F382274

General Info

Members Datasets Scaffolds Average Seq Length
278 161 556 176

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100061514|Ga0070664_1000615143
Length 207
Sequence MGRFDGGFGTARPLIWDGSTTGQDGGVGFALGDPVRIEMEKWGDRPHWRIPARWLGSDEYGDWLGIPAGTRMVRPGRDVLSQADQVGLVPTLDLPDHERAWLATFHAAGADTWVYVDMTTPPRWDGPVVRAVDLDLDVIRMQNGWVLVDDEDEFAEHRVSLSYPHEIVSMAVASRDRVHAAILDEDPPFDGHHLGWQAVLDGLTPGT

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
93 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
94 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
95 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
156 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
160 2643221561 Nocardioides sp. Root151 Isolate Unclassified
161 2643221696 Nocardioides sp. Root140 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.94
Nodule 0
Rhizoplane 6.12
Rhizosphere 68.35
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100061514 3300005564 Bacteria 3200
2 Ga0070658_10064321 3300005327 Bacteria 2992
3 Ga0070683_100001398 3300005329 Bacteria 18519
4 Ga0070683_100011273 3300005329 Bacteria 7717
5 Ga0070683_100655732 3300005329 Bacteria 1005
6 Ga0070670_100535334 3300005331 Bacteria 1044
7 Ga0070682_100018083 3300005337 Bacteria 4115
8 Ga0070682_100040209 3300005337 Bacteria 2876
9 Ga0070682_100540693 3300005337 Bacteria 910
10 Ga0068868_100291911 3300005338 Bacteria 1383
11 Ga0070660_100161418 3300005339 Bacteria 1806
12 Ga0070660_100210024 3300005339 Bacteria 1580
13 Ga0070692_10013120 3300005345 Bacteria 3856
14 Ga0070675_100356614 3300005354 Bacteria 1298
15 Ga0070673_100281436 3300005364 Bacteria 1459
16 Ga0070667_100207685 3300005367 Bacteria 1740
17 Ga0070705_100116674 3300005440 Bacteria 1716
18 Ga0070663_100107201 3300005455 Bacteria 2094
19 Ga0070663_100270309 3300005455 Bacteria 1351
20 Ga0070678_100193341 3300005456 Bacteria 1674
21 Ga0070678_100304858 3300005456 Bacteria 1355
22 Ga0070662_100653206 3300005457 Bacteria 887
23 Ga0070684_100006033 3300005535 Bacteria 9336
24 Ga0070684_100406421 3300005535 Bacteria 1256
25 Ga0070684_100518876 3300005535 Bacteria 1104
26 Ga0070684_100641944 3300005535 Bacteria 988
27 Ga0068853_100136547 3300005539 Bacteria 2199
28 Ga0070672_100769122 3300005543 Bacteria 846
29 Ga0070686_100336762 3300005544 Bacteria 1130
30 Ga0070665_100002610 3300005548 Bacteria 19669
31 Ga0070665_100332226 3300005548 Bacteria 1525
32 Ga0068855_100168870 3300005563 Bacteria 2478
33 Ga0068856_100153033 3300005614 Bacteria 2316
34 Ga0070702_100248187 3300005615 Bacteria 1205
35 Ga0070702_100258238 3300005615 Bacteria 1185
36 Ga0068852_100286199 3300005616 Bacteria 1590
37 Ga0068864_100026130 3300005618 Bacteria 4922
38 Ga0068864_100487480 3300005618 Bacteria 1184
39 Ga0068861_100186546 3300005719 Bacteria 1730
40 Ga0068863_100170517 3300005841 Bacteria 2087
41 Ga0068860_100003085 3300005843 Bacteria 17230
42 Ga0068860_100060475 3300005843 Bacteria 3600
43 Ga0075365_10003382 3300006038 Bacteria 8207
44 Ga0075365_10013795 3300006038 Bacteria 4848
45 Ga0075365_10022558 3300006038 Bacteria 3946
46 Ga0075365_10037235 3300006038 Bacteria 3157
47 Ga0075365_10111395 3300006038 Bacteria 1881
48 Ga0075365_10115563 3300006038 Bacteria 1847
49 Ga0075365_10160965 3300006038 Bacteria 1564
50 Ga0075365_10269614 3300006038 Bacteria 1197
51 Ga0075365_10290026 3300006038 Bacteria 1151
52 Ga0075365_10323662 3300006038 Bacteria 1086
53 Ga0075365_10359461 3300006038 Bacteria 1026
54 Ga0075365_10473932 3300006038 Bacteria 884
55 Ga0075368_10003264 3300006042 Bacteria 5401
56 Ga0075368_10003345 3300006042 Bacteria 5340
57 Ga0075368_10112839 3300006042 Bacteria 1121
58 Ga0075368_10239149 3300006042 Bacteria 774
59 Ga0075363_100006183 3300006048 Bacteria 5413
60 Ga0075363_100006780 3300006048 Bacteria 5230
61 Ga0075363_100151968 3300006048 Bacteria 1307
62 Ga0075363_100165735 3300006048 Bacteria 1253
63 Ga0075363_100288811 3300006048 Bacteria 950
64 Ga0075363_100565721 3300006048 Bacteria 679
65 Ga0075364_10006119 3300006051 Bacteria 7046
66 Ga0075364_10041133 3300006051 Bacteria 3000
67 Ga0075364_10088768 3300006051 Bacteria 2050
68 Ga0075367_10016279 3300006178 Bacteria 4059
69 Ga0075367_10089888 3300006178 Bacteria 1867
70 Ga0075367_10168836 3300006178 Bacteria 1362
71 Ga0075367_10275189 3300006178 Bacteria 1058
72 Ga0075367_10379263 3300006178 Bacteria 893
73 Ga0097621_100326513 3300006237 Bacteria 1360
74 Ga0075370_10003193 3300006353 Bacteria 7762
75 Ga0075370_10020640 3300006353 Bacteria 3604
76 Ga0075370_10119667 3300006353 Bacteria 1532
77 Ga0075370_10217199 3300006353 Bacteria 1129
78 Ga0068871_100090757 3300006358 Bacteria 2545
79 Ga0068865_100056955 3300006881 Bacteria 2725
80 Ga0068865_100408069 3300006881 Bacteria 1114
81 Ga0105245_10033587 3300009098 Bacteria 4548
82 Ga0105243_10108018 3300009148 Bacteria 2322
83 Ga0105243_10663197 3300009148 Bacteria 1012
84 Ga0105248_10056511 3300009177 Bacteria 4403
85 Ga0105248_10855505 3300009177 Bacteria 1027
86 Ga0105238_10176003 3300009551 Bacteria 2116
87 Ga0105249_10116413 3300009553 Bacteria 2533
88 Ga0105249_10346068 3300009553 Bacteria 1505
89 Ga0105249_10440713 3300009553 Bacteria 1340
90 Ga0105239_10022876 3300010375 Bacteria 6890
91 Ga0105246_10003855 3300011119 Bacteria 9092
92 Ga0157374_10352032 3300013296 Bacteria 1463
93 Ga0163162_10041244 3300013306 Bacteria 4618
94 Ga0157372_10003630 3300013307 Bacteria 16603
95 Ga0157375_10065021 3300013308 Bacteria 3634
96 Ga0157375_10118195 3300013308 Bacteria 2757
97 Ga0157375_10419771 3300013308 Bacteria 1504
98 Ga0163163_10018826 3300014325 Bacteria 6475
99 Ga0163163_10169056 3300014325 Bacteria 2233
100 Ga0163163_10208592 3300014325 Bacteria 2002
101 Ga0157377_10024109 3300014745 Bacteria 3232
102 Ga0157379_10018721 3300014968 Bacteria 6106
103 Ga0213876_10286274 3300021384 Bacteria 876
104 Ga0213875_10038331 3300021388 Bacteria 2258
105 Ga0207642_10248039 3300025899 Bacteria 1009
106 Ga0207688_10028341 3300025901 Bacteria 3081
107 Ga0207688_10132227 3300025901 Bacteria 1463
108 Ga0207705_10055075 3300025909 Bacteria 2867
109 Ga0207654_10440392 3300025911 Bacteria 912
110 Ga0207657_10192043 3300025919 Bacteria 1647
111 Ga0207657_10334948 3300025919 Bacteria 1195
112 Ga0207687_10013412 3300025927 Bacteria 5349
113 Ga0207690_10101131 3300025932 Bacteria 2059
114 Ga0207686_10598812 3300025934 Unclassified 867
115 Ga0207709_10062784 3300025935 Bacteria 2326
116 Ga0207711_10130328 3300025941 Bacteria 2254
117 Ga0207661_10023083 3300025944 Bacteria 4697
118 Ga0207661_10096064 3300025944 Bacteria 2479
119 Ga0207661_10223924 3300025944 Bacteria 1663
120 Ga0207661_10309734 3300025944 Bacteria 1417
121 Ga0207667_10128481 3300025949 Bacteria 2610
122 Ga0207712_10077882 3300025961 Bacteria 2404
123 Ga0207712_10191341 3300025961 Bacteria 1615
124 Ga0207712_10291643 3300025961 Bacteria 1335
125 Ga0207658_10037799 3300025986 Bacteria 3472
126 Ga0207677_10062381 3300026023 Bacteria 2585
127 Ga0207677_10496302 3300026023 Bacteria 1054
128 Ga0207703_10020531 3300026035 Bacteria 5166
129 Ga0207639_10038204 3300026041 Bacteria 3570
130 Ga0207678_10116110 3300026067 Bacteria 2283
131 Ga0207702_10794008 3300026078 Bacteria 935
132 Ga0207648_11279762 3300026089 Bacteria 689
133 Ga0207676_10439336 3300026095 Bacteria 1228
134 Ga0207674_10008596 3300026116 Bacteria 11768
135 Ga0207675_100846780 3300026118 Bacteria 929
136 Ga0207683_10097161 3300026121 Bacteria 2626
137 Ga0207683_10145038 3300026121 Bacteria 2140
138 Ga0207698_10062974 3300026142 Bacteria 2900
139 Ga0207698_10732794 3300026142 Bacteria 986
140 Ga0209813_10006076 3300027866 Bacteria 2966
141 Ga0209813_10080590 3300027866 Bacteria 1076
142 Ga0268266_10001445 3300028379 Bacteria 28270
143 Ga0268264_10001626 3300028381 Bacteria 20764
144 Ga0268264_10154965 3300028381 Bacteria 2058
145 Ga0307408_100099720 3300031548 Bacteria 2210
146 Ga0307410_10050899 3300031852 Bacteria 2789
147 Ga0307412_10738938 3300031911 Bacteria 848
148 Ga0307409_100402787 3300031995 Bacteria 1307
149 Ga0307409_100845848 3300031995 Bacteria 925
150 Ga0307416_100000221 3300032002 Bacteria 30062
151 Ga0307416_101686520 3300032002 Bacteria 738
152 Ga0307415_100000455 3300032126 Bacteria 17595
153 Ga0307415_100796258 3300032126 Bacteria 862
154 Ga0395898_0228737 3300037466 Bacteria 1774
155 Ga0395898_0386847 3300037466 Bacteria 1334
156 Ga0395898_0967684 3300037466 Bacteria 788
157 Ga0395905_0755474 3300037471 Bacteria 875
158 Ga0436364_0432278 3300037853 Bacteria 2596
159 Ga0395901_0124990 3300038443 Bacteria 2703
160 Ga0451802_0606230 3300041460 Bacteria 572
161 Ga0451837_1061545 3300041494 Bacteria 889
162 Ga0451849_0915038 3300041505 Bacteria 639
163 Ga0451843_0888756 3300041509 Bacteria 625
164 Ga0451853_1975185 3300041512 Bacteria 1250
165 Ga0450907_043172 3300042146 Bacteria 772
166 Ga0466965_0201477 3300044683 Bacteria 1056
167 Ga0466963_0007800 3300044694 Bacteria 6402
168 Ga0466963_0091535 3300044694 Bacteria 2072
169 Ga0466963_0537954 3300044694 Bacteria 825
170 Ga0466964_0067097 3300044706 Bacteria 1507
171 Ga0451576_0204369 3300045051 Bacteria 2063
172 Ga0466967_0029340 3300045976 Bacteria 4602
173 Ga0466967_0064168 3300045976 Bacteria 3265
174 Ga0466967_0135809 3300045976 Bacteria 2287
175 Ga0466967_0272974 3300045976 Bacteria 1621
176 Ga0466967_0470606 3300045976 Bacteria 1230
177 Ga0495641_0163989 3300046461 Bacteria 994
178 Ga0495608_0309135 3300046511 Bacteria 978
179 Ga0495667_0283467 3300046559 Bacteria 1051
180 Ga0495658_0283398 3300046683 Bacteria 1046
181 Ga0495674_0313749 3300047319 Bacteria 1279
182 Ga0495680_0676094 3300047322 Bacteria 684
183 Ga0496100_1144796 3300048903 Bacteria 613
184 Ga0496101_0060533 3300048904 Bacteria 2748
185 Ga0496102_0010176 3300048905 Bacteria 8087
186 Ga0496102_0299703 3300048905 Bacteria 1515
187 Ga0496102_1034238 3300048905 Bacteria 742
188 Ga0496103_0295176 3300048906 Bacteria 1043
189 Ga0496108_0044361 3300048911 Bacteria 3712
190 Ga0496109_0040720 3300048912 Bacteria 4208
191 Ga0496110_0003134 3300048913 Bacteria 12559
192 Ga0496110_0058533 3300048913 Bacteria 3394
193 Ga0496110_0328158 3300048913 Bacteria 1394
194 Ga0496111_0037923 3300048914 Bacteria 3450
195 Ga0496112_0171211 3300048915 Bacteria 2137
196 Ga0496113_0098700 3300048916 Bacteria 2261
197 Ga0496114_0013906 3300048917 Bacteria 6452
198 Ga0496114_0218694 3300048917 Bacteria 1672
199 Ga0496124_0421055 3300048927 Bacteria 920
200 Ga0501032_0117442 3300049569 Bacteria 1759
201 Ga0501034_0661647 3300049571 Bacteria 945
202 Ga0501036_0206164 3300049572 Bacteria 1653
203 Ga0501036_0351551 3300049572 Bacteria 1231
204 Ga0501038_0336415 3300049574 Bacteria 1178
205 Ga0501038_0821639 3300049574 Bacteria 690
206 Ga0501039_0331124 3300049575 Bacteria 1197
207 Ga0501042_0120367 3300049578 Bacteria 1890
208 Ga0501043_0086073 3300049579 Bacteria 2470
209 Ga0501047_0032058 3300049581 Bacteria 5071
210 Ga0501067_0000550 3300049583 Bacteria 20334
211 Ga0501067_0002642 3300049583 Bacteria 9928
212 Ga0501067_0083858 3300049583 Bacteria 1768
213 Ga0501068_0006976 3300049584 Bacteria 6248
214 Ga0501069_0046482 3300049585 Bacteria 2408
215 Ga0501069_0053847 3300049585 Bacteria 2241
216 Ga0501069_0068835 3300049585 Bacteria 1981
217 Ga0501069_0096898 3300049585 Bacteria 1672
218 Ga0501069_0117471 3300049585 Bacteria 1518
219 Ga0501069_0279206 3300049585 Bacteria 977
220 Ga0501069_0310542 3300049585 Bacteria 925
221 Ga0501070_0015292 3300049586 Bacteria 6457
222 Ga0501070_0038848 3300049586 Bacteria 3971
223 Ga0501070_0112626 3300049586 Bacteria 2248
224 Ga0501071_0033856 3300049587 Bacteria 3632
225 Ga0501071_1053467 3300049587 Bacteria 628
226 Ga0501072_0155865 3300049588 Bacteria 1821
227 Ga0501073_0017465 3300049589 Bacteria 5197
228 Ga0501074_0004950 3300049590 Bacteria 9544
229 Ga0501074_0014170 3300049590 Bacteria 5798
230 Ga0501074_0018574 3300049590 Bacteria 5050
231 Ga0501075_1091559 3300049591 Bacteria 606
232 Ga0501076_0090013 3300049592 Bacteria 2468
233 Ga0501077_0015925 3300049593 Bacteria 4737
234 Ga0501079_0083035 3300049741 Bacteria 2478
235 Ga0501080_0007836 3300049742 Bacteria 9661
236 Ga0501080_0011869 3300049742 Bacteria 7980
237 Ga0501080_0042127 3300049742 Bacteria 4254
238 Ga0501080_0203482 3300049742 Bacteria 1817
239 Ga0501083_0010100 3300049744 Bacteria 6653
240 Ga0501035_0414629 3300049822 Bacteria 1119
241 Ga0501044_0093380 3300049823 Bacteria 3034
242 Ga0501045_0039101 3300049824 Bacteria 3452
243 nmdc:mga03683_351983_c1 3300050489 Bacteria 697
244 nmdc:mga03n38_12470_c1 3300050490 Bacteria 3200
245 nmdc:mga03n38_143858_c1 3300050490 Bacteria 1194
246 nmdc:mga03n38_30910_c1 3300050490 Bacteria 2256
247 nmdc:mga03n38_560145_c1 3300050490 Bacteria 647
248 nmdc:mga00v17_105119_c1 3300050491 Bacteria 1786
249 nmdc:mga00v17_172737_c1 3300050491 Bacteria 1394
250 nmdc:mga00v17_212752_c1 3300050491 Bacteria 1251
251 nmdc:mga00v17_23212_c1 3300050491 Bacteria 3587
252 nmdc:mga00v17_3399_c1 3300050491 Bacteria 8220
253 nmdc:mga0yw44_117352_c1 3300050492 Bacteria 1711
254 nmdc:mga0yw44_159279_c1 3300050492 Bacteria 1477
255 nmdc:mga0yw44_160344_c1 3300050492 Bacteria 1472
256 nmdc:mga0yw44_193098_c1 3300050492 Bacteria 1343
257 nmdc:mga0yw44_2197_c1 3300050492 Bacteria 8212
258 nmdc:mga0yw44_229073_c1 3300050492 Bacteria 1233
259 nmdc:mga0yw44_332485_c1 3300050492 Bacteria 1021
260 nmdc:mga0yw44_969940_c1 3300050492 Bacteria 576
261 nmdc:mga06z11_4906_c1 3300050494 Bacteria 5309
262 nmdc:mga06z11_98985_c1 3300050494 Bacteria 1597
263 nmdc:mga04h51_6820_c1 3300050495 Bacteria 2982
264 nmdc:mga07m45_336536_c1 3300050496 Bacteria 877
265 nmdc:mga07m45_9674_c1 3300050496 Bacteria 5010
266 Ga0495595_0169145 3300053084 Bacteria 1081
267 Ga0495619_0013857 3300053085 Bacteria 5087
268 Ga0500573_0001847 3300053140 Bacteria 10311
269 Ga0500604_0104719 3300053151 Bacteria 935
270 Ga0501084_0010853 3300054114 Bacteria 7545
271 Ga0501082_0016546 3300060353 Bacteria 6349
272 Ga0501082_0029063 3300060353 Bacteria 4762
273 Ga0501082_0658500 3300060353 Bacteria 916
274 Ga0501082_0919616 3300060353 Bacteria 765
275 Ga0530510_0315137 3300061734 Bacteria 1172
276 Ga0530510_0578954 3300061734 Bacteria 853
277 2643827659 2643221561 Bacteria 4984412
278 2644534911 2643221696 Bacteria 5431823
279 Ga0070664_100061514
280 Ga0070658_10064321
281 Ga0070683_100001398
282 Ga0070683_100011273
283 Ga0070683_100655732
284 Ga0070670_100535334
285 Ga0070682_100018083
286 Ga0070682_100040209
287 Ga0070682_100540693
288 Ga0068868_100291911
289 Ga0070660_100161418
290 Ga0070660_100210024
291 Ga0070692_10013120
292 Ga0070675_100356614
293 Ga0070673_100281436
294 Ga0070667_100207685
295 Ga0070705_100116674
296 Ga0070663_100107201
297 Ga0070663_100270309
298 Ga0070678_100193341
299 Ga0070678_100304858
300 Ga0070662_100653206
301 Ga0070684_100006033
302 Ga0070684_100406421
303 Ga0070684_100518876
304 Ga0070684_100641944
305 Ga0068853_100136547
306 Ga0070672_100769122
307 Ga0070686_100336762
308 Ga0070665_100002610
309 Ga0070665_100332226
310 Ga0068855_100168870
311 Ga0068856_100153033
312 Ga0070702_100248187
313 Ga0070702_100258238
314 Ga0068852_100286199
315 Ga0068864_100026130
316 Ga0068864_100487480
317 Ga0068861_100186546
318 Ga0068863_100170517
319 Ga0068860_100003085
320 Ga0068860_100060475
321 Ga0075365_10003382
322 Ga0075365_10013795
323 Ga0075365_10022558
324 Ga0075365_10037235
325 Ga0075365_10111395
326 Ga0075365_10115563
327 Ga0075365_10160965
328 Ga0075365_10269614
329 Ga0075365_10290026
330 Ga0075365_10323662
331 Ga0075365_10359461
332 Ga0075365_10473932
333 Ga0075368_10003264
334 Ga0075368_10003345
335 Ga0075368_10112839
336 Ga0075368_10239149
337 Ga0075363_100006183
338 Ga0075363_100006780
339 Ga0075363_100151968
340 Ga0075363_100165735
341 Ga0075363_100288811
342 Ga0075363_100565721
343 Ga0075364_10006119
344 Ga0075364_10041133
345 Ga0075364_10088768
346 Ga0075367_10016279
347 Ga0075367_10089888
348 Ga0075367_10168836
349 Ga0075367_10275189
350 Ga0075367_10379263
351 Ga0097621_100326513
352 Ga0075370_10003193
353 Ga0075370_10020640
354 Ga0075370_10119667
355 Ga0075370_10217199
356 Ga0068871_100090757
357 Ga0068865_100056955
358 Ga0068865_100408069
359 Ga0105245_10033587
360 Ga0105243_10108018
361 Ga0105243_10663197
362 Ga0105248_10056511
363 Ga0105248_10855505
364 Ga0105238_10176003
365 Ga0105249_10116413
366 Ga0105249_10346068
367 Ga0105249_10440713
368 Ga0105239_10022876
369 Ga0105246_10003855
370 Ga0157374_10352032
371 Ga0163162_10041244
372 Ga0157372_10003630
373 Ga0157375_10065021
374 Ga0157375_10118195
375 Ga0157375_10419771
376 Ga0163163_10018826
377 Ga0163163_10169056
378 Ga0163163_10208592
379 Ga0157377_10024109
380 Ga0157379_10018721
381 Ga0213876_10286274
382 Ga0213875_10038331
383 Ga0207642_10248039
384 Ga0207688_10028341
385 Ga0207688_10132227
386 Ga0207705_10055075
387 Ga0207654_10440392
388 Ga0207657_10192043
389 Ga0207657_10334948
390 Ga0207687_10013412
391 Ga0207690_10101131
392 Ga0207686_10598812
393 Ga0207709_10062784
394 Ga0207711_10130328
395 Ga0207661_10023083
396 Ga0207661_10096064
397 Ga0207661_10223924
398 Ga0207661_10309734
399 Ga0207667_10128481
400 Ga0207712_10077882
401 Ga0207712_10191341
402 Ga0207712_10291643
403 Ga0207658_10037799
404 Ga0207677_10062381
405 Ga0207677_10496302
406 Ga0207703_10020531
407 Ga0207639_10038204
408 Ga0207678_10116110
409 Ga0207702_10794008
410 Ga0207648_11279762
411 Ga0207676_10439336
412 Ga0207674_10008596
413 Ga0207675_100846780
414 Ga0207683_10097161
415 Ga0207683_10145038
416 Ga0207698_10062974
417 Ga0207698_10732794
418 Ga0209813_10006076
419 Ga0209813_10080590
420 Ga0268266_10001445
421 Ga0268264_10001626
422 Ga0268264_10154965
423 Ga0307408_100099720
424 Ga0307410_10050899
425 Ga0307412_10738938
426 Ga0307409_100402787
427 Ga0307409_100845848
428 Ga0307416_100000221
429 Ga0307416_101686520
430 Ga0307415_100000455
431 Ga0307415_100796258
432 Ga0395898_0228737
433 Ga0395898_0386847
434 Ga0395898_0967684
435 Ga0395905_0755474
436 Ga0436364_0432278
437 Ga0395901_0124990
438 Ga0451802_0606230
439 Ga0451837_1061545
440 Ga0451849_0915038
441 Ga0451843_0888756
442 Ga0451853_1975185
443 Ga0450907_043172
444 Ga0466965_0201477
445 Ga0466963_0007800
446 Ga0466963_0091535
447 Ga0466963_0537954
448 Ga0466964_0067097
449 Ga0451576_0204369
450 Ga0466967_0029340
451 Ga0466967_0064168
452 Ga0466967_0135809
453 Ga0466967_0272974
454 Ga0466967_0470606
455 Ga0495641_0163989
456 Ga0495608_0309135
457 Ga0495667_0283467
458 Ga0495658_0283398
459 Ga0495674_0313749
460 Ga0495680_0676094
461 Ga0496100_1144796
462 Ga0496101_0060533
463 Ga0496102_0010176
464 Ga0496102_0299703
465 Ga0496102_1034238
466 Ga0496103_0295176
467 Ga0496108_0044361
468 Ga0496109_0040720
469 Ga0496110_0003134
470 Ga0496110_0058533
471 Ga0496110_0328158
472 Ga0496111_0037923
473 Ga0496112_0171211
474 Ga0496113_0098700
475 Ga0496114_0013906
476 Ga0496114_0218694
477 Ga0496124_0421055
478 Ga0501032_0117442
479 Ga0501034_0661647
480 Ga0501036_0206164
481 Ga0501036_0351551
482 Ga0501038_0336415
483 Ga0501038_0821639
484 Ga0501039_0331124
485 Ga0501042_0120367
486 Ga0501043_0086073
487 Ga0501047_0032058
488 Ga0501067_0000550
489 Ga0501067_0002642
490 Ga0501067_0083858
491 Ga0501068_0006976
492 Ga0501069_0046482
493 Ga0501069_0053847
494 Ga0501069_0068835
495 Ga0501069_0096898
496 Ga0501069_0117471
497 Ga0501069_0279206
498 Ga0501069_0310542
499 Ga0501070_0015292
500 Ga0501070_0038848
501 Ga0501070_0112626
502 Ga0501071_0033856
503 Ga0501071_1053467
504 Ga0501072_0155865
505 Ga0501073_0017465
506 Ga0501074_0004950
507 Ga0501074_0014170
508 Ga0501074_0018574
509 Ga0501075_1091559
510 Ga0501076_0090013
511 Ga0501077_0015925
512 Ga0501079_0083035
513 Ga0501080_0007836
514 Ga0501080_0011869
515 Ga0501080_0042127
516 Ga0501080_0203482
517 Ga0501083_0010100
518 Ga0501035_0414629
519 Ga0501044_0093380
520 Ga0501045_0039101
521 nmdc:mga03683_351983_c1
522 nmdc:mga03n38_12470_c1
523 nmdc:mga03n38_143858_c1
524 nmdc:mga03n38_30910_c1
525 nmdc:mga03n38_560145_c1
526 nmdc:mga00v17_105119_c1
527 nmdc:mga00v17_172737_c1
528 nmdc:mga00v17_212752_c1
529 nmdc:mga00v17_23212_c1
530 nmdc:mga00v17_3399_c1
531 nmdc:mga0yw44_117352_c1
532 nmdc:mga0yw44_159279_c1
533 nmdc:mga0yw44_160344_c1
534 nmdc:mga0yw44_193098_c1
535 nmdc:mga0yw44_2197_c1
536 nmdc:mga0yw44_229073_c1
537 nmdc:mga0yw44_332485_c1
538 nmdc:mga0yw44_969940_c1
539 nmdc:mga06z11_4906_c1
540 nmdc:mga06z11_98985_c1
541 nmdc:mga04h51_6820_c1
542 nmdc:mga07m45_336536_c1
543 nmdc:mga07m45_9674_c1
544 Ga0495595_0169145
545 Ga0495619_0013857
546 Ga0500573_0001847
547 Ga0500604_0104719
548 Ga0501084_0010853
549 Ga0501082_0016546
550 Ga0501082_0029063
551 Ga0501082_0658500
552 Ga0501082_0919616
553 Ga0530510_0315137
554 Ga0530510_0578954
555 2643827659
556 2644534911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04167

DUF402

Protein of unknown function (DUF402)

94

154

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d8q-assembly1.cif.gz_A the structure of nucleotide phosphatase sa1684 complex with gdp analogue from staphylococcus aureus 0.8895 3 178
7d8q-assembly1.cif.gz_A the structure of nucleotide phosphatase sa1684 complex with gdp analogue from staphylococcus aureus 0.8751 3 178
3exm-assembly1.cif.gz_A crystal structure of the phosphatase sc4828 with the non-hydrolyzable nucleotide gpcp 0.7783 3 170
5zdn-assembly1.cif.gz_A the complex structure of fomd with cdp 0.7739 2 156
3exm-assembly1.cif.gz_A crystal structure of the phosphatase sc4828 with the non-hydrolyzable nucleotide gpcp 0.725 3 170
ID Description Score Start End Superfamily
af_Q2G2M8_8_173_2.40.380.10 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.8877 4 172 2.40.380.10
af_Q2G2M8_8_173_2.40.380.10 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.8777 4 172 2.40.380.10
3cbtA01 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.7803 3 164 2.40.380.10
3cbtA01 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.7037 3 164 2.40.380.10
af_O06149_1_140_2.40.380.10 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.6933 31 172 2.40.380.10
ID Description Score Start End GO Terms
AF-A0A417Y3E9-F1-model_v4 DUF402 domain-containing protein 0.988 3 174 GO:0016787
AF-A0A5B1M2C0-F1-model_v4 DUF402 domain-containing protein 0.9866 3 178 GO:0016787
AF-A0A7X0RF39-F1-model_v4 DUF402 domain-containing protein 0.9848 1 176 GO:0016787
AF-A0A4S5A4K4-F1-model_v4 DUF402 domain-containing protein 0.9848 3 174 GO:0016787
AF-A0A7W3J1R3-F1-model_v4 DUF402 domain-containing protein 0.9835 1 176

Map