F382425
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 278 | 238 | 556 | 370 |
Family's Representative Sequence
| Representative Sequence | 3300025909|Ga0207705_10000473|Ga0207705_1000047320 |
| Length | 364 |
| Sequence | MSNPLADLSAAGVAVWLDDLSRERLRSGNLADLVSNKHVVGVTTNPSIFQKALSDGAAYDEQVRDLALRGVDLGEAVRALTTYDVRWACDVLKLRYDASDGVDGRVSIEVDPRLAADTDRTVAEAEALWWLVDRPNLFIKIPATLEGLPAITEVLAHGISVNVTLIFGIERYKQVMDAFFAGMEQAKAGGHDITKMGSVASFFVSRVDTEVDKRLGDGHELRGKAAVANARLAYQAYEEAFASPRWKALEAAGAKRQRPLWASTGVKDPAYPDTMYVTELVAPGTVNTMPEATLDAVADHGVLRGNTIDGTYAEAHQLMDDLKAAGVDMDDVTEVLEREGVKKFEDSWQELLDSVTDQLAKARA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 28 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 33 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 105 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 106 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 108 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 111 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 116 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 117 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 118 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 121 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 122 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 124 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 125 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 126 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 127 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 128 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 129 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 132 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 133 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 134 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 135 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 136 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 137 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 138 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 139 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 140 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 183 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 184 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 185 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 186 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 187 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 215 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 216 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 217 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 218 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 219 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 220 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 221 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 224 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 225 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 226 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 227 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 228 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 229 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 230 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 231 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 232 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 233 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 234 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 235 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 236 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 237 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 238 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.88 |
| Metatranscriptomes | 1.08 |
| Isolates | 5.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.52 |
| Nodule | 1.08 |
| Rhizoplane | 8.99 |
| Rhizosphere | 79.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207705_10000473 | 3300025909 | Bacteria | 34432 |
| 2 | Ga0058862_12887079 | 3300004803 | Bacteria | 1731 |
| 3 | Ga0070658_10001723 | 3300005327 | Bacteria | 18454 |
| 4 | Ga0070683_100241463 | 3300005329 | Bacteria | 1718 |
| 5 | Ga0070680_100062164 | 3300005336 | Bacteria | 3057 |
| 6 | Ga0070682_100001465 | 3300005337 | Bacteria | 13239 |
| 7 | Ga0070682_100167980 | 3300005337 | Bacteria | 1522 |
| 8 | Ga0068868_100065750 | 3300005338 | Bacteria | 2881 |
| 9 | Ga0070660_100187289 | 3300005339 | Bacteria | 1676 |
| 10 | Ga0070691_10006477 | 3300005341 | Bacteria | 5354 |
| 11 | Ga0070687_100069620 | 3300005343 | Bacteria | 1885 |
| 12 | Ga0070692_10013348 | 3300005345 | Bacteria | 3826 |
| 13 | Ga0070671_100008566 | 3300005355 | Bacteria | 8200 |
| 14 | Ga0070688_100073040 | 3300005365 | Bacteria | 2200 |
| 15 | Ga0070667_100075817 | 3300005367 | Bacteria | 2872 |
| 16 | Ga0070709_10060231 | 3300005434 | Bacteria | 2412 |
| 17 | Ga0070700_100031800 | 3300005441 | Bacteria | 3166 |
| 18 | Ga0070663_100042859 | 3300005455 | Bacteria | 3182 |
| 19 | Ga0070663_100216609 | 3300005455 | Bacteria | 1501 |
| 20 | Ga0070678_100003005 | 3300005456 | Bacteria | 9347 |
| 21 | Ga0070662_100072434 | 3300005457 | Bacteria | 2544 |
| 22 | Ga0070684_100104649 | 3300005535 | Bacteria | 2532 |
| 23 | Ga0068853_100090301 | 3300005539 | Bacteria | 2692 |
| 24 | Ga0070693_100109540 | 3300005547 | Bacteria | 1696 |
| 25 | Ga0068857_100238450 | 3300005577 | Bacteria | 1665 |
| 26 | Ga0068856_100005516 | 3300005614 | Bacteria | 12458 |
| 27 | Ga0068856_100331046 | 3300005614 | Bacteria | 1540 |
| 28 | Ga0070702_100000444 | 3300005615 | Bacteria | 14693 |
| 29 | Ga0068859_100030366 | 3300005617 | Bacteria | 5423 |
| 30 | Ga0068859_100037569 | 3300005617 | Bacteria | 4860 |
| 31 | Ga0068859_100208426 | 3300005617 | Bacteria | 2041 |
| 32 | Ga0068851_10106691 | 3300005834 | Bacteria | 1491 |
| 33 | Ga0068870_10003448 | 3300005840 | Bacteria | 6704 |
| 34 | Ga0068863_100006617 | 3300005841 | Bacteria | 11377 |
| 35 | Ga0068858_100006939 | 3300005842 | Bacteria | 11009 |
| 36 | Ga0068860_100323209 | 3300005843 | Bacteria | 1515 |
| 37 | Ga0081455_10007766 | 3300005937 | Bacteria | 11246 |
| 38 | Ga0081538_10000092 | 3300005981 | Bacteria | 87123 |
| 39 | Ga0081540_1066951 | 3300005983 | Bacteria | 1680 |
| 40 | Ga0070717_10056351 | 3300006028 | Bacteria | 3247 |
| 41 | Ga0068871_100103810 | 3300006358 | Bacteria | 2384 |
| 42 | Ga0075428_100113076 | 3300006844 | Bacteria | 2957 |
| 43 | Ga0075431_100006072 | 3300006847 | Bacteria | 11976 |
| 44 | Ga0075431_100056774 | 3300006847 | Bacteria | 4038 |
| 45 | Ga0075433_10002952 | 3300006852 | Bacteria | 13056 |
| 46 | Ga0075434_100015482 | 3300006871 | Bacteria | 7315 |
| 47 | Ga0075436_100003834 | 3300006914 | Bacteria | 10314 |
| 48 | Ga0097620_100030367 | 3300006931 | Bacteria | 5423 |
| 49 | Ga0097620_100037569 | 3300006931 | Bacteria | 4860 |
| 50 | Ga0097620_100208421 | 3300006931 | Bacteria | 2041 |
| 51 | Ga0075435_100034321 | 3300007076 | Bacteria | 4019 |
| 52 | Ga0111539_10277494 | 3300009094 | Bacteria | 1950 |
| 53 | Ga0105245_10047297 | 3300009098 | Bacteria | 3846 |
| 54 | Ga0105247_10021108 | 3300009101 | Bacteria | 3917 |
| 55 | Ga0105243_10143374 | 3300009148 | Bacteria | 2041 |
| 56 | Ga0105241_10143784 | 3300009174 | Bacteria | 1945 |
| 57 | Ga0105248_10105701 | 3300009177 | Bacteria | 3174 |
| 58 | Ga0105248_10260107 | 3300009177 | Bacteria | 1954 |
| 59 | Ga0105237_10088333 | 3300009545 | Bacteria | 3089 |
| 60 | Ga0105238_10086111 | 3300009551 | Bacteria | 3129 |
| 61 | Ga0105239_10589199 | 3300010375 | Bacteria | 1268 |
| 62 | Ga0105246_10060988 | 3300011119 | Bacteria | 2622 |
| 63 | Ga0157373_10021947 | 3300013100 | Bacteria | 4632 |
| 64 | Ga0157371_10017348 | 3300013102 | Bacteria | 5351 |
| 65 | Ga0157370_10042186 | 3300013104 | Bacteria | 4398 |
| 66 | Ga0157369_10006508 | 3300013105 | Bacteria | 13538 |
| 67 | Ga0157369_10025796 | 3300013105 | Bacteria | 6519 |
| 68 | Ga0157369_10456455 | 3300013105 | Bacteria | 1323 |
| 69 | Ga0163162_10036949 | 3300013306 | Bacteria | 4872 |
| 70 | Ga0157372_10033036 | 3300013307 | Bacteria | 5680 |
| 71 | Ga0157372_10496747 | 3300013307 | Bacteria | 1423 |
| 72 | Ga0157375_10018958 | 3300013308 | Bacteria | 6246 |
| 73 | Ga0163163_10049151 | 3300014325 | Bacteria | 4149 |
| 74 | Ga0157377_10014792 | 3300014745 | Bacteria | 3978 |
| 75 | Ga0206350_10857868 | 3300020080 | Bacteria | 1924 |
| 76 | Ga0224712_10052621 | 3300022467 | Bacteria | 1591 |
| 77 | Ga0207656_10007358 | 3300025321 | Bacteria | 4005 |
| 78 | Ga0207692_10097233 | 3300025898 | Bacteria | 1609 |
| 79 | Ga0207688_10006110 | 3300025901 | Bacteria | 6551 |
| 80 | Ga0207647_10092589 | 3300025904 | Bacteria | 1802 |
| 81 | Ga0207699_10007139 | 3300025906 | Bacteria | 5449 |
| 82 | Ga0207643_10001745 | 3300025908 | Bacteria | 12180 |
| 83 | Ga0207705_10004764 | 3300025909 | Bacteria | 10220 |
| 84 | Ga0207684_10026373 | 3300025910 | Bacteria | 4954 |
| 85 | Ga0207707_10057021 | 3300025912 | Bacteria | 3400 |
| 86 | Ga0207660_10055741 | 3300025917 | Bacteria | 2826 |
| 87 | Ga0207660_10164051 | 3300025917 | Bacteria | 1716 |
| 88 | Ga0207660_10205361 | 3300025917 | Bacteria | 1540 |
| 89 | Ga0207662_10010381 | 3300025918 | Bacteria | 5141 |
| 90 | Ga0207657_10030263 | 3300025919 | Bacteria | 4915 |
| 91 | Ga0207649_10002369 | 3300025920 | Bacteria | 10566 |
| 92 | Ga0207652_10056118 | 3300025921 | Bacteria | 3390 |
| 93 | Ga0207650_10007243 | 3300025925 | Bacteria | 7557 |
| 94 | Ga0207659_10152233 | 3300025926 | Bacteria | 1807 |
| 95 | Ga0207687_10004401 | 3300025927 | Bacteria | 9400 |
| 96 | Ga0207687_10087080 | 3300025927 | Bacteria | 2269 |
| 97 | Ga0207700_10018220 | 3300025928 | Bacteria | 4713 |
| 98 | Ga0207700_10087525 | 3300025928 | Bacteria | 2450 |
| 99 | Ga0207644_10011890 | 3300025931 | Bacteria | 5769 |
| 100 | Ga0207690_10001866 | 3300025932 | Bacteria | 12955 |
| 101 | Ga0207706_10086534 | 3300025933 | Bacteria | 2755 |
| 102 | Ga0207665_10002567 | 3300025939 | Bacteria | 12196 |
| 103 | Ga0207689_10000187 | 3300025942 | Bacteria | 53919 |
| 104 | Ga0207679_10132740 | 3300025945 | Bacteria | 2000 |
| 105 | Ga0207667_10124621 | 3300025949 | Bacteria | 2654 |
| 106 | Ga0207658_10203160 | 3300025986 | Bacteria | 1656 |
| 107 | Ga0207677_10023247 | 3300026023 | Bacteria | 3824 |
| 108 | Ga0207703_10157834 | 3300026035 | Bacteria | 1984 |
| 109 | Ga0207703_10259891 | 3300026035 | Bacteria | 1569 |
| 110 | Ga0207639_10218046 | 3300026041 | Bacteria | 1646 |
| 111 | Ga0207678_10135734 | 3300026067 | Bacteria | 2099 |
| 112 | Ga0207708_10013603 | 3300026075 | Bacteria | 6081 |
| 113 | Ga0207702_10015901 | 3300026078 | Bacteria | 6230 |
| 114 | Ga0207702_10017907 | 3300026078 | Bacteria | 5862 |
| 115 | Ga0207641_10007961 | 3300026088 | Bacteria | 8783 |
| 116 | Ga0207676_10025263 | 3300026095 | Bacteria | 4407 |
| 117 | Ga0207675_100179038 | 3300026118 | Bacteria | 2030 |
| 118 | Ga0207675_100407123 | 3300026118 | Bacteria | 1341 |
| 119 | Ga0207683_10000594 | 3300026121 | Bacteria | 33332 |
| 120 | Ga0207698_10088369 | 3300026142 | Bacteria | 2527 |
| 121 | Ga0207428_10008241 | 3300027907 | Bacteria | 9425 |
| 122 | Ga0268266_10012724 | 3300028379 | Bacteria | 7272 |
| 123 | Ga0268265_10121760 | 3300028380 | Bacteria | 2151 |
| 124 | Ga0307517_10043236 | 3300028786 | Bacteria | 4805 |
| 125 | Ga0307515_10076859 | 3300028794 | Bacteria | 4419 |
| 126 | Ga0265338_10001554 | 3300028800 | Bacteria | 37076 |
| 127 | Ga0307512_10003523 | 3300030522 | Bacteria | 18089 |
| 128 | Ga0307512_10098703 | 3300030522 | Bacteria | 1992 |
| 129 | Ga0307509_10019139 | 3300031507 | Bacteria | 7826 |
| 130 | Ga0307408_100128747 | 3300031548 | Bacteria | 1972 |
| 131 | Ga0307508_10009064 | 3300031616 | Bacteria | 9166 |
| 132 | Ga0307508_10036384 | 3300031616 | Bacteria | 4433 |
| 133 | Ga0316576_10001302 | 3300031727 | Bacteria | 13243 |
| 134 | Ga0307413_10002380 | 3300031824 | Bacteria | 7635 |
| 135 | Ga0307518_10000054 | 3300031838 | Bacteria | 76765 |
| 136 | Ga0307410_10133558 | 3300031852 | Bacteria | 1826 |
| 137 | Ga0307409_100009164 | 3300031995 | Bacteria | 6067 |
| 138 | Ga0307409_100188724 | 3300031995 | Bacteria | 1832 |
| 139 | Ga0307416_100054362 | 3300032002 | Bacteria | 3218 |
| 140 | Ga0373926_0003126 | 3300035083 | Bacteria | 5311 |
| 141 | Ga0373944_0012680 | 3300035089 | Bacteria | 2327 |
| 142 | Ga0373951_0000068 | 3300035091 | Bacteria | 41054 |
| 143 | Ga0373923_0008346 | 3300035111 | Bacteria | 3688 |
| 144 | Ga0373936_0001271 | 3300035113 | Bacteria | 9117 |
| 145 | Ga0373945_0005583 | 3300035116 | Bacteria | 4033 |
| 146 | Ga0373957_0001229 | 3300035120 | Bacteria | 6847 |
| 147 | Ga0373943_0010661 | 3300035170 | Bacteria | 4124 |
| 148 | Ga0373946_0008161 | 3300035171 | Bacteria | 3843 |
| 149 | Ga0373935_0022501 | 3300035692 | Bacteria | 3866 |
| 150 | Ga0373935_0029565 | 3300035692 | Bacteria | 3391 |
| 151 | Ga0373927_0034805 | 3300035695 | Bacteria | 3275 |
| 152 | Ga0373947_0047488 | 3300035725 | Bacteria | 2572 |
| 153 | Ga0373937_0307672 | 3300036401 | Bacteria | 1498 |
| 154 | Ga0373925_0019776 | 3300037068 | Bacteria | 4901 |
| 155 | Ga0400486_20001 | 3300038742 | Bacteria | 106597 |
| 156 | Ga0451793_1475822 | 3300041452 | Bacteria | 1698 |
| 157 | Ga0439464_0005090 | 3300042439 | Bacteria | 3385 |
| 158 | Ga0466965_0005956 | 3300044683 | Bacteria | 5509 |
| 159 | Ga0466965_0025434 | 3300044683 | Bacteria | 2865 |
| 160 | Ga0466970_0043453 | 3300044765 | Bacteria | 2391 |
| 161 | Ga0466957_0030086 | 3300044842 | Bacteria | 3241 |
| 162 | Ga0466960_0014785 | 3300044901 | Bacteria | 3352 |
| 163 | Ga0466958_0003152 | 3300045836 | Bacteria | 8484 |
| 164 | Ga0466958_0024669 | 3300045836 | Bacteria | 3538 |
| 165 | Ga0466967_0017324 | 3300045976 | Bacteria | 5715 |
| 166 | Ga0466967_0059633 | 3300045976 | Bacteria | 3379 |
| 167 | Ga0495592_0045530 | 3300046454 | Bacteria | 3273 |
| 168 | Ga0495603_0077524 | 3300046455 | Bacteria | 1949 |
| 169 | Ga0495629_0005291 | 3300046459 | Bacteria | 9646 |
| 170 | Ga0495641_0005480 | 3300046461 | Bacteria | 8560 |
| 171 | Ga0495651_0065586 | 3300046462 | Bacteria | 2772 |
| 172 | Ga0495582_0047503 | 3300046473 | Bacteria | 2364 |
| 173 | Ga0495662_0001206 | 3300046476 | Bacteria | 12758 |
| 174 | Ga0495594_0035745 | 3300046499 | Bacteria | 2707 |
| 175 | Ga0495618_0026396 | 3300046514 | Bacteria | 3610 |
| 176 | Ga0495630_0010957 | 3300046517 | Bacteria | 6551 |
| 177 | Ga0495666_0002454 | 3300046526 | Bacteria | 9207 |
| 178 | Ga0495586_0002818 | 3300046535 | Bacteria | 9384 |
| 179 | Ga0495587_0019852 | 3300046536 | Bacteria | 4153 |
| 180 | Ga0495645_0119092 | 3300046543 | Bacteria | 1860 |
| 181 | Ga0495634_0004216 | 3300046642 | Bacteria | 11348 |
| 182 | Ga0495657_0045713 | 3300046675 | Bacteria | 2969 |
| 183 | Ga0495623_0004486 | 3300046679 | Bacteria | 9170 |
| 184 | Ga0495623_0030272 | 3300046679 | Bacteria | 3482 |
| 185 | Ga0495646_0026457 | 3300046680 | Bacteria | 3643 |
| 186 | Ga0495647_0039707 | 3300046681 | Bacteria | 1785 |
| 187 | Ga0495658_0001876 | 3300046683 | Bacteria | 10731 |
| 188 | Ga0495613_0069570 | 3300046689 | Bacteria | 2565 |
| 189 | Ga0495600_0002108 | 3300046809 | Bacteria | 11250 |
| 190 | Ga0495581_0023006 | 3300047315 | Bacteria | 3610 |
| 191 | Ga0495604_0036985 | 3300047317 | Bacteria | 3846 |
| 192 | Ga0495674_0043208 | 3300047319 | Bacteria | 4012 |
| 193 | Ga0495680_0029967 | 3300047322 | Bacteria | 4448 |
| 194 | Ga0495593_0017233 | 3300047673 | Bacteria | 4064 |
| 195 | Ga0495614_0026961 | 3300048089 | Bacteria | 2477 |
| 196 | Ga0496100_0012032 | 3300048903 | Bacteria | 4946 |
| 197 | Ga0496101_0103897 | 3300048904 | Bacteria | 2130 |
| 198 | Ga0496102_0026917 | 3300048905 | Bacteria | 5134 |
| 199 | Ga0496102_0074539 | 3300048905 | Bacteria | 3119 |
| 200 | Ga0496102_0232530 | 3300048905 | Bacteria | 1738 |
| 201 | Ga0496103_0003139 | 3300048906 | Bacteria | 10164 |
| 202 | Ga0496103_0107952 | 3300048906 | Bacteria | 1766 |
| 203 | Ga0496104_0092547 | 3300048907 | Bacteria | 2890 |
| 204 | Ga0496105_0010933 | 3300048908 | Bacteria | 7150 |
| 205 | Ga0496105_0111590 | 3300048908 | Bacteria | 2256 |
| 206 | Ga0496106_0013298 | 3300048909 | Bacteria | 6076 |
| 207 | Ga0496106_0138126 | 3300048909 | Bacteria | 1916 |
| 208 | Ga0496109_0011417 | 3300048912 | Bacteria | 7635 |
| 209 | Ga0496109_0431993 | 3300048912 | Bacteria | 1244 |
| 210 | Ga0496110_0005781 | 3300048913 | Bacteria | 9721 |
| 211 | Ga0496110_0127184 | 3300048913 | Bacteria | 2299 |
| 212 | Ga0496111_0004085 | 3300048914 | Bacteria | 9167 |
| 213 | Ga0496112_0030392 | 3300048915 | Bacteria | 5227 |
| 214 | Ga0496112_0218149 | 3300048915 | Bacteria | 1864 |
| 215 | Ga0496113_0005979 | 3300048916 | Bacteria | 7657 |
| 216 | Ga0496113_0153662 | 3300048916 | Bacteria | 1816 |
| 217 | Ga0496114_0061433 | 3300048917 | Bacteria | 3143 |
| 218 | Ga0496115_0012979 | 3300048918 | Bacteria | 6285 |
| 219 | Ga0496115_0284012 | 3300048918 | Bacteria | 1358 |
| 220 | Ga0496117_0001264 | 3300048920 | Bacteria | 37571 |
| 221 | Ga0496119_0006780 | 3300048922 | Bacteria | 10503 |
| 222 | Ga0496120_0047308 | 3300048923 | Bacteria | 2481 |
| 223 | Ga0496122_0000120 | 3300048925 | Bacteria | 182539 |
| 224 | Ga0496123_0000051 | 3300048926 | Bacteria | 237095 |
| 225 | Ga0501031_0025254 | 3300049568 | Bacteria | 3876 |
| 226 | Ga0501032_0076122 | 3300049569 | Bacteria | 2235 |
| 227 | Ga0501036_0067525 | 3300049572 | Bacteria | 3025 |
| 228 | Ga0501037_0118137 | 3300049573 | Bacteria | 1908 |
| 229 | Ga0501038_0050287 | 3300049574 | Bacteria | 3602 |
| 230 | Ga0501040_0013096 | 3300049576 | Bacteria | 5454 |
| 231 | Ga0501041_0032086 | 3300049577 | Bacteria | 3174 |
| 232 | Ga0501046_0075012 | 3300049580 | Bacteria | 2623 |
| 233 | Ga0501047_0198449 | 3300049581 | Bacteria | 1868 |
| 234 | Ga0501071_0025810 | 3300049587 | Bacteria | 4118 |
| 235 | Ga0501072_0023176 | 3300049588 | Bacteria | 4821 |
| 236 | Ga0501075_0011937 | 3300049591 | Bacteria | 6163 |
| 237 | Ga0501076_0015769 | 3300049592 | Bacteria | 5715 |
| 238 | Ga0501077_0152361 | 3300049593 | Bacteria | 1467 |
| 239 | Ga0501079_0013685 | 3300049741 | Bacteria | 6187 |
| 240 | Ga0501081_0027080 | 3300049743 | Bacteria | 3869 |
| 241 | Ga0501035_0047812 | 3300049822 | Bacteria | 3839 |
| 242 | Ga0501045_0007370 | 3300049824 | Bacteria | 7647 |
| 243 | nmdc:mga0qj67_91129_c1 | 3300050509 | Bacteria | 2450 |
| 244 | nmdc:mga06r32_656_c1 | 3300050510 | Bacteria | 30201 |
| 245 | nmdc:mga08y16_38704_c1 | 3300050511 | Bacteria | 5006 |
| 246 | nmdc:mga08y16_624242_c1 | 3300050511 | Bacteria | 1084 |
| 247 | nmdc:mga0n895_180617_c1 | 3300050512 | Bacteria | 2141 |
| 248 | nmdc:mga0n895_232597_c1 | 3300050512 | Bacteria | 1871 |
| 249 | nmdc:mga0rr50_41469_c1 | 3300050513 | Bacteria | 3355 |
| 250 | nmdc:mga08x19_4505_c1 | 3300050514 | Bacteria | 8255 |
| 251 | Ga0495601_0091485 | 3300053077 | Bacteria | 1958 |
| 252 | Ga0495612_0002948 | 3300053078 | Bacteria | 7061 |
| 253 | Ga0495595_0002685 | 3300053084 | Bacteria | 6981 |
| 254 | Ga0500646_0000810 | 3300053090 | Bacteria | 8679 |
| 255 | Ga0500583_0029056 | 3300053092 | Bacteria | 2405 |
| 256 | Ga0500641_0009869 | 3300053096 | Bacteria | 3439 |
| 257 | Ga0500569_011001 | 3300053109 | Bacteria | 2149 |
| 258 | Ga0500594_0005547 | 3300053118 | Bacteria | 2800 |
| 259 | Ga0500588_0015654 | 3300053146 | Bacteria | 1946 |
| 260 | Ga0500600_0073376 | 3300053149 | Bacteria | 1870 |
| 261 | Ga0501084_0059761 | 3300054114 | Bacteria | 3191 |
| 262 | Ga0501082_0011028 | 3300060353 | Bacteria | 7772 |
| 263 | Ga0466962_0013381 | 3300061719 | Bacteria | 3949 |
| 264 | Ga0530510_0026107 | 3300061734 | Bacteria | 4178 |
| 265 | 2559425023 | 2558860280 | Bacteria | 11429938 |
| 266 | 2586062274 | 2585427649 | Bacteria | 9053857 |
| 267 | 2644081581 | 2643221613 | Bacteria | 4622396 |
| 268 | 2644666215 | 2643221721 | Bacteria | 4486924 |
| 269 | 2676199652 | 2675902999 | Bacteria | 9438463 |
| 270 | 2689956472 | 2687453737 | Bacteria | 11203906 |
| 271 | 2753268167 | 2751185782 | Bacteria | 11227053 |
| 272 | 2774399768 | 2773857763 | Bacteria | 4180068 |
| 273 | 2774844230 | 2773857921 | Bacteria | 9435764 |
| 274 | 2795797775 | 2795385472 | Bacteria | 6627535 |
| 275 | 2935891162 | 2935890801 | Bacteria | 4593001 |
| 276 | 2977231129 | 2977228692 | Bacteria | 3450105 |
| 277 | 8004214096 | 8004212874 | Bacteria | 2861420 |
| 278 | 8045830949 | 8045830549 | Bacteria | 4444727 |
| 279 | Ga0207705_10000473 | |||
| 280 | Ga0058862_12887079 | |||
| 281 | Ga0070658_10001723 | |||
| 282 | Ga0070683_100241463 | |||
| 283 | Ga0070680_100062164 | |||
| 284 | Ga0070682_100001465 | |||
| 285 | Ga0070682_100167980 | |||
| 286 | Ga0068868_100065750 | |||
| 287 | Ga0070660_100187289 | |||
| 288 | Ga0070691_10006477 | |||
| 289 | Ga0070687_100069620 | |||
| 290 | Ga0070692_10013348 | |||
| 291 | Ga0070671_100008566 | |||
| 292 | Ga0070688_100073040 | |||
| 293 | Ga0070667_100075817 | |||
| 294 | Ga0070709_10060231 | |||
| 295 | Ga0070700_100031800 | |||
| 296 | Ga0070663_100042859 | |||
| 297 | Ga0070663_100216609 | |||
| 298 | Ga0070678_100003005 | |||
| 299 | Ga0070662_100072434 | |||
| 300 | Ga0070684_100104649 | |||
| 301 | Ga0068853_100090301 | |||
| 302 | Ga0070693_100109540 | |||
| 303 | Ga0068857_100238450 | |||
| 304 | Ga0068856_100005516 | |||
| 305 | Ga0068856_100331046 | |||
| 306 | Ga0070702_100000444 | |||
| 307 | Ga0068859_100030366 | |||
| 308 | Ga0068859_100037569 | |||
| 309 | Ga0068859_100208426 | |||
| 310 | Ga0068851_10106691 | |||
| 311 | Ga0068870_10003448 | |||
| 312 | Ga0068863_100006617 | |||
| 313 | Ga0068858_100006939 | |||
| 314 | Ga0068860_100323209 | |||
| 315 | Ga0081455_10007766 | |||
| 316 | Ga0081538_10000092 | |||
| 317 | Ga0081540_1066951 | |||
| 318 | Ga0070717_10056351 | |||
| 319 | Ga0068871_100103810 | |||
| 320 | Ga0075428_100113076 | |||
| 321 | Ga0075431_100006072 | |||
| 322 | Ga0075431_100056774 | |||
| 323 | Ga0075433_10002952 | |||
| 324 | Ga0075434_100015482 | |||
| 325 | Ga0075436_100003834 | |||
| 326 | Ga0097620_100030367 | |||
| 327 | Ga0097620_100037569 | |||
| 328 | Ga0097620_100208421 | |||
| 329 | Ga0075435_100034321 | |||
| 330 | Ga0111539_10277494 | |||
| 331 | Ga0105245_10047297 | |||
| 332 | Ga0105247_10021108 | |||
| 333 | Ga0105243_10143374 | |||
| 334 | Ga0105241_10143784 | |||
| 335 | Ga0105248_10105701 | |||
| 336 | Ga0105248_10260107 | |||
| 337 | Ga0105237_10088333 | |||
| 338 | Ga0105238_10086111 | |||
| 339 | Ga0105239_10589199 | |||
| 340 | Ga0105246_10060988 | |||
| 341 | Ga0157373_10021947 | |||
| 342 | Ga0157371_10017348 | |||
| 343 | Ga0157370_10042186 | |||
| 344 | Ga0157369_10006508 | |||
| 345 | Ga0157369_10025796 | |||
| 346 | Ga0157369_10456455 | |||
| 347 | Ga0163162_10036949 | |||
| 348 | Ga0157372_10033036 | |||
| 349 | Ga0157372_10496747 | |||
| 350 | Ga0157375_10018958 | |||
| 351 | Ga0163163_10049151 | |||
| 352 | Ga0157377_10014792 | |||
| 353 | Ga0206350_10857868 | |||
| 354 | Ga0224712_10052621 | |||
| 355 | Ga0207656_10007358 | |||
| 356 | Ga0207692_10097233 | |||
| 357 | Ga0207688_10006110 | |||
| 358 | Ga0207647_10092589 | |||
| 359 | Ga0207699_10007139 | |||
| 360 | Ga0207643_10001745 | |||
| 361 | Ga0207705_10004764 | |||
| 362 | Ga0207684_10026373 | |||
| 363 | Ga0207707_10057021 | |||
| 364 | Ga0207660_10055741 | |||
| 365 | Ga0207660_10164051 | |||
| 366 | Ga0207660_10205361 | |||
| 367 | Ga0207662_10010381 | |||
| 368 | Ga0207657_10030263 | |||
| 369 | Ga0207649_10002369 | |||
| 370 | Ga0207652_10056118 | |||
| 371 | Ga0207650_10007243 | |||
| 372 | Ga0207659_10152233 | |||
| 373 | Ga0207687_10004401 | |||
| 374 | Ga0207687_10087080 | |||
| 375 | Ga0207700_10018220 | |||
| 376 | Ga0207700_10087525 | |||
| 377 | Ga0207644_10011890 | |||
| 378 | Ga0207690_10001866 | |||
| 379 | Ga0207706_10086534 | |||
| 380 | Ga0207665_10002567 | |||
| 381 | Ga0207689_10000187 | |||
| 382 | Ga0207679_10132740 | |||
| 383 | Ga0207667_10124621 | |||
| 384 | Ga0207658_10203160 | |||
| 385 | Ga0207677_10023247 | |||
| 386 | Ga0207703_10157834 | |||
| 387 | Ga0207703_10259891 | |||
| 388 | Ga0207639_10218046 | |||
| 389 | Ga0207678_10135734 | |||
| 390 | Ga0207708_10013603 | |||
| 391 | Ga0207702_10015901 | |||
| 392 | Ga0207702_10017907 | |||
| 393 | Ga0207641_10007961 | |||
| 394 | Ga0207676_10025263 | |||
| 395 | Ga0207675_100179038 | |||
| 396 | Ga0207675_100407123 | |||
| 397 | Ga0207683_10000594 | |||
| 398 | Ga0207698_10088369 | |||
| 399 | Ga0207428_10008241 | |||
| 400 | Ga0268266_10012724 | |||
| 401 | Ga0268265_10121760 | |||
| 402 | Ga0307517_10043236 | |||
| 403 | Ga0307515_10076859 | |||
| 404 | Ga0265338_10001554 | |||
| 405 | Ga0307512_10003523 | |||
| 406 | Ga0307512_10098703 | |||
| 407 | Ga0307509_10019139 | |||
| 408 | Ga0307408_100128747 | |||
| 409 | Ga0307508_10009064 | |||
| 410 | Ga0307508_10036384 | |||
| 411 | Ga0316576_10001302 | |||
| 412 | Ga0307413_10002380 | |||
| 413 | Ga0307518_10000054 | |||
| 414 | Ga0307410_10133558 | |||
| 415 | Ga0307409_100009164 | |||
| 416 | Ga0307409_100188724 | |||
| 417 | Ga0307416_100054362 | |||
| 418 | Ga0373926_0003126 | |||
| 419 | Ga0373944_0012680 | |||
| 420 | Ga0373951_0000068 | |||
| 421 | Ga0373923_0008346 | |||
| 422 | Ga0373936_0001271 | |||
| 423 | Ga0373945_0005583 | |||
| 424 | Ga0373957_0001229 | |||
| 425 | Ga0373943_0010661 | |||
| 426 | Ga0373946_0008161 | |||
| 427 | Ga0373935_0022501 | |||
| 428 | Ga0373935_0029565 | |||
| 429 | Ga0373927_0034805 | |||
| 430 | Ga0373947_0047488 | |||
| 431 | Ga0373937_0307672 | |||
| 432 | Ga0373925_0019776 | |||
| 433 | Ga0400486_20001 | |||
| 434 | Ga0451793_1475822 | |||
| 435 | Ga0439464_0005090 | |||
| 436 | Ga0466965_0005956 | |||
| 437 | Ga0466965_0025434 | |||
| 438 | Ga0466970_0043453 | |||
| 439 | Ga0466957_0030086 | |||
| 440 | Ga0466960_0014785 | |||
| 441 | Ga0466958_0003152 | |||
| 442 | Ga0466958_0024669 | |||
| 443 | Ga0466967_0017324 | |||
| 444 | Ga0466967_0059633 | |||
| 445 | Ga0495592_0045530 | |||
| 446 | Ga0495603_0077524 | |||
| 447 | Ga0495629_0005291 | |||
| 448 | Ga0495641_0005480 | |||
| 449 | Ga0495651_0065586 | |||
| 450 | Ga0495582_0047503 | |||
| 451 | Ga0495662_0001206 | |||
| 452 | Ga0495594_0035745 | |||
| 453 | Ga0495618_0026396 | |||
| 454 | Ga0495630_0010957 | |||
| 455 | Ga0495666_0002454 | |||
| 456 | Ga0495586_0002818 | |||
| 457 | Ga0495587_0019852 | |||
| 458 | Ga0495645_0119092 | |||
| 459 | Ga0495634_0004216 | |||
| 460 | Ga0495657_0045713 | |||
| 461 | Ga0495623_0004486 | |||
| 462 | Ga0495623_0030272 | |||
| 463 | Ga0495646_0026457 | |||
| 464 | Ga0495647_0039707 | |||
| 465 | Ga0495658_0001876 | |||
| 466 | Ga0495613_0069570 | |||
| 467 | Ga0495600_0002108 | |||
| 468 | Ga0495581_0023006 | |||
| 469 | Ga0495604_0036985 | |||
| 470 | Ga0495674_0043208 | |||
| 471 | Ga0495680_0029967 | |||
| 472 | Ga0495593_0017233 | |||
| 473 | Ga0495614_0026961 | |||
| 474 | Ga0496100_0012032 | |||
| 475 | Ga0496101_0103897 | |||
| 476 | Ga0496102_0026917 | |||
| 477 | Ga0496102_0074539 | |||
| 478 | Ga0496102_0232530 | |||
| 479 | Ga0496103_0003139 | |||
| 480 | Ga0496103_0107952 | |||
| 481 | Ga0496104_0092547 | |||
| 482 | Ga0496105_0010933 | |||
| 483 | Ga0496105_0111590 | |||
| 484 | Ga0496106_0013298 | |||
| 485 | Ga0496106_0138126 | |||
| 486 | Ga0496109_0011417 | |||
| 487 | Ga0496109_0431993 | |||
| 488 | Ga0496110_0005781 | |||
| 489 | Ga0496110_0127184 | |||
| 490 | Ga0496111_0004085 | |||
| 491 | Ga0496112_0030392 | |||
| 492 | Ga0496112_0218149 | |||
| 493 | Ga0496113_0005979 | |||
| 494 | Ga0496113_0153662 | |||
| 495 | Ga0496114_0061433 | |||
| 496 | Ga0496115_0012979 | |||
| 497 | Ga0496115_0284012 | |||
| 498 | Ga0496117_0001264 | |||
| 499 | Ga0496119_0006780 | |||
| 500 | Ga0496120_0047308 | |||
| 501 | Ga0496122_0000120 | |||
| 502 | Ga0496123_0000051 | |||
| 503 | Ga0501031_0025254 | |||
| 504 | Ga0501032_0076122 | |||
| 505 | Ga0501036_0067525 | |||
| 506 | Ga0501037_0118137 | |||
| 507 | Ga0501038_0050287 | |||
| 508 | Ga0501040_0013096 | |||
| 509 | Ga0501041_0032086 | |||
| 510 | Ga0501046_0075012 | |||
| 511 | Ga0501047_0198449 | |||
| 512 | Ga0501071_0025810 | |||
| 513 | Ga0501072_0023176 | |||
| 514 | Ga0501075_0011937 | |||
| 515 | Ga0501076_0015769 | |||
| 516 | Ga0501077_0152361 | |||
| 517 | Ga0501079_0013685 | |||
| 518 | Ga0501081_0027080 | |||
| 519 | Ga0501035_0047812 | |||
| 520 | Ga0501045_0007370 | |||
| 521 | nmdc:mga0qj67_91129_c1 | |||
| 522 | nmdc:mga06r32_656_c1 | |||
| 523 | nmdc:mga08y16_38704_c1 | |||
| 524 | nmdc:mga08y16_624242_c1 | |||
| 525 | nmdc:mga0n895_180617_c1 | |||
| 526 | nmdc:mga0n895_232597_c1 | |||
| 527 | nmdc:mga0rr50_41469_c1 | |||
| 528 | nmdc:mga08x19_4505_c1 | |||
| 529 | Ga0495601_0091485 | |||
| 530 | Ga0495612_0002948 | |||
| 531 | Ga0495595_0002685 | |||
| 532 | Ga0500646_0000810 | |||
| 533 | Ga0500583_0029056 | |||
| 534 | Ga0500641_0009869 | |||
| 535 | Ga0500569_011001 | |||
| 536 | Ga0500594_0005547 | |||
| 537 | Ga0500588_0015654 | |||
| 538 | Ga0500600_0073376 | |||
| 539 | Ga0501084_0059761 | |||
| 540 | Ga0501082_0011028 | |||
| 541 | Ga0466962_0013381 | |||
| 542 | Ga0530510_0026107 | |||
| 543 | 2559425023 | |||
| 544 | 2586062274 | |||
| 545 | 2644081581 | |||
| 546 | 2644666215 | |||
| 547 | 2676199652 | |||
| 548 | 2689956472 | |||
| 549 | 2753268167 | |||
| 550 | 2774399768 | |||
| 551 | 2774844230 | |||
| 552 | 2795797775 | |||
| 553 | 2935891162 | |||
| 554 | 2977231129 | |||
| 555 | 8004214096 | |||
| 556 | 8045830949 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7oey-assembly1.cif.gz_B | neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution | 0.978 | 5 | 361 |
| 7bbw-assembly2.cif.gz_B | neisseria gonorrhoeae transaldolase, variant c38s | 0.9759 | 5 | 361 |
| 7bbx-assembly1.cif.gz_A | neisseria gonorrhoeae transaldolase, variant k8a | 0.9741 | 5 | 361 |
| 3r5e-assembly1.cif.gz_A | transaldolase from corynebacterium glutamicum | 0.9719 | 3 | 365 |
| 7odq-assembly1.cif.gz_A | neisseria gonorrhoeae transaldolase at 5.4 mgy dose | 0.9715 | 5 | 361 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FRC9_66_421_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9767 | 6 | 361 | 3.20.20.70 |
| 3r5eA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9719 | 3 | 365 | 3.20.20.70 |
| af_K7L4A2_15_219_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9718 | 52 | 253 | 3.20.20.70 |
| 3clmA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9711 | 5 | 361 | 3.20.20.70 |
| af_I1JM01_1_306_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9699 | 66 | 362 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G3XGD8-F1-model_v4 | transaldolase (EC 2.2.1.2) | 1.005 | 92 | 173 |
GO:0004801
GO:0005737 GO:0005975 GO:0006098 |
| AF-A0A6B3CHQ4-F1-model_v4 | Transaldolase (EC 2.2.1.2) | 1.004 | 135 | 205 |
GO:0004801
GO:0005737 GO:0005975 |
| AF-A0A3C1DZE4-F1-model_v4 | transaldolase (EC 2.2.1.2) | 1.003 | 97 | 194 |
GO:0004801
GO:0005737 GO:0005975 GO:0006098 |
| AF-A0A505D201-F1-model_v4 | Transaldolase (EC 2.2.1.2) | 0.9998 | 89 | 283 |
GO:0004801
GO:0005737 GO:0005975 GO:0006098 |
| AF-A0A4Y8YCC9-F1-model_v4 | deleted | 0.9997 | 116 | 235 |
|