F382396

General Info

Members Datasets Scaffolds Average Seq Length
278 170 556 386

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10172157|Ga0157380_101721571
Length 423
Sequence MTAYMPRWSDGVKPWHHRSTDPAVTRRSPVDRFEPNLRIPGPTALPPSVRVAGGRQMINHRGPEFAAMLERILTGMQPFFGTTSDVAMISTAGSGGLEAAIVNVLSPGDAILGVSIGSFGDRFAKIAGIYGADVTKLDAEWGYAAAADEVRERLRAMAEVKAVLLTHNETSTGVMNPIPELAAAIRDERPDALILVDSVSGLGAVPFEMDGWGVDVVVTGSQKAWMAAPGLAMIAASPRAWAAMETATMPRFYLDLRSHRDSAAQGQTPFTPAIAVVYQVDEGLRLMHEEGADGIFARHEACAAAARAGLEALGFELFADPRHASKTVTAAHVPDGLDWKAFNGEVKRRGVVLAGGQGKLTGKIFRLGHLGSVTIEEILGALSTLEIVSLQQGRPVEPGAAVGAAQRAALASMGIAALSVTGA

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 11.51
Rhizosphere 87.77
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10172157 3300014326 Unclassified 1893
2 JGI25406J46586_10019996 3300003203 Bacteria 2718
3 rootH2_10043864 3300003320 Bacteria 2642
4 Ga0065704_10121478 3300005289 Bacteria 1766
5 Ga0070690_100008334 3300005330 Bacteria 5964
6 Ga0070670_100094060 3300005331 Bacteria 2578
7 Ga0070680_100000004 3300005336 Bacteria 129387
8 Ga0070682_100022494 3300005337 Bacteria 3735
9 Ga0068868_100181168 3300005338 Bacteria 1748
10 Ga0070689_100004656 3300005340 Bacteria 9293
11 Ga0070687_100001573 3300005343 Bacteria 8113
12 Ga0070687_100019606 3300005343 Unclassified 3149
13 Ga0070661_100027798 3300005344 Bacteria 4076
14 Ga0070692_10042936 3300005345 Bacteria 2324
15 Ga0070668_100270134 3300005347 Bacteria 1417
16 Ga0070675_100018577 3300005354 Bacteria 5535
17 Ga0070675_100277791 3300005354 Bacteria 1471
18 Ga0070674_100009777 3300005356 Bacteria 5765
19 Ga0070673_100009674 3300005364 Bacteria 6484
20 Ga0070688_100022094 3300005365 Bacteria 3723
21 Ga0070659_100011402 3300005366 Bacteria 6574
22 Ga0070701_10000787 3300005438 Bacteria 11341
23 Ga0070701_10053231 3300005438 Bacteria 2106
24 Ga0070705_100148938 3300005440 Bacteria 1550
25 Ga0070700_100004591 3300005441 Bacteria 7229
26 Ga0070694_100021362 3300005444 Bacteria 4134
27 Ga0070694_100055270 3300005444 Bacteria 2692
28 Ga0070694_100142607 3300005444 Bacteria 1741
29 Ga0070708_100004951 3300005445 Bacteria 10535
30 Ga0070708_100007125 3300005445 Bacteria 8920
31 Ga0070708_100011799 3300005445 Bacteria 7110
32 Ga0070663_100013867 3300005455 Bacteria 5156
33 Ga0070662_100082604 3300005457 Bacteria 2396
34 Ga0068867_100007101 3300005459 Bacteria 7915
35 Ga0070685_10055808 3300005466 Bacteria 2295
36 Ga0070706_100071088 3300005467 Bacteria 3218
37 Ga0070707_100001005 3300005468 Bacteria 27919
38 Ga0070707_100086513 3300005468 Bacteria 3031
39 Ga0070707_100122499 3300005468 Unclassified 2525
40 Ga0070707_100124370 3300005468 Bacteria 2505
41 Ga0070698_100007701 3300005471 Bacteria 11646
42 Ga0070698_100054978 3300005471 Bacteria 4040
43 Ga0070698_100189646 3300005471 Bacteria 1994
44 Ga0070699_100096551 3300005518 Bacteria 2588
45 Ga0070699_100149391 3300005518 Bacteria 2066
46 Ga0070697_100002027 3300005536 Bacteria 15504
47 Ga0068853_100220264 3300005539 Bacteria 1733
48 Ga0070686_100027686 3300005544 Bacteria 3432
49 Ga0070695_100006887 3300005545 Bacteria 6731
50 Ga0070695_100028107 3300005545 Bacteria 3488
51 Ga0070695_100082829 3300005545 Bacteria 2124
52 Ga0070696_100003205 3300005546 Bacteria 10891
53 Ga0070696_100027913 3300005546 Bacteria 3850
54 Ga0070696_100034748 3300005546 Bacteria 3469
55 Ga0070696_100049202 3300005546 Bacteria 2927
56 Ga0070696_100139349 3300005546 Bacteria 1771
57 Ga0070704_100026714 3300005549 Bacteria 3820
58 Ga0070664_100063826 3300005564 Bacteria 3140
59 Ga0068857_100104249 3300005577 Bacteria 2546
60 Ga0068857_100166573 3300005577 Bacteria 2002
61 Ga0068854_100056583 3300005578 Bacteria 2827
62 Ga0070702_100017183 3300005615 Bacteria 3726
63 Ga0068859_100052659 3300005617 Bacteria 4093
64 Ga0068864_100011463 3300005618 Bacteria 7323
65 Ga0068864_100264475 3300005618 Bacteria 1601
66 Ga0068866_10027242 3300005718 Bacteria 2708
67 Ga0068851_10100232 3300005834 Bacteria 1536
68 Ga0068858_100047764 3300005842 Bacteria 3967
69 Ga0068860_100069699 3300005843 Bacteria 3342
70 Ga0068860_100467184 3300005843 Bacteria 1256
71 Ga0081538_10113803 3300005981 Unclassified 1320
72 Ga0081539_10004422 3300005985 Bacteria 15547
73 Ga0081539_10010037 3300005985 Bacteria 7789
74 Ga0075365_10061165 3300006038 Bacteria 2514
75 Ga0075428_100000219 3300006844 Bacteria 55414
76 Ga0075433_10214905 3300006852 Bacteria 1709
77 Ga0075434_100066302 3300006871 Bacteria 3596
78 Ga0075434_100172217 3300006871 Bacteria 2185
79 Ga0075434_100181717 3300006871 Bacteria 2123
80 Ga0068865_100003307 3300006881 Bacteria 9649
81 Ga0075436_100096336 3300006914 Bacteria 2058
82 Ga0097620_100052658 3300006931 Bacteria 4093
83 Ga0075435_100134729 3300007076 Bacteria 2068
84 Ga0075435_100160237 3300007076 Bacteria 1895
85 Ga0075435_100204680 3300007076 Bacteria 1673
86 Ga0111539_10039895 3300009094 Bacteria 5654
87 Ga0111539_10059081 3300009094 Bacteria 4549
88 Ga0111539_10170745 3300009094 Bacteria 2541
89 Ga0111539_10510468 3300009094 Bacteria 1400
90 Ga0105245_10021565 3300009098 Bacteria 5653
91 Ga0105245_10034584 3300009098 Bacteria 4483
92 Ga0105245_10144097 3300009098 Bacteria 2247
93 Ga0114129_10000738 3300009147 Bacteria 41604
94 Ga0114129_10090588 3300009147 Bacteria 4239
95 Ga0114129_10156798 3300009147 Bacteria 3112
96 Ga0114129_10240764 3300009147 Bacteria 2432
97 Ga0114129_10279169 3300009147 Bacteria 2232
98 Ga0105243_10004733 3300009148 Bacteria 10706
99 Ga0105243_10166562 3300009148 Bacteria 1905
100 Ga0105242_10029761 3300009176 Bacteria 4356
101 Ga0105248_10076262 3300009177 Bacteria 3768
102 Ga0105249_10001025 3300009553 Bacteria 24688
103 Ga0105246_10005069 3300011119 Bacteria 8011
104 Ga0157378_10014100 3300013297 Bacteria 6996
105 Ga0157378_10277666 3300013297 Unclassified 1614
106 Ga0163162_10145876 3300013306 Bacteria 2483
107 Ga0157375_10088457 3300013308 Bacteria 3152
108 Ga0163163_10039112 3300014325 Bacteria 4627
109 Ga0157380_10006598 3300014326 Bacteria 8187
110 Ga0157380_10138397 3300014326 Bacteria 2088
111 Ga0182008_10062572 3300014497 Bacteria 1834
112 Ga0157379_10057451 3300014968 Bacteria 3477
113 Ga0157376_10170789 3300014969 Bacteria 1980
114 Ga0163161_10147121 3300017792 Bacteria 1788
115 Ga0207642_10046765 3300025899 Bacteria 1930
116 Ga0207688_10016148 3300025901 Bacteria 4048
117 Ga0207688_10034321 3300025901 Bacteria 2809
118 Ga0207645_10047136 3300025907 Bacteria 2752
119 Ga0207684_10000839 3300025910 Bacteria 35443
120 Ga0207660_10000001 3300025917 Bacteria 1034169
121 Ga0207662_10000078 3300025918 Bacteria 44345
122 Ga0207662_10138122 3300025918 Unclassified 1542
123 Ga0207657_10029509 3300025919 Bacteria 4991
124 Ga0207646_10006437 3300025922 Bacteria 12124
125 Ga0207646_10107238 3300025922 Unclassified 2506
126 Ga0207646_10257516 3300025922 Bacteria 1577
127 Ga0207646_10283660 3300025922 Bacteria 1497
128 Ga0207650_10026439 3300025925 Bacteria 4140
129 Ga0207659_10019454 3300025926 Bacteria 4471
130 Ga0207687_10106612 3300025927 Bacteria 2072
131 Ga0207690_10037071 3300025932 Bacteria 3163
132 Ga0207706_10006811 3300025933 Bacteria 10567
133 Ga0207706_10148700 3300025933 Bacteria 2061
134 Ga0207706_10162099 3300025933 Bacteria 1966
135 Ga0207686_10169278 3300025934 Bacteria 1539
136 Ga0207709_10134805 3300025935 Unclassified 1688
137 Ga0207670_10035387 3300025936 Bacteria 3237
138 Ga0207669_10010245 3300025937 Bacteria 4507
139 Ga0207668_10242563 3300025972 Bacteria 1459
140 Ga0207677_10226798 3300026023 Bacteria 1502
141 Ga0207678_10019501 3300026067 Bacteria 5958
142 Ga0207708_10029347 3300026075 Bacteria 4168
143 Ga0207708_10052135 3300026075 Bacteria 3116
144 Ga0207648_10000305 3300026089 Bacteria 53670
145 Ga0207674_10073546 3300026116 Bacteria 3431
146 Ga0207675_100367471 3300026118 Bacteria 1413
147 Ga0207428_10134834 3300027907 Bacteria 1888
148 Ga0207428_10154832 3300027907 Bacteria 1743
149 Ga0268264_10061966 3300028381 Bacteria 3139
150 Ga0268264_10162845 3300028381 Bacteria 2011
151 Ga0265326_10003171 3300028558 Bacteria 5435
152 Ga0265330_10013374 3300031235 Bacteria 3826
153 Ga0265316_10031573 3300031344 Bacteria 4329
154 Ga0307416_100007246 3300032002 Bacteria 7029
155 Ga0307416_100091427 3300032002 Bacteria 2614
156 Ga0373962_0005023 3300035242 Bacteria 3199
157 Ga0316574_0018062 3300035398 Bacteria 4140
158 Ga0373931_0016737 3300035691 Bacteria 3614
159 Ga0373937_0163946 3300036401 Bacteria 2084
160 Ga0316582_0180829 3300036647 Bacteria 1435
161 Ga0451577_0051726 3300042876 Bacteria 3668
162 Ga0453684_0000181 3300044712 Bacteria 279183
163 Ga0453684_0001513 3300044712 Bacteria 65266
164 Ga0495651_0126851 3300046462 Bacteria 1868
165 Ga0495652_0159950 3300046529 Bacteria 1750
166 Ga0495657_0165799 3300046675 Bacteria 1364
167 Ga0495624_0136434 3300046690 Bacteria 1504
168 Ga0495680_0115920 3300047322 Bacteria 1982
169 Ga0496101_0026957 3300048904 Bacteria 3996
170 Ga0496101_0074741 3300048904 Bacteria 2493
171 Ga0496103_0082472 3300048906 Bacteria 2024
172 Ga0496104_0013053 3300048907 Bacteria 7481
173 Ga0496104_0027838 3300048907 Bacteria 5232
174 Ga0496104_0156160 3300048907 Bacteria 2189
175 Ga0496104_0178504 3300048907 Bacteria 2034
176 Ga0496105_0057273 3300048908 Bacteria 3218
177 Ga0496105_0083737 3300048908 Bacteria 2634
178 Ga0496106_0039688 3300048909 Bacteria 3526
179 Ga0496106_0049174 3300048909 Bacteria 3176
180 Ga0496107_0187902 3300048910 Bacteria 1535
181 Ga0496108_0005515 3300048911 Bacteria 10232
182 Ga0496108_0079114 3300048911 Bacteria 2783
183 Ga0496109_0003271 3300048912 Bacteria 13516
184 Ga0496109_0009154 3300048912 Bacteria 8433
185 Ga0496109_0020352 3300048912 Bacteria 5860
186 Ga0496109_0251794 3300048912 Bacteria 1663
187 Ga0496110_0005374 3300048913 Bacteria 10037
188 Ga0496110_0104991 3300048913 Bacteria 2535
189 Ga0496110_0216343 3300048913 Bacteria 1742
190 Ga0496111_0025275 3300048914 Bacteria 4190
191 Ga0496111_0028072 3300048914 Bacteria 3986
192 Ga0496111_0075819 3300048914 Bacteria 2451
193 Ga0496111_0116842 3300048914 Bacteria 1967
194 Ga0496112_0000005 3300048915 Bacteria 525541
195 Ga0496112_0045175 3300048915 Bacteria 4318
196 Ga0496112_0138167 3300048915 Bacteria 2407
197 Ga0496112_0175430 3300048915 Bacteria 2108
198 Ga0496113_0069324 3300048916 Bacteria 2678
199 Ga0496114_0283706 3300048917 Bacteria 1460
200 Ga0496115_0000213 3300048918 Bacteria 53968
201 Ga0501031_0017447 3300049568 Bacteria 4665
202 Ga0501031_0109720 3300049568 Bacteria 1802
203 Ga0501032_0091210 3300049569 Bacteria 2021
204 Ga0501036_0059477 3300049572 Bacteria 3238
205 Ga0501036_0124290 3300049572 Bacteria 2179
206 Ga0501037_0226587 3300049573 Bacteria 1313
207 Ga0501039_0032732 3300049575 Bacteria 4009
208 Ga0501040_0013800 3300049576 Bacteria 5317
209 Ga0501040_0015495 3300049576 Bacteria 5038
210 Ga0501040_0023596 3300049576 Bacteria 4125
211 Ga0501040_0071278 3300049576 Bacteria 2399
212 Ga0501041_0024280 3300049577 Bacteria 3639
213 Ga0501041_0028484 3300049577 Bacteria 3370
214 Ga0501041_0062297 3300049577 Bacteria 2283
215 Ga0501041_0181531 3300049577 Bacteria 1317
216 Ga0501042_0075003 3300049578 Bacteria 2420
217 Ga0501043_0087705 3300049579 Bacteria 2445
218 Ga0501048_0238004 3300049582 Bacteria 1292
219 Ga0501067_0000573 3300049583 Bacteria 19902
220 Ga0501068_0004916 3300049584 Bacteria 7281
221 Ga0501068_0172654 3300049584 Bacteria 1365
222 Ga0501069_0003716 3300049585 Bacteria 7845
223 Ga0501070_0108873 3300049586 Bacteria 2289
224 Ga0501071_0036708 3300049587 Bacteria 3495
225 Ga0501071_0050817 3300049587 Bacteria 2987
226 Ga0501072_0027671 3300049588 Bacteria 4422
227 Ga0501072_0034785 3300049588 Bacteria 3948
228 Ga0501072_0040442 3300049588 Bacteria 3661
229 Ga0501072_0111639 3300049588 Bacteria 2176
230 Ga0501074_0120664 3300049590 Bacteria 1875
231 Ga0501075_0011452 3300049591 Bacteria 6277
232 Ga0501075_0018392 3300049591 Bacteria 5059
233 Ga0501075_0023933 3300049591 Bacteria 4473
234 Ga0501076_0005930 3300049592 Bacteria 8820
235 Ga0501076_0019676 3300049592 Bacteria 5162
236 Ga0501076_0082825 3300049592 Bacteria 2576
237 Ga0501077_0025103 3300049593 Bacteria 3785
238 Ga0501079_0010113 3300049741 Bacteria 7162
239 Ga0501079_0014448 3300049741 Bacteria 6019
240 Ga0501079_0060693 3300049741 Bacteria 2917
241 Ga0501079_0061098 3300049741 Bacteria 2906
242 Ga0501079_0092050 3300049741 Bacteria 2349
243 Ga0501079_0251487 3300049741 Bacteria 1381
244 Ga0501080_0020544 3300049742 Bacteria 6116
245 Ga0501080_0224095 3300049742 Bacteria 1720
246 Ga0501081_0011126 3300049743 Bacteria 5884
247 Ga0501081_0087310 3300049743 Bacteria 2190
248 Ga0501081_0147145 3300049743 Bacteria 1691
249 Ga0501083_0064509 3300049744 Bacteria 2441
250 Ga0501035_0107702 3300049822 Bacteria 2443
251 Ga0501035_0142869 3300049822 Bacteria 2080
252 Ga0501045_0006240 3300049824 Bacteria 8247
253 Ga0501045_0020098 3300049824 Bacteria 4768
254 Ga0501045_0231499 3300049824 Bacteria 1375
255 nmdc:mga05p37_287166_c1 3300050507 Bacteria 1959
256 nmdc:mga05p37_287867_c1 3300050507 Bacteria 1956
257 nmdc:mga05p37_389722_c1 3300050507 Bacteria 1630
258 nmdc:mga05p37_479_c1 3300050507 Bacteria 43660
259 nmdc:mga06r32_145280_c1 3300050510 Bacteria 2349
260 nmdc:mga08y16_211877_c1 3300050511 Bacteria 2007
261 nmdc:mga08y16_24707_c1 3300050511 Bacteria 6341
262 nmdc:mga0n895_123232_c1 3300050512 Bacteria 2614
263 nmdc:mga0n895_87190_c1 3300050512 Bacteria 3118
264 nmdc:mga0rr50_141229_c1 3300050513 Bacteria 1937
265 nmdc:mga0rr50_208510_c1 3300050513 Bacteria 1609
266 nmdc:mga08x19_95945_c1 3300050514 Bacteria 1962
267 Ga0495601_0038245 3300053077 Bacteria 3000
268 Ga0495601_0148396 3300053077 Bacteria 1530
269 Ga0495619_0049701 3300053085 Bacteria 2766
270 Ga0501084_0047988 3300054114 Bacteria 3576
271 Ga0501084_0091868 3300054114 Bacteria 2548
272 Ga0501084_0156260 3300054114 Bacteria 1923
273 Ga0501084_0236597 3300054114 Bacteria 1542
274 Ga0590071_016533 3300059421 Bacteria 1730
275 Ga0590075_000971 3300059424 Bacteria 7439
276 Ga0590077_009849 3300059426 Bacteria 1964
277 Ga0501082_0326340 3300060353 Bacteria 1337
278 Ga0530510_0038839 3300061734 Bacteria 3438
279 Ga0157380_10172157
280 JGI25406J46586_10019996
281 rootH2_10043864
282 Ga0065704_10121478
283 Ga0070690_100008334
284 Ga0070670_100094060
285 Ga0070680_100000004
286 Ga0070682_100022494
287 Ga0068868_100181168
288 Ga0070689_100004656
289 Ga0070687_100001573
290 Ga0070687_100019606
291 Ga0070661_100027798
292 Ga0070692_10042936
293 Ga0070668_100270134
294 Ga0070675_100018577
295 Ga0070675_100277791
296 Ga0070674_100009777
297 Ga0070673_100009674
298 Ga0070688_100022094
299 Ga0070659_100011402
300 Ga0070701_10000787
301 Ga0070701_10053231
302 Ga0070705_100148938
303 Ga0070700_100004591
304 Ga0070694_100021362
305 Ga0070694_100055270
306 Ga0070694_100142607
307 Ga0070708_100004951
308 Ga0070708_100007125
309 Ga0070708_100011799
310 Ga0070663_100013867
311 Ga0070662_100082604
312 Ga0068867_100007101
313 Ga0070685_10055808
314 Ga0070706_100071088
315 Ga0070707_100001005
316 Ga0070707_100086513
317 Ga0070707_100122499
318 Ga0070707_100124370
319 Ga0070698_100007701
320 Ga0070698_100054978
321 Ga0070698_100189646
322 Ga0070699_100096551
323 Ga0070699_100149391
324 Ga0070697_100002027
325 Ga0068853_100220264
326 Ga0070686_100027686
327 Ga0070695_100006887
328 Ga0070695_100028107
329 Ga0070695_100082829
330 Ga0070696_100003205
331 Ga0070696_100027913
332 Ga0070696_100034748
333 Ga0070696_100049202
334 Ga0070696_100139349
335 Ga0070704_100026714
336 Ga0070664_100063826
337 Ga0068857_100104249
338 Ga0068857_100166573
339 Ga0068854_100056583
340 Ga0070702_100017183
341 Ga0068859_100052659
342 Ga0068864_100011463
343 Ga0068864_100264475
344 Ga0068866_10027242
345 Ga0068851_10100232
346 Ga0068858_100047764
347 Ga0068860_100069699
348 Ga0068860_100467184
349 Ga0081538_10113803
350 Ga0081539_10004422
351 Ga0081539_10010037
352 Ga0075365_10061165
353 Ga0075428_100000219
354 Ga0075433_10214905
355 Ga0075434_100066302
356 Ga0075434_100172217
357 Ga0075434_100181717
358 Ga0068865_100003307
359 Ga0075436_100096336
360 Ga0097620_100052658
361 Ga0075435_100134729
362 Ga0075435_100160237
363 Ga0075435_100204680
364 Ga0111539_10039895
365 Ga0111539_10059081
366 Ga0111539_10170745
367 Ga0111539_10510468
368 Ga0105245_10021565
369 Ga0105245_10034584
370 Ga0105245_10144097
371 Ga0114129_10000738
372 Ga0114129_10090588
373 Ga0114129_10156798
374 Ga0114129_10240764
375 Ga0114129_10279169
376 Ga0105243_10004733
377 Ga0105243_10166562
378 Ga0105242_10029761
379 Ga0105248_10076262
380 Ga0105249_10001025
381 Ga0105246_10005069
382 Ga0157378_10014100
383 Ga0157378_10277666
384 Ga0163162_10145876
385 Ga0157375_10088457
386 Ga0163163_10039112
387 Ga0157380_10006598
388 Ga0157380_10138397
389 Ga0182008_10062572
390 Ga0157379_10057451
391 Ga0157376_10170789
392 Ga0163161_10147121
393 Ga0207642_10046765
394 Ga0207688_10016148
395 Ga0207688_10034321
396 Ga0207645_10047136
397 Ga0207684_10000839
398 Ga0207660_10000001
399 Ga0207662_10000078
400 Ga0207662_10138122
401 Ga0207657_10029509
402 Ga0207646_10006437
403 Ga0207646_10107238
404 Ga0207646_10257516
405 Ga0207646_10283660
406 Ga0207650_10026439
407 Ga0207659_10019454
408 Ga0207687_10106612
409 Ga0207690_10037071
410 Ga0207706_10006811
411 Ga0207706_10148700
412 Ga0207706_10162099
413 Ga0207686_10169278
414 Ga0207709_10134805
415 Ga0207670_10035387
416 Ga0207669_10010245
417 Ga0207668_10242563
418 Ga0207677_10226798
419 Ga0207678_10019501
420 Ga0207708_10029347
421 Ga0207708_10052135
422 Ga0207648_10000305
423 Ga0207674_10073546
424 Ga0207675_100367471
425 Ga0207428_10134834
426 Ga0207428_10154832
427 Ga0268264_10061966
428 Ga0268264_10162845
429 Ga0265326_10003171
430 Ga0265330_10013374
431 Ga0265316_10031573
432 Ga0307416_100007246
433 Ga0307416_100091427
434 Ga0373962_0005023
435 Ga0316574_0018062
436 Ga0373931_0016737
437 Ga0373937_0163946
438 Ga0316582_0180829
439 Ga0451577_0051726
440 Ga0453684_0000181
441 Ga0453684_0001513
442 Ga0495651_0126851
443 Ga0495652_0159950
444 Ga0495657_0165799
445 Ga0495624_0136434
446 Ga0495680_0115920
447 Ga0496101_0026957
448 Ga0496101_0074741
449 Ga0496103_0082472
450 Ga0496104_0013053
451 Ga0496104_0027838
452 Ga0496104_0156160
453 Ga0496104_0178504
454 Ga0496105_0057273
455 Ga0496105_0083737
456 Ga0496106_0039688
457 Ga0496106_0049174
458 Ga0496107_0187902
459 Ga0496108_0005515
460 Ga0496108_0079114
461 Ga0496109_0003271
462 Ga0496109_0009154
463 Ga0496109_0020352
464 Ga0496109_0251794
465 Ga0496110_0005374
466 Ga0496110_0104991
467 Ga0496110_0216343
468 Ga0496111_0025275
469 Ga0496111_0028072
470 Ga0496111_0075819
471 Ga0496111_0116842
472 Ga0496112_0000005
473 Ga0496112_0045175
474 Ga0496112_0138167
475 Ga0496112_0175430
476 Ga0496113_0069324
477 Ga0496114_0283706
478 Ga0496115_0000213
479 Ga0501031_0017447
480 Ga0501031_0109720
481 Ga0501032_0091210
482 Ga0501036_0059477
483 Ga0501036_0124290
484 Ga0501037_0226587
485 Ga0501039_0032732
486 Ga0501040_0013800
487 Ga0501040_0015495
488 Ga0501040_0023596
489 Ga0501040_0071278
490 Ga0501041_0024280
491 Ga0501041_0028484
492 Ga0501041_0062297
493 Ga0501041_0181531
494 Ga0501042_0075003
495 Ga0501043_0087705
496 Ga0501048_0238004
497 Ga0501067_0000573
498 Ga0501068_0004916
499 Ga0501068_0172654
500 Ga0501069_0003716
501 Ga0501070_0108873
502 Ga0501071_0036708
503 Ga0501071_0050817
504 Ga0501072_0027671
505 Ga0501072_0034785
506 Ga0501072_0040442
507 Ga0501072_0111639
508 Ga0501074_0120664
509 Ga0501075_0011452
510 Ga0501075_0018392
511 Ga0501075_0023933
512 Ga0501076_0005930
513 Ga0501076_0019676
514 Ga0501076_0082825
515 Ga0501077_0025103
516 Ga0501079_0010113
517 Ga0501079_0014448
518 Ga0501079_0060693
519 Ga0501079_0061098
520 Ga0501079_0092050
521 Ga0501079_0251487
522 Ga0501080_0020544
523 Ga0501080_0224095
524 Ga0501081_0011126
525 Ga0501081_0087310
526 Ga0501081_0147145
527 Ga0501083_0064509
528 Ga0501035_0107702
529 Ga0501035_0142869
530 Ga0501045_0006240
531 Ga0501045_0020098
532 Ga0501045_0231499
533 nmdc:mga05p37_287166_c1
534 nmdc:mga05p37_287867_c1
535 nmdc:mga05p37_389722_c1
536 nmdc:mga05p37_479_c1
537 nmdc:mga06r32_145280_c1
538 nmdc:mga08y16_211877_c1
539 nmdc:mga08y16_24707_c1
540 nmdc:mga0n895_123232_c1
541 nmdc:mga0n895_87190_c1
542 nmdc:mga0rr50_141229_c1
543 nmdc:mga0rr50_208510_c1
544 nmdc:mga08x19_95945_c1
545 Ga0495601_0038245
546 Ga0495601_0148396
547 Ga0495619_0049701
548 Ga0501084_0047988
549 Ga0501084_0091868
550 Ga0501084_0156260
551 Ga0501084_0236597
552 Ga0590071_016533
553 Ga0590075_000971
554 Ga0590077_009849
555 Ga0501082_0326340
556 Ga0530510_0038839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

49

367

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pk3-assembly1.cif.gz_B alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana 0.9517 5 368
1j04-assembly1.cif.gz_A structural mechanism of enzyme mistargeting in hereditary kidney stone disease in vitro 0.9503 5 348
4cbs-assembly1.cif.gz_A-2 x-ray structure of quintuple mutant of human alanine glyoxylate aminotransferase, agxt_rheam 0.9499 5 348
6mfb-assembly1.cif.gz_B crystal structure of 3-hydroxykynurenine transaminase from aedes aegypti 0.9489 11 351
4cbr-assembly1.cif.gz_A-2 x-ray structure of the more stable human agxt triple mutant (agxt_hem) 0.9458 5 351
ID Description Score Start End Superfamily
af_Q58369_36_182_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9641 35 180 3.40.640.10
af_Q58369_270_367_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9637 260 353 3.90.1150.10
af_Q2FXK2_10_249_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9618 11 238 3.40.640.10
af_A0A1D6KIG3_10_230_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9574 17 220 3.40.640.10
af_Q58369_38_263_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.949 37 252 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A536BPU9-F1-model_v4 Alanine--glyoxylate aminotransferase family protein 0.9795 1 266 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A523E9V3-F1-model_v4 Alanine--glyoxylate aminotransferase family protein 0.9778 5 354 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A534ZKM2-F1-model_v4 Alanine--glyoxylate aminotransferase family protein 0.9772 8 299 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A660VEZ2-F1-model_v4 Aminotransferase 0.9765 93 368 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A328VCE0-F1-model_v4 Class V aminotransferase 0.9761 5 357 GO:0004760
GO:0005777
GO:0008453
GO:0019265

Map