F382162

General Info

Members Datasets Scaffolds Average Seq Length
278 161 556 80

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10307186|Ga0065715_103071863
Length 81
Sequence MTVHVTVLYFASLRDAAEVASESFETAAPDLRVLYLELRARYGFELPVERLRVAVDGAFARWDDAPRDGSEIAFIPPVSGG

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
35 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
36 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
37 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
38 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
93 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
94 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
95 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
96 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
97 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
98 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
99 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
100 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
103 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
104 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
105 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
106 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
107 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
110 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
111 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
112 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
113 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
114 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
118 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
119 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
136 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
137 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
138 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
139 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
140 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
141 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
142 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
143 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
144 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
145 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
146 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
147 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
148 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
149 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
150 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
151 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
152 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
153 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
154 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
155 2643221593 Lysobacter sp. Root690 Isolate Unclassified
156 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
157 2919513703 Luteimonas sp. 3794 Isolate Unclassified
158 2919675420 Luteimonas terrae 4099 Isolate Unclassified
159 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
160 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
161 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.35
Nodule 0
Rhizoplane 5.04
Rhizosphere 70.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10307186 3300005293 Bacteria 1028
2 JGI25151J46595_10000818 3300003187 Bacteria 24780
3 JGI25151J46595_10018579 3300003187 Bacteria 2979
4 rootL2_10214729 3300003322 Bacteria 1187
5 Ga0055526_1009709 3300003771 Bacteria 4586
6 Ga0055537_1000551 3300003773 Bacteria 21389
7 Ga0055524_1000211 3300003775 Bacteria 62400
8 Ga0055524_1008824 3300003775 Bacteria 4153
9 Ga0055536_1006324 3300003781 Bacteria 5561
10 Ga0055536_1015529 3300003781 Bacteria 2599
11 Ga0055536_1022381 3300003781 Bacteria 1888
12 Ga0055536_1042952 3300003781 Bacteria 1053
13 Ga0055536_1066052 3300003781 Bacteria 730
14 Ga0055534_1000107 3300003784 Bacteria 62400
15 Ga0055534_1065470 3300003784 Bacteria 501
16 Ga0055528_1000027 3300003790 Bacteria 126420
17 Ga0055530_10003516 3300003791 Bacteria 8853
18 Ga0055540_1037939 3300003792 Bacteria 1059
19 Ga0055531_10011679 3300003794 Bacteria 4206
20 Ga0055531_10014683 3300003794 Bacteria 3509
21 Ga0055531_10046999 3300003794 Bacteria 1180
22 Ga0055531_10051663 3300003794 Bacteria 1077
23 Ga0055531_10052675 3300003794 Bacteria 1058
24 Ga0065715_10375301 3300005293 Bacteria 890
25 Ga0070670_101164709 3300005331 Bacteria 704
26 Ga0070670_101270115 3300005331 Bacteria 674
27 Ga0070666_11291783 3300005335 Bacteria 544
28 Ga0070682_101510224 3300005337 Bacteria 578
29 Ga0070668_100034886 3300005347 Bacteria 3834
30 Ga0070668_101972673 3300005347 Bacteria 538
31 Ga0070669_100377759 3300005353 Bacteria 1155
32 Ga0070675_100601173 3300005354 Bacteria 997
33 Ga0070671_100336813 3300005355 Bacteria 1286
34 Ga0070674_100051684 3300005356 Bacteria 2833
35 Ga0070667_100410824 3300005367 Bacteria 1233
36 Ga0070678_101066178 3300005456 Bacteria 745
37 Ga0070662_100509749 3300005457 Bacteria 1004
38 Ga0070681_10424207 3300005458 Bacteria 1242
39 Ga0070672_100017520 3300005543 Bacteria 5159
40 Ga0070686_100552407 3300005544 Bacteria 901
41 Ga0070686_101311727 3300005544 Bacteria 605
42 Ga0070664_101581997 3300005564 Bacteria 621
43 Ga0068871_101673380 3300006358 Bacteria 603
44 Ga0075430_100823371 3300006846 Bacteria 765
45 Ga0105243_10892487 3300009148 Bacteria 884
46 Ga0105241_10326837 3300009174 Bacteria 1324
47 Ga0105242_10491963 3300009176 Bacteria 1165
48 Ga0105248_12113442 3300009177 Bacteria 640
49 Ga0105248_12876243 3300009177 Bacteria 549
50 Ga0105032_100170 3300009979 Bacteria 6762
51 Ga0157313_1011725 3300012503 Bacteria 767
52 Ga0157324_1066371 3300012506 Bacteria 505
53 Ga0157315_1000661 3300012508 Bacteria 1658
54 Ga0157316_1050415 3300012510 Bacteria 573
55 Ga0157373_10559833 3300013100 Bacteria 830
56 Ga0157374_11901794 3300013296 Bacteria 621
57 Ga0157375_10099958 3300013308 Bacteria 2980
58 Ga0157380_10342621 3300014326 Bacteria 1395
59 Ga0182008_10039004 3300014497 Bacteria 2375
60 Ga0183360_10001 3300015689 Bacteria 3943671
61 Ga0207425_1068717 3300025245 Bacteria 611
62 Ga0209565_1000005 3300025263 Bacteria 947317
63 Ga0209565_1005097 3300025263 Bacteria 3868
64 Ga0209673_1000011 3300025273 Bacteria 586604
65 Ga0209130_1004968 3300025284 Bacteria 4811
66 Ga0209675_1000004 3300025291 Bacteria 947166
67 Ga0209675_1010841 3300025291 Bacteria 3073
68 Ga0209675_1019283 3300025291 Bacteria 1882
69 Ga0209676_1007525 3300025292 Bacteria 5083
70 Ga0209676_1007836 3300025292 Bacteria 4912
71 Ga0209676_1007864 3300025292 Bacteria 4898
72 Ga0209676_1018672 3300025292 Bacteria 2411
73 Ga0209676_1026770 3300025292 Bacteria 1825
74 Ga0209025_1000884 3300025294 Bacteria 46917
75 Ga0209025_1003704 3300025294 Bacteria 14045
76 Ga0209025_1030651 3300025294 Bacteria 2568
77 Ga0209564_1000018 3300025295 Bacteria 586913
78 Ga0209564_1022122 3300025295 Bacteria 2258
79 Ga0209758_1031266 3300025297 Bacteria 2187
80 Ga0209050_1001755 3300025298 Bacteria 21513
81 Ga0209256_1000021 3300025299 Bacteria 537097
82 Ga0209256_1003855 3300025299 Bacteria 9996
83 Ga0209256_1007593 3300025299 Bacteria 5295
84 Ga0209051_1013668 3300025303 Bacteria 3845
85 Ga0209257_1000133 3300025304 Bacteria 208808
86 Ga0209257_1000320 3300025304 Bacteria 100514
87 Ga0209257_1002186 3300025304 Bacteria 20241
88 Ga0209257_1002557 3300025304 Bacteria 17736
89 Ga0209257_1009066 3300025304 Bacteria 5443
90 Ga0207682_10036096 3300025893 Bacteria 1999
91 Ga0207680_10264727 3300025903 Bacteria 1191
92 Ga0207645_10314898 3300025907 Bacteria 1043
93 Ga0207707_10350453 3300025912 Bacteria 1272
94 Ga0207649_10582299 3300025920 Bacteria 859
95 Ga0207681_10447858 3300025923 Bacteria 1050
96 Ga0207650_10485868 3300025925 Bacteria 1031
97 Ga0207650_10496616 3300025925 Bacteria 1019
98 Ga0207650_11099841 3300025925 Bacteria 676
99 Ga0207659_10477158 3300025926 Bacteria 1053
100 Ga0207659_10593138 3300025926 Bacteria 944
101 Ga0207659_10691518 3300025926 Bacteria 873
102 Ga0207659_11477910 3300025926 Bacteria 582
103 Ga0207644_10117408 3300025931 Bacteria 2021
104 Ga0207644_10314456 3300025931 Bacteria 1265
105 Ga0207686_10306121 3300025934 Bacteria 1182
106 Ga0207709_11341867 3300025935 Bacteria 591
107 Ga0207669_10035019 3300025937 Bacteria 2852
108 Ga0207691_10022309 3300025940 Bacteria 5971
109 Ga0207711_11407908 3300025941 Bacteria 640
110 Ga0207661_10968191 3300025944 Bacteria 784
111 Ga0207679_10303075 3300025945 Bacteria 1378
112 Ga0207679_11235105 3300025945 Bacteria 686
113 Ga0207668_10133772 3300025972 Bacteria 1897
114 Ga0207658_10384467 3300025986 Bacteria 1230
115 Ga0207658_11738071 3300025986 Bacteria 570
116 Ga0207641_10100292 3300026088 Bacteria 2550
117 Ga0207648_11872334 3300026089 Bacteria 561
118 Ga0207683_10144027 3300026121 Bacteria 2148
119 Ga0207683_11449017 3300026121 Bacteria 634
120 Ga0209973_1048406 3300027252 Bacteria 637
121 Ga0307408_100112455 3300031548 Bacteria 2094
122 Ga0307408_100146963 3300031548 Bacteria 1857
123 Ga0307408_101309675 3300031548 Bacteria 679
124 Ga0307408_101568002 3300031548 Bacteria 624
125 Ga0307405_10095435 3300031731 Bacteria 1980
126 Ga0307405_11057822 3300031731 Bacteria 695
127 Ga0307405_12074914 3300031731 Bacteria 510
128 Ga0307413_10035398 3300031824 Bacteria 2863
129 Ga0307413_10182623 3300031824 Bacteria 1497
130 Ga0307413_10374994 3300031824 Bacteria 1106
131 Ga0307413_10925728 3300031824 Bacteria 742
132 Ga0307413_11711814 3300031824 Bacteria 561
133 Ga0307410_10029849 3300031852 Bacteria 3477
134 Ga0307410_10289650 3300031852 Bacteria 1288
135 Ga0307410_10334641 3300031852 Bacteria 1205
136 Ga0307410_12124774 3300031852 Bacteria 502
137 Ga0307406_10002835 3300031901 Bacteria 9448
138 Ga0307406_10020917 3300031901 Bacteria 3863
139 Ga0307406_10047972 3300031901 Bacteria 2695
140 Ga0307406_10895677 3300031901 Bacteria 755
141 Ga0307406_12106983 3300031901 Bacteria 505
142 Ga0307407_10377707 3300031903 Bacteria 1011
143 Ga0307407_10915944 3300031903 Bacteria 673
144 Ga0307412_10346167 3300031911 Bacteria 1191
145 Ga0307412_10528299 3300031911 Bacteria 987
146 Ga0307412_10534869 3300031911 Bacteria 981
147 Ga0307412_11080432 3300031911 Bacteria 713
148 Ga0307409_100390404 3300031995 Bacteria 1326
149 Ga0307409_100713829 3300031995 Bacteria 1003
150 Ga0307416_100314899 3300032002 Bacteria 1564
151 Ga0307416_100319136 3300032002 Bacteria 1555
152 Ga0307416_100330080 3300032002 Bacteria 1532
153 Ga0307416_102285919 3300032002 Bacteria 641
154 Ga0307416_102637267 3300032002 Bacteria 600
155 Ga0307414_10050162 3300032004 Bacteria 2890
156 Ga0307414_10095287 3300032004 Bacteria 2224
157 Ga0307414_10116928 3300032004 Bacteria 2042
158 Ga0307414_10240800 3300032004 Bacteria 1497
159 Ga0307414_10377039 3300032004 Bacteria 1225
160 Ga0307414_10926818 3300032004 Bacteria 799
161 Ga0307414_11584151 3300032004 Bacteria 610
162 Ga0307414_12184143 3300032004 Bacteria 517
163 Ga0307411_10098404 3300032005 Bacteria 2061
164 Ga0307411_10372442 3300032005 Bacteria 1172
165 Ga0307411_10396940 3300032005 Bacteria 1139
166 Ga0307411_10795308 3300032005 Bacteria 832
167 Ga0307411_10836712 3300032005 Bacteria 813
168 Ga0307411_10983276 3300032005 Bacteria 754
169 Ga0307411_11290928 3300032005 Bacteria 665
170 Ga0307411_11416208 3300032005 Bacteria 636
171 Ga0307411_12032382 3300032005 Bacteria 537
172 Ga0307415_100342972 3300032126 Bacteria 1254
173 Ga0307415_101164883 3300032126 Bacteria 725
174 Ga0439436_0017992 3300041404 Bacteria 2114
175 Ga0439436_0062596 3300041404 Bacteria 1040
176 Ga0439436_0178763 3300041404 Bacteria 603
177 Ga0439439_0003020 3300041406 Bacteria 3661
178 Ga0439439_0048860 3300041406 Bacteria 1107
179 Ga0439439_0200730 3300041406 Bacteria 580
180 Ga0439447_011791 3300041407 Bacteria 2533
181 Ga0439461_0032312 3300041410 Bacteria 1096
182 Ga0439465_0000395 3300041413 Bacteria 12664
183 Ga0439465_0287470 3300041413 Bacteria 613
184 Ga0439465_0314848 3300041413 Bacteria 587
185 Ga0451789_1040554 3300041443 Bacteria 735
186 Ga0451789_1246684 3300041443 Bacteria 525
187 Ga0451793_0535872 3300041452 Bacteria 681
188 Ga0451797_1155184 3300041453 Bacteria 719
189 Ga0451797_1478942 3300041453 Bacteria 967
190 Ga0451797_1516063 3300041453 Bacteria 1639
191 Ga0451797_1522925 3300041453 Bacteria 831
192 Ga0451807_0683310 3300041486 Bacteria 1547
193 Ga0451837_0289493 3300041494 Bacteria 1365
194 Ga0451837_1318070 3300041494 Bacteria 868
195 Ga0451837_1354344 3300041494 Bacteria 568
196 Ga0451839_1482540 3300041496 Bacteria 1166
197 Ga0451851_0053312 3300041507 Bacteria 546
198 Ga0451843_0569891 3300041509 Bacteria 3459
199 Ga0451843_1583166 3300041509 Bacteria 3062
200 Ga0439433_0058641 3300041999 Bacteria 916
201 Ga0439445_0051101 3300042004 Bacteria 1116
202 Ga0439432_007569 3300042006 Bacteria 3844
203 Ga0439432_059862 3300042006 Bacteria 1176
204 Ga0439432_160360 3300042006 Bacteria 658
205 Ga0439432_253715 3300042006 Bacteria 504
206 Ga0439449_0002715 3300042007 Bacteria 6889
207 Ga0439449_0008043 3300042007 Bacteria 4006
208 Ga0439449_0010020 3300042007 Bacteria 3585
209 Ga0439449_0027726 3300042007 Bacteria 2112
210 Ga0439452_014780 3300042010 Bacteria 2159
211 Ga0439457_041045 3300042014 Bacteria 1031
212 Ga0439457_083982 3300042014 Bacteria 733
213 Ga0439457_136547 3300042014 Bacteria 585
214 Ga0439462_0011670 3300042015 Bacteria 2241
215 Ga0439462_0016365 3300042015 Bacteria 1915
216 Ga0439462_0100646 3300042015 Bacteria 796
217 Ga0439462_0112561 3300042015 Bacteria 754
218 Ga0450898_132097 3300042134 Bacteria 538
219 Ga0450899_041359 3300042135 Bacteria 577
220 Ga0450906_063690 3300042145 Bacteria 657
221 Ga0495638_0066136 3300046460 Bacteria 2223
222 Ga0495616_0343286 3300046513 Bacteria 623
223 Ga0495663_0000269 3300046525 Bacteria 19924
224 Ga0495663_0055414 3300046525 Bacteria 1236
225 Ga0495663_0086003 3300046525 Bacteria 1019
226 Ga0495663_0232521 3300046525 Bacteria 650
227 Ga0495598_0001721 3300046537 Bacteria 4387
228 Ga0495598_0014615 3300046537 Bacteria 1966
229 Ga0495621_0000265 3300046539 Bacteria 12518
230 Ga0495621_0008271 3300046539 Bacteria 3112
231 Ga0495656_0002378 3300046615 Bacteria 6235
232 Ga0495656_0049744 3300046615 Bacteria 1786
233 Ga0495668_0002920 3300046616 Bacteria 13484
234 Ga0495670_0093044 3300046691 Bacteria 1545
235 Ga0495636_0058570 3300047318 Bacteria 1624
236 Ga0495636_0066169 3300047318 Bacteria 1536
237 Ga0495636_0210896 3300047318 Bacteria 889
238 Ga0495615_0007016 3300048090 Bacteria 2119
239 Ga0496108_0093996 3300048911 Bacteria 2551
240 Ga0496109_0101937 3300048912 Bacteria 2664
241 Ga0496109_0719028 3300048912 Bacteria 936
242 Ga0496111_0916756 3300048914 Bacteria 630
243 Ga0496112_0206797 3300048915 Bacteria 1921
244 Ga0496113_0118932 3300048916 Bacteria 2064
245 Ga0496121_0009916 3300048924 Bacteria 10842
246 Ga0496122_0014313 3300048925 Bacteria 7680
247 Ga0496123_0012068 3300048926 Bacteria 7410
248 Ga0496124_0041030 3300048927 Bacteria 3998
249 Ga0501034_0002634 3300049571 Bacteria 21272
250 Ga0501034_1386415 3300049571 Bacteria 578
251 Ga0501202_025970 3300049652 Bacteria 1196
252 Ga0501209_191746 3300049656 Bacteria 627
253 Ga0501216_152635 3300049660 Bacteria 550
254 Ga0501223_014522 3300049663 Bacteria 1562
255 Ga0501223_033277 3300049663 Bacteria 1002
256 Ga0501239_002389 3300049672 Bacteria 1700
257 Ga0501242_021722 3300049674 Bacteria 830
258 Ga0501249_013858 3300049679 Bacteria 1716
259 Ga0501250_012741 3300049680 Bacteria 999
260 Ga0501251_028416 3300049681 Bacteria 784
261 Ga0501259_027011 3300049688 Bacteria 1061
262 Ga0501225_0039458 3300049705 Bacteria 1301
263 Ga0501245_071081 3300049708 Bacteria 655
264 Ga0501241_167300 3300049758 Bacteria 515
265 Ga0501262_028828 3300049759 Bacteria 792
266 Ga0501263_023437 3300049760 Bacteria 841
267 Ga0501266_006719 3300049763 Bacteria 1432
268 Ga0501268_082090 3300049765 Bacteria 667
269 Ga0501270_078399 3300049767 Bacteria 652
270 Ga0501274_004735 3300049771 Bacteria 1132
271 Ga0500577_0429567 3300053142 Bacteria 577
272 2643975769 2643221593 Bacteria 6296053
273 2894416387 2894414249 Bacteria 4405451
274 2919516269 2919513703 Bacteria 3844312
275 2919676888 2919675420 Bacteria 3969095
276 2941493401 2941489479 Bacteria 6313767
277 2995952502 2995948881 Bacteria 6358104
278 8003016346 8003014200 Bacteria 4059994
279 Ga0065715_10307186
280 JGI25151J46595_10000818
281 JGI25151J46595_10018579
282 rootL2_10214729
283 Ga0055526_1009709
284 Ga0055537_1000551
285 Ga0055524_1000211
286 Ga0055524_1008824
287 Ga0055536_1006324
288 Ga0055536_1015529
289 Ga0055536_1022381
290 Ga0055536_1042952
291 Ga0055536_1066052
292 Ga0055534_1000107
293 Ga0055534_1065470
294 Ga0055528_1000027
295 Ga0055530_10003516
296 Ga0055540_1037939
297 Ga0055531_10011679
298 Ga0055531_10014683
299 Ga0055531_10046999
300 Ga0055531_10051663
301 Ga0055531_10052675
302 Ga0065715_10375301
303 Ga0070670_101164709
304 Ga0070670_101270115
305 Ga0070666_11291783
306 Ga0070682_101510224
307 Ga0070668_100034886
308 Ga0070668_101972673
309 Ga0070669_100377759
310 Ga0070675_100601173
311 Ga0070671_100336813
312 Ga0070674_100051684
313 Ga0070667_100410824
314 Ga0070678_101066178
315 Ga0070662_100509749
316 Ga0070681_10424207
317 Ga0070672_100017520
318 Ga0070686_100552407
319 Ga0070686_101311727
320 Ga0070664_101581997
321 Ga0068871_101673380
322 Ga0075430_100823371
323 Ga0105243_10892487
324 Ga0105241_10326837
325 Ga0105242_10491963
326 Ga0105248_12113442
327 Ga0105248_12876243
328 Ga0105032_100170
329 Ga0157313_1011725
330 Ga0157324_1066371
331 Ga0157315_1000661
332 Ga0157316_1050415
333 Ga0157373_10559833
334 Ga0157374_11901794
335 Ga0157375_10099958
336 Ga0157380_10342621
337 Ga0182008_10039004
338 Ga0183360_10001
339 Ga0207425_1068717
340 Ga0209565_1000005
341 Ga0209565_1005097
342 Ga0209673_1000011
343 Ga0209130_1004968
344 Ga0209675_1000004
345 Ga0209675_1010841
346 Ga0209675_1019283
347 Ga0209676_1007525
348 Ga0209676_1007836
349 Ga0209676_1007864
350 Ga0209676_1018672
351 Ga0209676_1026770
352 Ga0209025_1000884
353 Ga0209025_1003704
354 Ga0209025_1030651
355 Ga0209564_1000018
356 Ga0209564_1022122
357 Ga0209758_1031266
358 Ga0209050_1001755
359 Ga0209256_1000021
360 Ga0209256_1003855
361 Ga0209256_1007593
362 Ga0209051_1013668
363 Ga0209257_1000133
364 Ga0209257_1000320
365 Ga0209257_1002186
366 Ga0209257_1002557
367 Ga0209257_1009066
368 Ga0207682_10036096
369 Ga0207680_10264727
370 Ga0207645_10314898
371 Ga0207707_10350453
372 Ga0207649_10582299
373 Ga0207681_10447858
374 Ga0207650_10485868
375 Ga0207650_10496616
376 Ga0207650_11099841
377 Ga0207659_10477158
378 Ga0207659_10593138
379 Ga0207659_10691518
380 Ga0207659_11477910
381 Ga0207644_10117408
382 Ga0207644_10314456
383 Ga0207686_10306121
384 Ga0207709_11341867
385 Ga0207669_10035019
386 Ga0207691_10022309
387 Ga0207711_11407908
388 Ga0207661_10968191
389 Ga0207679_10303075
390 Ga0207679_11235105
391 Ga0207668_10133772
392 Ga0207658_10384467
393 Ga0207658_11738071
394 Ga0207641_10100292
395 Ga0207648_11872334
396 Ga0207683_10144027
397 Ga0207683_11449017
398 Ga0209973_1048406
399 Ga0307408_100112455
400 Ga0307408_100146963
401 Ga0307408_101309675
402 Ga0307408_101568002
403 Ga0307405_10095435
404 Ga0307405_11057822
405 Ga0307405_12074914
406 Ga0307413_10035398
407 Ga0307413_10182623
408 Ga0307413_10374994
409 Ga0307413_10925728
410 Ga0307413_11711814
411 Ga0307410_10029849
412 Ga0307410_10289650
413 Ga0307410_10334641
414 Ga0307410_12124774
415 Ga0307406_10002835
416 Ga0307406_10020917
417 Ga0307406_10047972
418 Ga0307406_10895677
419 Ga0307406_12106983
420 Ga0307407_10377707
421 Ga0307407_10915944
422 Ga0307412_10346167
423 Ga0307412_10528299
424 Ga0307412_10534869
425 Ga0307412_11080432
426 Ga0307409_100390404
427 Ga0307409_100713829
428 Ga0307416_100314899
429 Ga0307416_100319136
430 Ga0307416_100330080
431 Ga0307416_102285919
432 Ga0307416_102637267
433 Ga0307414_10050162
434 Ga0307414_10095287
435 Ga0307414_10116928
436 Ga0307414_10240800
437 Ga0307414_10377039
438 Ga0307414_10926818
439 Ga0307414_11584151
440 Ga0307414_12184143
441 Ga0307411_10098404
442 Ga0307411_10372442
443 Ga0307411_10396940
444 Ga0307411_10795308
445 Ga0307411_10836712
446 Ga0307411_10983276
447 Ga0307411_11290928
448 Ga0307411_11416208
449 Ga0307411_12032382
450 Ga0307415_100342972
451 Ga0307415_101164883
452 Ga0439436_0017992
453 Ga0439436_0062596
454 Ga0439436_0178763
455 Ga0439439_0003020
456 Ga0439439_0048860
457 Ga0439439_0200730
458 Ga0439447_011791
459 Ga0439461_0032312
460 Ga0439465_0000395
461 Ga0439465_0287470
462 Ga0439465_0314848
463 Ga0451789_1040554
464 Ga0451789_1246684
465 Ga0451793_0535872
466 Ga0451797_1155184
467 Ga0451797_1478942
468 Ga0451797_1516063
469 Ga0451797_1522925
470 Ga0451807_0683310
471 Ga0451837_0289493
472 Ga0451837_1318070
473 Ga0451837_1354344
474 Ga0451839_1482540
475 Ga0451851_0053312
476 Ga0451843_0569891
477 Ga0451843_1583166
478 Ga0439433_0058641
479 Ga0439445_0051101
480 Ga0439432_007569
481 Ga0439432_059862
482 Ga0439432_160360
483 Ga0439432_253715
484 Ga0439449_0002715
485 Ga0439449_0008043
486 Ga0439449_0010020
487 Ga0439449_0027726
488 Ga0439452_014780
489 Ga0439457_041045
490 Ga0439457_083982
491 Ga0439457_136547
492 Ga0439462_0011670
493 Ga0439462_0016365
494 Ga0439462_0100646
495 Ga0439462_0112561
496 Ga0450898_132097
497 Ga0450899_041359
498 Ga0450906_063690
499 Ga0495638_0066136
500 Ga0495616_0343286
501 Ga0495663_0000269
502 Ga0495663_0055414
503 Ga0495663_0086003
504 Ga0495663_0232521
505 Ga0495598_0001721
506 Ga0495598_0014615
507 Ga0495621_0000265
508 Ga0495621_0008271
509 Ga0495656_0002378
510 Ga0495656_0049744
511 Ga0495668_0002920
512 Ga0495670_0093044
513 Ga0495636_0058570
514 Ga0495636_0066169
515 Ga0495636_0210896
516 Ga0495615_0007016
517 Ga0496108_0093996
518 Ga0496109_0101937
519 Ga0496109_0719028
520 Ga0496111_0916756
521 Ga0496112_0206797
522 Ga0496113_0118932
523 Ga0496121_0009916
524 Ga0496122_0014313
525 Ga0496123_0012068
526 Ga0496124_0041030
527 Ga0501034_0002634
528 Ga0501034_1386415
529 Ga0501202_025970
530 Ga0501209_191746
531 Ga0501216_152635
532 Ga0501223_014522
533 Ga0501223_033277
534 Ga0501239_002389
535 Ga0501242_021722
536 Ga0501249_013858
537 Ga0501250_012741
538 Ga0501251_028416
539 Ga0501259_027011
540 Ga0501225_0039458
541 Ga0501245_071081
542 Ga0501241_167300
543 Ga0501262_028828
544 Ga0501263_023437
545 Ga0501266_006719
546 Ga0501268_082090
547 Ga0501270_078399
548 Ga0501274_004735
549 Ga0500577_0429567
550 2643975769
551 2894416387
552 2919516269
553 2919676888
554 2941493401
555 2995952502
556 8003016346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

7

81

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8761 1 79
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8662 2 79
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8662 1 79
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8465 2 79
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8438 2 76
ID Description Score Start End Superfamily
af_I6XWG2_11_92_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8732 1 79 3.10.20.30
af_I6XWG2_11_92_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8634 1 79 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8567 4 76 3.10.20.30
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8496 3 79 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8449 3 79 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A3M8SVZ1-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9941 2 79 GO:0000166
GO:0006777
GO:1990133
AF-A0A0S7Z8A9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9922 2 79 GO:0000166
GO:0006777
GO:1990133
AF-A0A2W4KBF5-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9877 2 79 GO:0000166
GO:0006777
GO:1990133
AF-A0A2T6DRT3-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9875 1 79 GO:0000166
GO:0006777
GO:1990133
AF-A0A4Y6UA71-F1-model_v4 Molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) 0.9874 1 79 GO:0005525
GO:0005737
GO:0006777
GO:0046872
GO:0061603

Map