F382425

General Info

Members Datasets Scaffolds Average Seq Length
278 238 556 370

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10000473|Ga0207705_1000047320
Length 364
Sequence MSNPLADLSAAGVAVWLDDLSRERLRSGNLADLVSNKHVVGVTTNPSIFQKALSDGAAYDEQVRDLALRGVDLGEAVRALTTYDVRWACDVLKLRYDASDGVDGRVSIEVDPRLAADTDRTVAEAEALWWLVDRPNLFIKIPATLEGLPAITEVLAHGISVNVTLIFGIERYKQVMDAFFAGMEQAKAGGHDITKMGSVASFFVSRVDTEVDKRLGDGHELRGKAAVANARLAYQAYEEAFASPRWKALEAAGAKRQRPLWASTGVKDPAYPDTMYVTELVAPGTVNTMPEATLDAVADHGVLRGNTIDGTYAEAHQLMDDLKAAGVDMDDVTEVLEREGVKKFEDSWQELLDSVTDQLAKARA

Samples

Sample ID Description Type Environment
1 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
132 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
215 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
218 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
219 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
220 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
225 2558860280 Kutzneria sp. 744 Isolate Unclassified
226 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
227 2643221613 Oerskovia sp. Root22 Isolate Unclassified
228 2643221721 Oerskovia sp. Root918 Isolate Unclassified
229 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
230 2687453737 Frankia sp. BMG5.36 Isolate Nodule
231 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
232 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
233 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
234 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
235 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
236 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
237 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
238 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.88
Metatranscriptomes 1.08
Isolates 5.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.52
Nodule 1.08
Rhizoplane 8.99
Rhizosphere 79.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207705_10000473 3300025909 Bacteria 34432
2 Ga0058862_12887079 3300004803 Bacteria 1731
3 Ga0070658_10001723 3300005327 Bacteria 18454
4 Ga0070683_100241463 3300005329 Bacteria 1718
5 Ga0070680_100062164 3300005336 Bacteria 3057
6 Ga0070682_100001465 3300005337 Bacteria 13239
7 Ga0070682_100167980 3300005337 Bacteria 1522
8 Ga0068868_100065750 3300005338 Bacteria 2881
9 Ga0070660_100187289 3300005339 Bacteria 1676
10 Ga0070691_10006477 3300005341 Bacteria 5354
11 Ga0070687_100069620 3300005343 Bacteria 1885
12 Ga0070692_10013348 3300005345 Bacteria 3826
13 Ga0070671_100008566 3300005355 Bacteria 8200
14 Ga0070688_100073040 3300005365 Bacteria 2200
15 Ga0070667_100075817 3300005367 Bacteria 2872
16 Ga0070709_10060231 3300005434 Bacteria 2412
17 Ga0070700_100031800 3300005441 Bacteria 3166
18 Ga0070663_100042859 3300005455 Bacteria 3182
19 Ga0070663_100216609 3300005455 Bacteria 1501
20 Ga0070678_100003005 3300005456 Bacteria 9347
21 Ga0070662_100072434 3300005457 Bacteria 2544
22 Ga0070684_100104649 3300005535 Bacteria 2532
23 Ga0068853_100090301 3300005539 Bacteria 2692
24 Ga0070693_100109540 3300005547 Bacteria 1696
25 Ga0068857_100238450 3300005577 Bacteria 1665
26 Ga0068856_100005516 3300005614 Bacteria 12458
27 Ga0068856_100331046 3300005614 Bacteria 1540
28 Ga0070702_100000444 3300005615 Bacteria 14693
29 Ga0068859_100030366 3300005617 Bacteria 5423
30 Ga0068859_100037569 3300005617 Bacteria 4860
31 Ga0068859_100208426 3300005617 Bacteria 2041
32 Ga0068851_10106691 3300005834 Bacteria 1491
33 Ga0068870_10003448 3300005840 Bacteria 6704
34 Ga0068863_100006617 3300005841 Bacteria 11377
35 Ga0068858_100006939 3300005842 Bacteria 11009
36 Ga0068860_100323209 3300005843 Bacteria 1515
37 Ga0081455_10007766 3300005937 Bacteria 11246
38 Ga0081538_10000092 3300005981 Bacteria 87123
39 Ga0081540_1066951 3300005983 Bacteria 1680
40 Ga0070717_10056351 3300006028 Bacteria 3247
41 Ga0068871_100103810 3300006358 Bacteria 2384
42 Ga0075428_100113076 3300006844 Bacteria 2957
43 Ga0075431_100006072 3300006847 Bacteria 11976
44 Ga0075431_100056774 3300006847 Bacteria 4038
45 Ga0075433_10002952 3300006852 Bacteria 13056
46 Ga0075434_100015482 3300006871 Bacteria 7315
47 Ga0075436_100003834 3300006914 Bacteria 10314
48 Ga0097620_100030367 3300006931 Bacteria 5423
49 Ga0097620_100037569 3300006931 Bacteria 4860
50 Ga0097620_100208421 3300006931 Bacteria 2041
51 Ga0075435_100034321 3300007076 Bacteria 4019
52 Ga0111539_10277494 3300009094 Bacteria 1950
53 Ga0105245_10047297 3300009098 Bacteria 3846
54 Ga0105247_10021108 3300009101 Bacteria 3917
55 Ga0105243_10143374 3300009148 Bacteria 2041
56 Ga0105241_10143784 3300009174 Bacteria 1945
57 Ga0105248_10105701 3300009177 Bacteria 3174
58 Ga0105248_10260107 3300009177 Bacteria 1954
59 Ga0105237_10088333 3300009545 Bacteria 3089
60 Ga0105238_10086111 3300009551 Bacteria 3129
61 Ga0105239_10589199 3300010375 Bacteria 1268
62 Ga0105246_10060988 3300011119 Bacteria 2622
63 Ga0157373_10021947 3300013100 Bacteria 4632
64 Ga0157371_10017348 3300013102 Bacteria 5351
65 Ga0157370_10042186 3300013104 Bacteria 4398
66 Ga0157369_10006508 3300013105 Bacteria 13538
67 Ga0157369_10025796 3300013105 Bacteria 6519
68 Ga0157369_10456455 3300013105 Bacteria 1323
69 Ga0163162_10036949 3300013306 Bacteria 4872
70 Ga0157372_10033036 3300013307 Bacteria 5680
71 Ga0157372_10496747 3300013307 Bacteria 1423
72 Ga0157375_10018958 3300013308 Bacteria 6246
73 Ga0163163_10049151 3300014325 Bacteria 4149
74 Ga0157377_10014792 3300014745 Bacteria 3978
75 Ga0206350_10857868 3300020080 Bacteria 1924
76 Ga0224712_10052621 3300022467 Bacteria 1591
77 Ga0207656_10007358 3300025321 Bacteria 4005
78 Ga0207692_10097233 3300025898 Bacteria 1609
79 Ga0207688_10006110 3300025901 Bacteria 6551
80 Ga0207647_10092589 3300025904 Bacteria 1802
81 Ga0207699_10007139 3300025906 Bacteria 5449
82 Ga0207643_10001745 3300025908 Bacteria 12180
83 Ga0207705_10004764 3300025909 Bacteria 10220
84 Ga0207684_10026373 3300025910 Bacteria 4954
85 Ga0207707_10057021 3300025912 Bacteria 3400
86 Ga0207660_10055741 3300025917 Bacteria 2826
87 Ga0207660_10164051 3300025917 Bacteria 1716
88 Ga0207660_10205361 3300025917 Bacteria 1540
89 Ga0207662_10010381 3300025918 Bacteria 5141
90 Ga0207657_10030263 3300025919 Bacteria 4915
91 Ga0207649_10002369 3300025920 Bacteria 10566
92 Ga0207652_10056118 3300025921 Bacteria 3390
93 Ga0207650_10007243 3300025925 Bacteria 7557
94 Ga0207659_10152233 3300025926 Bacteria 1807
95 Ga0207687_10004401 3300025927 Bacteria 9400
96 Ga0207687_10087080 3300025927 Bacteria 2269
97 Ga0207700_10018220 3300025928 Bacteria 4713
98 Ga0207700_10087525 3300025928 Bacteria 2450
99 Ga0207644_10011890 3300025931 Bacteria 5769
100 Ga0207690_10001866 3300025932 Bacteria 12955
101 Ga0207706_10086534 3300025933 Bacteria 2755
102 Ga0207665_10002567 3300025939 Bacteria 12196
103 Ga0207689_10000187 3300025942 Bacteria 53919
104 Ga0207679_10132740 3300025945 Bacteria 2000
105 Ga0207667_10124621 3300025949 Bacteria 2654
106 Ga0207658_10203160 3300025986 Bacteria 1656
107 Ga0207677_10023247 3300026023 Bacteria 3824
108 Ga0207703_10157834 3300026035 Bacteria 1984
109 Ga0207703_10259891 3300026035 Bacteria 1569
110 Ga0207639_10218046 3300026041 Bacteria 1646
111 Ga0207678_10135734 3300026067 Bacteria 2099
112 Ga0207708_10013603 3300026075 Bacteria 6081
113 Ga0207702_10015901 3300026078 Bacteria 6230
114 Ga0207702_10017907 3300026078 Bacteria 5862
115 Ga0207641_10007961 3300026088 Bacteria 8783
116 Ga0207676_10025263 3300026095 Bacteria 4407
117 Ga0207675_100179038 3300026118 Bacteria 2030
118 Ga0207675_100407123 3300026118 Bacteria 1341
119 Ga0207683_10000594 3300026121 Bacteria 33332
120 Ga0207698_10088369 3300026142 Bacteria 2527
121 Ga0207428_10008241 3300027907 Bacteria 9425
122 Ga0268266_10012724 3300028379 Bacteria 7272
123 Ga0268265_10121760 3300028380 Bacteria 2151
124 Ga0307517_10043236 3300028786 Bacteria 4805
125 Ga0307515_10076859 3300028794 Bacteria 4419
126 Ga0265338_10001554 3300028800 Bacteria 37076
127 Ga0307512_10003523 3300030522 Bacteria 18089
128 Ga0307512_10098703 3300030522 Bacteria 1992
129 Ga0307509_10019139 3300031507 Bacteria 7826
130 Ga0307408_100128747 3300031548 Bacteria 1972
131 Ga0307508_10009064 3300031616 Bacteria 9166
132 Ga0307508_10036384 3300031616 Bacteria 4433
133 Ga0316576_10001302 3300031727 Bacteria 13243
134 Ga0307413_10002380 3300031824 Bacteria 7635
135 Ga0307518_10000054 3300031838 Bacteria 76765
136 Ga0307410_10133558 3300031852 Bacteria 1826
137 Ga0307409_100009164 3300031995 Bacteria 6067
138 Ga0307409_100188724 3300031995 Bacteria 1832
139 Ga0307416_100054362 3300032002 Bacteria 3218
140 Ga0373926_0003126 3300035083 Bacteria 5311
141 Ga0373944_0012680 3300035089 Bacteria 2327
142 Ga0373951_0000068 3300035091 Bacteria 41054
143 Ga0373923_0008346 3300035111 Bacteria 3688
144 Ga0373936_0001271 3300035113 Bacteria 9117
145 Ga0373945_0005583 3300035116 Bacteria 4033
146 Ga0373957_0001229 3300035120 Bacteria 6847
147 Ga0373943_0010661 3300035170 Bacteria 4124
148 Ga0373946_0008161 3300035171 Bacteria 3843
149 Ga0373935_0022501 3300035692 Bacteria 3866
150 Ga0373935_0029565 3300035692 Bacteria 3391
151 Ga0373927_0034805 3300035695 Bacteria 3275
152 Ga0373947_0047488 3300035725 Bacteria 2572
153 Ga0373937_0307672 3300036401 Bacteria 1498
154 Ga0373925_0019776 3300037068 Bacteria 4901
155 Ga0400486_20001 3300038742 Bacteria 106597
156 Ga0451793_1475822 3300041452 Bacteria 1698
157 Ga0439464_0005090 3300042439 Bacteria 3385
158 Ga0466965_0005956 3300044683 Bacteria 5509
159 Ga0466965_0025434 3300044683 Bacteria 2865
160 Ga0466970_0043453 3300044765 Bacteria 2391
161 Ga0466957_0030086 3300044842 Bacteria 3241
162 Ga0466960_0014785 3300044901 Bacteria 3352
163 Ga0466958_0003152 3300045836 Bacteria 8484
164 Ga0466958_0024669 3300045836 Bacteria 3538
165 Ga0466967_0017324 3300045976 Bacteria 5715
166 Ga0466967_0059633 3300045976 Bacteria 3379
167 Ga0495592_0045530 3300046454 Bacteria 3273
168 Ga0495603_0077524 3300046455 Bacteria 1949
169 Ga0495629_0005291 3300046459 Bacteria 9646
170 Ga0495641_0005480 3300046461 Bacteria 8560
171 Ga0495651_0065586 3300046462 Bacteria 2772
172 Ga0495582_0047503 3300046473 Bacteria 2364
173 Ga0495662_0001206 3300046476 Bacteria 12758
174 Ga0495594_0035745 3300046499 Bacteria 2707
175 Ga0495618_0026396 3300046514 Bacteria 3610
176 Ga0495630_0010957 3300046517 Bacteria 6551
177 Ga0495666_0002454 3300046526 Bacteria 9207
178 Ga0495586_0002818 3300046535 Bacteria 9384
179 Ga0495587_0019852 3300046536 Bacteria 4153
180 Ga0495645_0119092 3300046543 Bacteria 1860
181 Ga0495634_0004216 3300046642 Bacteria 11348
182 Ga0495657_0045713 3300046675 Bacteria 2969
183 Ga0495623_0004486 3300046679 Bacteria 9170
184 Ga0495623_0030272 3300046679 Bacteria 3482
185 Ga0495646_0026457 3300046680 Bacteria 3643
186 Ga0495647_0039707 3300046681 Bacteria 1785
187 Ga0495658_0001876 3300046683 Bacteria 10731
188 Ga0495613_0069570 3300046689 Bacteria 2565
189 Ga0495600_0002108 3300046809 Bacteria 11250
190 Ga0495581_0023006 3300047315 Bacteria 3610
191 Ga0495604_0036985 3300047317 Bacteria 3846
192 Ga0495674_0043208 3300047319 Bacteria 4012
193 Ga0495680_0029967 3300047322 Bacteria 4448
194 Ga0495593_0017233 3300047673 Bacteria 4064
195 Ga0495614_0026961 3300048089 Bacteria 2477
196 Ga0496100_0012032 3300048903 Bacteria 4946
197 Ga0496101_0103897 3300048904 Bacteria 2130
198 Ga0496102_0026917 3300048905 Bacteria 5134
199 Ga0496102_0074539 3300048905 Bacteria 3119
200 Ga0496102_0232530 3300048905 Bacteria 1738
201 Ga0496103_0003139 3300048906 Bacteria 10164
202 Ga0496103_0107952 3300048906 Bacteria 1766
203 Ga0496104_0092547 3300048907 Bacteria 2890
204 Ga0496105_0010933 3300048908 Bacteria 7150
205 Ga0496105_0111590 3300048908 Bacteria 2256
206 Ga0496106_0013298 3300048909 Bacteria 6076
207 Ga0496106_0138126 3300048909 Bacteria 1916
208 Ga0496109_0011417 3300048912 Bacteria 7635
209 Ga0496109_0431993 3300048912 Bacteria 1244
210 Ga0496110_0005781 3300048913 Bacteria 9721
211 Ga0496110_0127184 3300048913 Bacteria 2299
212 Ga0496111_0004085 3300048914 Bacteria 9167
213 Ga0496112_0030392 3300048915 Bacteria 5227
214 Ga0496112_0218149 3300048915 Bacteria 1864
215 Ga0496113_0005979 3300048916 Bacteria 7657
216 Ga0496113_0153662 3300048916 Bacteria 1816
217 Ga0496114_0061433 3300048917 Bacteria 3143
218 Ga0496115_0012979 3300048918 Bacteria 6285
219 Ga0496115_0284012 3300048918 Bacteria 1358
220 Ga0496117_0001264 3300048920 Bacteria 37571
221 Ga0496119_0006780 3300048922 Bacteria 10503
222 Ga0496120_0047308 3300048923 Bacteria 2481
223 Ga0496122_0000120 3300048925 Bacteria 182539
224 Ga0496123_0000051 3300048926 Bacteria 237095
225 Ga0501031_0025254 3300049568 Bacteria 3876
226 Ga0501032_0076122 3300049569 Bacteria 2235
227 Ga0501036_0067525 3300049572 Bacteria 3025
228 Ga0501037_0118137 3300049573 Bacteria 1908
229 Ga0501038_0050287 3300049574 Bacteria 3602
230 Ga0501040_0013096 3300049576 Bacteria 5454
231 Ga0501041_0032086 3300049577 Bacteria 3174
232 Ga0501046_0075012 3300049580 Bacteria 2623
233 Ga0501047_0198449 3300049581 Bacteria 1868
234 Ga0501071_0025810 3300049587 Bacteria 4118
235 Ga0501072_0023176 3300049588 Bacteria 4821
236 Ga0501075_0011937 3300049591 Bacteria 6163
237 Ga0501076_0015769 3300049592 Bacteria 5715
238 Ga0501077_0152361 3300049593 Bacteria 1467
239 Ga0501079_0013685 3300049741 Bacteria 6187
240 Ga0501081_0027080 3300049743 Bacteria 3869
241 Ga0501035_0047812 3300049822 Bacteria 3839
242 Ga0501045_0007370 3300049824 Bacteria 7647
243 nmdc:mga0qj67_91129_c1 3300050509 Bacteria 2450
244 nmdc:mga06r32_656_c1 3300050510 Bacteria 30201
245 nmdc:mga08y16_38704_c1 3300050511 Bacteria 5006
246 nmdc:mga08y16_624242_c1 3300050511 Bacteria 1084
247 nmdc:mga0n895_180617_c1 3300050512 Bacteria 2141
248 nmdc:mga0n895_232597_c1 3300050512 Bacteria 1871
249 nmdc:mga0rr50_41469_c1 3300050513 Bacteria 3355
250 nmdc:mga08x19_4505_c1 3300050514 Bacteria 8255
251 Ga0495601_0091485 3300053077 Bacteria 1958
252 Ga0495612_0002948 3300053078 Bacteria 7061
253 Ga0495595_0002685 3300053084 Bacteria 6981
254 Ga0500646_0000810 3300053090 Bacteria 8679
255 Ga0500583_0029056 3300053092 Bacteria 2405
256 Ga0500641_0009869 3300053096 Bacteria 3439
257 Ga0500569_011001 3300053109 Bacteria 2149
258 Ga0500594_0005547 3300053118 Bacteria 2800
259 Ga0500588_0015654 3300053146 Bacteria 1946
260 Ga0500600_0073376 3300053149 Bacteria 1870
261 Ga0501084_0059761 3300054114 Bacteria 3191
262 Ga0501082_0011028 3300060353 Bacteria 7772
263 Ga0466962_0013381 3300061719 Bacteria 3949
264 Ga0530510_0026107 3300061734 Bacteria 4178
265 2559425023 2558860280 Bacteria 11429938
266 2586062274 2585427649 Bacteria 9053857
267 2644081581 2643221613 Bacteria 4622396
268 2644666215 2643221721 Bacteria 4486924
269 2676199652 2675902999 Bacteria 9438463
270 2689956472 2687453737 Bacteria 11203906
271 2753268167 2751185782 Bacteria 11227053
272 2774399768 2773857763 Bacteria 4180068
273 2774844230 2773857921 Bacteria 9435764
274 2795797775 2795385472 Bacteria 6627535
275 2935891162 2935890801 Bacteria 4593001
276 2977231129 2977228692 Bacteria 3450105
277 8004214096 8004212874 Bacteria 2861420
278 8045830949 8045830549 Bacteria 4444727
279 Ga0207705_10000473
280 Ga0058862_12887079
281 Ga0070658_10001723
282 Ga0070683_100241463
283 Ga0070680_100062164
284 Ga0070682_100001465
285 Ga0070682_100167980
286 Ga0068868_100065750
287 Ga0070660_100187289
288 Ga0070691_10006477
289 Ga0070687_100069620
290 Ga0070692_10013348
291 Ga0070671_100008566
292 Ga0070688_100073040
293 Ga0070667_100075817
294 Ga0070709_10060231
295 Ga0070700_100031800
296 Ga0070663_100042859
297 Ga0070663_100216609
298 Ga0070678_100003005
299 Ga0070662_100072434
300 Ga0070684_100104649
301 Ga0068853_100090301
302 Ga0070693_100109540
303 Ga0068857_100238450
304 Ga0068856_100005516
305 Ga0068856_100331046
306 Ga0070702_100000444
307 Ga0068859_100030366
308 Ga0068859_100037569
309 Ga0068859_100208426
310 Ga0068851_10106691
311 Ga0068870_10003448
312 Ga0068863_100006617
313 Ga0068858_100006939
314 Ga0068860_100323209
315 Ga0081455_10007766
316 Ga0081538_10000092
317 Ga0081540_1066951
318 Ga0070717_10056351
319 Ga0068871_100103810
320 Ga0075428_100113076
321 Ga0075431_100006072
322 Ga0075431_100056774
323 Ga0075433_10002952
324 Ga0075434_100015482
325 Ga0075436_100003834
326 Ga0097620_100030367
327 Ga0097620_100037569
328 Ga0097620_100208421
329 Ga0075435_100034321
330 Ga0111539_10277494
331 Ga0105245_10047297
332 Ga0105247_10021108
333 Ga0105243_10143374
334 Ga0105241_10143784
335 Ga0105248_10105701
336 Ga0105248_10260107
337 Ga0105237_10088333
338 Ga0105238_10086111
339 Ga0105239_10589199
340 Ga0105246_10060988
341 Ga0157373_10021947
342 Ga0157371_10017348
343 Ga0157370_10042186
344 Ga0157369_10006508
345 Ga0157369_10025796
346 Ga0157369_10456455
347 Ga0163162_10036949
348 Ga0157372_10033036
349 Ga0157372_10496747
350 Ga0157375_10018958
351 Ga0163163_10049151
352 Ga0157377_10014792
353 Ga0206350_10857868
354 Ga0224712_10052621
355 Ga0207656_10007358
356 Ga0207692_10097233
357 Ga0207688_10006110
358 Ga0207647_10092589
359 Ga0207699_10007139
360 Ga0207643_10001745
361 Ga0207705_10004764
362 Ga0207684_10026373
363 Ga0207707_10057021
364 Ga0207660_10055741
365 Ga0207660_10164051
366 Ga0207660_10205361
367 Ga0207662_10010381
368 Ga0207657_10030263
369 Ga0207649_10002369
370 Ga0207652_10056118
371 Ga0207650_10007243
372 Ga0207659_10152233
373 Ga0207687_10004401
374 Ga0207687_10087080
375 Ga0207700_10018220
376 Ga0207700_10087525
377 Ga0207644_10011890
378 Ga0207690_10001866
379 Ga0207706_10086534
380 Ga0207665_10002567
381 Ga0207689_10000187
382 Ga0207679_10132740
383 Ga0207667_10124621
384 Ga0207658_10203160
385 Ga0207677_10023247
386 Ga0207703_10157834
387 Ga0207703_10259891
388 Ga0207639_10218046
389 Ga0207678_10135734
390 Ga0207708_10013603
391 Ga0207702_10015901
392 Ga0207702_10017907
393 Ga0207641_10007961
394 Ga0207676_10025263
395 Ga0207675_100179038
396 Ga0207675_100407123
397 Ga0207683_10000594
398 Ga0207698_10088369
399 Ga0207428_10008241
400 Ga0268266_10012724
401 Ga0268265_10121760
402 Ga0307517_10043236
403 Ga0307515_10076859
404 Ga0265338_10001554
405 Ga0307512_10003523
406 Ga0307512_10098703
407 Ga0307509_10019139
408 Ga0307408_100128747
409 Ga0307508_10009064
410 Ga0307508_10036384
411 Ga0316576_10001302
412 Ga0307413_10002380
413 Ga0307518_10000054
414 Ga0307410_10133558
415 Ga0307409_100009164
416 Ga0307409_100188724
417 Ga0307416_100054362
418 Ga0373926_0003126
419 Ga0373944_0012680
420 Ga0373951_0000068
421 Ga0373923_0008346
422 Ga0373936_0001271
423 Ga0373945_0005583
424 Ga0373957_0001229
425 Ga0373943_0010661
426 Ga0373946_0008161
427 Ga0373935_0022501
428 Ga0373935_0029565
429 Ga0373927_0034805
430 Ga0373947_0047488
431 Ga0373937_0307672
432 Ga0373925_0019776
433 Ga0400486_20001
434 Ga0451793_1475822
435 Ga0439464_0005090
436 Ga0466965_0005956
437 Ga0466965_0025434
438 Ga0466970_0043453
439 Ga0466957_0030086
440 Ga0466960_0014785
441 Ga0466958_0003152
442 Ga0466958_0024669
443 Ga0466967_0017324
444 Ga0466967_0059633
445 Ga0495592_0045530
446 Ga0495603_0077524
447 Ga0495629_0005291
448 Ga0495641_0005480
449 Ga0495651_0065586
450 Ga0495582_0047503
451 Ga0495662_0001206
452 Ga0495594_0035745
453 Ga0495618_0026396
454 Ga0495630_0010957
455 Ga0495666_0002454
456 Ga0495586_0002818
457 Ga0495587_0019852
458 Ga0495645_0119092
459 Ga0495634_0004216
460 Ga0495657_0045713
461 Ga0495623_0004486
462 Ga0495623_0030272
463 Ga0495646_0026457
464 Ga0495647_0039707
465 Ga0495658_0001876
466 Ga0495613_0069570
467 Ga0495600_0002108
468 Ga0495581_0023006
469 Ga0495604_0036985
470 Ga0495674_0043208
471 Ga0495680_0029967
472 Ga0495593_0017233
473 Ga0495614_0026961
474 Ga0496100_0012032
475 Ga0496101_0103897
476 Ga0496102_0026917
477 Ga0496102_0074539
478 Ga0496102_0232530
479 Ga0496103_0003139
480 Ga0496103_0107952
481 Ga0496104_0092547
482 Ga0496105_0010933
483 Ga0496105_0111590
484 Ga0496106_0013298
485 Ga0496106_0138126
486 Ga0496109_0011417
487 Ga0496109_0431993
488 Ga0496110_0005781
489 Ga0496110_0127184
490 Ga0496111_0004085
491 Ga0496112_0030392
492 Ga0496112_0218149
493 Ga0496113_0005979
494 Ga0496113_0153662
495 Ga0496114_0061433
496 Ga0496115_0012979
497 Ga0496115_0284012
498 Ga0496117_0001264
499 Ga0496119_0006780
500 Ga0496120_0047308
501 Ga0496122_0000120
502 Ga0496123_0000051
503 Ga0501031_0025254
504 Ga0501032_0076122
505 Ga0501036_0067525
506 Ga0501037_0118137
507 Ga0501038_0050287
508 Ga0501040_0013096
509 Ga0501041_0032086
510 Ga0501046_0075012
511 Ga0501047_0198449
512 Ga0501071_0025810
513 Ga0501072_0023176
514 Ga0501075_0011937
515 Ga0501076_0015769
516 Ga0501077_0152361
517 Ga0501079_0013685
518 Ga0501081_0027080
519 Ga0501035_0047812
520 Ga0501045_0007370
521 nmdc:mga0qj67_91129_c1
522 nmdc:mga06r32_656_c1
523 nmdc:mga08y16_38704_c1
524 nmdc:mga08y16_624242_c1
525 nmdc:mga0n895_180617_c1
526 nmdc:mga0n895_232597_c1
527 nmdc:mga0rr50_41469_c1
528 nmdc:mga08x19_4505_c1
529 Ga0495601_0091485
530 Ga0495612_0002948
531 Ga0495595_0002685
532 Ga0500646_0000810
533 Ga0500583_0029056
534 Ga0500641_0009869
535 Ga0500569_011001
536 Ga0500594_0005547
537 Ga0500588_0015654
538 Ga0500600_0073376
539 Ga0501084_0059761
540 Ga0501082_0011028
541 Ga0466962_0013381
542 Ga0530510_0026107
543 2559425023
544 2586062274
545 2644081581
546 2644666215
547 2676199652
548 2689956472
549 2753268167
550 2774399768
551 2774844230
552 2795797775
553 2935891162
554 2977231129
555 8004214096
556 8045830949

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

15

355

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oey-assembly1.cif.gz_B neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution 0.978 5 361
7bbw-assembly2.cif.gz_B neisseria gonorrhoeae transaldolase, variant c38s 0.9759 5 361
7bbx-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase, variant k8a 0.9741 5 361
3r5e-assembly1.cif.gz_A transaldolase from corynebacterium glutamicum 0.9719 3 365
7odq-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase at 5.4 mgy dose 0.9715 5 361
ID Description Score Start End Superfamily
af_B4FRC9_66_421_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9767 6 361 3.20.20.70
3r5eA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9719 3 365 3.20.20.70
af_K7L4A2_15_219_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9718 52 253 3.20.20.70
3clmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9711 5 361 3.20.20.70
af_I1JM01_1_306_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9699 66 362 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6G3XGD8-F1-model_v4 transaldolase (EC 2.2.1.2) 1.005 92 173 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A6B3CHQ4-F1-model_v4 Transaldolase (EC 2.2.1.2) 1.004 135 205 GO:0004801
GO:0005737
GO:0005975
AF-A0A3C1DZE4-F1-model_v4 transaldolase (EC 2.2.1.2) 1.003 97 194 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A505D201-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9998 89 283 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A4Y8YCC9-F1-model_v4 deleted 0.9997 116 235

Map