F381998

General Info

Members Datasets Scaffolds Average Seq Length
277 141 554 150

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_1078969|Ga0496102_1078969_41_577
Length 178
Sequence MRFASFAAKRFSSACGKNRPSSRGESFSVPSRADEVEIRRARLSDAPAVAELSGQLGYPTPEREMADRLAHLIRHPRFGAVLIAENSDGKIVGWLHVSVTPLLEVELRAEVNGLIVAEGQRSSGSGAKLLEAAEAWAKSKGCASMSVRSNVVRDRAHAFYLRNGYEHYKTQKAFRKAL

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
107 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
118 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.33
Rhizosphere 94.22
Stem 0
Stem Tuber 0
Unclassified 35.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_1078969 3300048905 Unclassified 723
2 Ga0065707_10116489 3300005295 Bacteria 2236
3 Ga0070680_100063456 3300005336 Bacteria 3026
4 Ga0070660_100121206 3300005339 Bacteria 2087
5 Ga0070660_100362164 3300005339 Unclassified 1195
6 Ga0070675_101005855 3300005354 Unclassified 765
7 Ga0070659_100029311 3300005366 Bacteria 4253
8 Ga0070659_100134391 3300005366 Unclassified 2011
9 Ga0070667_101142295 3300005367 Unclassified 728
10 Ga0070667_101274477 3300005367 Unclassified 688
11 Ga0070703_10001856 3300005406 Bacteria 6218
12 Ga0070709_10030381 3300005434 Bacteria 3242
13 Ga0070709_10082375 3300005434 Unclassified 2102
14 Ga0070709_10174294 3300005434 Bacteria 1506
15 Ga0070713_100037464 3300005436 Unclassified 3921
16 Ga0070713_100196627 3300005436 Bacteria 1819
17 Ga0070713_100221942 3300005436 Bacteria 1715
18 Ga0070713_100240701 3300005436 Unclassified 1648
19 Ga0070713_100399398 3300005436 Bacteria 1283
20 Ga0070711_100021594 3300005439 Unclassified 4165
21 Ga0070711_100235371 3300005439 Unclassified 1430
22 Ga0070711_100515920 3300005439 Unclassified 987
23 Ga0070711_100703132 3300005439 Unclassified 851
24 Ga0070705_100002256 3300005440 Bacteria 9763
25 Ga0070694_100003278 3300005444 Bacteria 9669
26 Ga0070694_100296635 3300005444 Unclassified 1237
27 Ga0070708_100035512 3300005445 Bacteria 4343
28 Ga0070708_100036557 3300005445 Unclassified 4284
29 Ga0070708_100052515 3300005445 Bacteria 3614
30 Ga0070708_100206072 3300005445 Bacteria 1842
31 Ga0070706_100006454 3300005467 Bacteria 11070
32 Ga0070706_100140967 3300005467 Bacteria 2250
33 Ga0070706_100163355 3300005467 Unclassified 2079
34 Ga0070706_100580423 3300005467 Unclassified 1042
35 Ga0070706_100768833 3300005467 Bacteria 892
36 Ga0070707_100061756 3300005468 Unclassified 3594
37 Ga0070707_100198296 3300005468 Unclassified 1957
38 Ga0070707_100315564 3300005468 Unclassified 1519
39 Ga0070698_100203727 3300005471 Bacteria 1914
40 Ga0070698_101736094 3300005471 Bacteria 577
41 Ga0070699_100046007 3300005518 Unclassified 3776
42 Ga0070699_100375272 3300005518 Bacteria 1283
43 Ga0070679_100051908 3300005530 Bacteria 4085
44 Ga0070697_100000061 3300005536 Bacteria 85209
45 Ga0070697_100012677 3300005536 Bacteria 6604
46 Ga0070697_100026204 3300005536 Unclassified 4654
47 Ga0070697_100376571 3300005536 Unclassified 1229
48 Ga0070686_100024472 3300005544 Bacteria 3619
49 Ga0070695_100001117 3300005545 Bacteria 14697
50 Ga0070695_100158522 3300005545 Bacteria 1586
51 Ga0070696_100002008 3300005546 Bacteria 13350
52 Ga0070693_100000014 3300005547 Bacteria 68137
53 Ga0070693_100027830 3300005547 Unclassified 3068
54 Ga0070693_100033767 3300005547 Bacteria 2826
55 Ga0070665_100001678 3300005548 Bacteria 25511
56 Ga0070665_100961823 3300005548 Unclassified 866
57 Ga0070704_100003164 3300005549 Bacteria 9400
58 Ga0068855_100003658 3300005563 Bacteria 18797
59 Ga0068854_100455499 3300005578 Bacteria 1069
60 Ga0068856_100019632 3300005614 Bacteria 6559
61 Ga0068856_100497289 3300005614 Bacteria 1240
62 Ga0068859_100442110 3300005617 Unclassified 1397
63 Ga0068863_100008359 3300005841 Bacteria 10108
64 Ga0068863_100126422 3300005841 Bacteria 2439
65 Ga0068858_100068330 3300005842 Bacteria 3293
66 Ga0068860_100021553 3300005843 Bacteria 6240
67 Ga0068860_100593711 3300005843 Bacteria 1112
68 Ga0081455_10055579 3300005937 Bacteria 3366
69 Ga0081540_1138890 3300005983 Unclassified 979
70 Ga0070717_10035396 3300006028 Unclassified 4042
71 Ga0070715_10015541 3300006163 Bacteria 2842
72 Ga0070716_100000707 3300006173 Bacteria 14236
73 Ga0070716_100001222 3300006173 Bacteria 11299
74 Ga0070716_100034847 3300006173 Bacteria 2763
75 Ga0070716_100052177 3300006173 Bacteria 2328
76 Ga0070716_100055230 3300006173 Bacteria 2272
77 Ga0070716_100112877 3300006173 Bacteria 1687
78 Ga0070716_100205172 3300006173 Unclassified 1313
79 Ga0070716_100371898 3300006173 Bacteria 1019
80 Ga0070712_100033697 3300006175 Bacteria 3467
81 Ga0070712_100080106 3300006175 Bacteria 2363
82 Ga0070712_100188780 3300006175 Unclassified 1611
83 Ga0070712_100265830 3300006175 Bacteria 1376
84 Ga0070712_100592798 3300006175 Bacteria 937
85 Ga0070712_100597726 3300006175 Unclassified 934
86 Ga0075433_10158483 3300006852 Unclassified 2014
87 Ga0075433_10533203 3300006852 Bacteria 1032
88 Ga0075434_100066374 3300006871 Bacteria 3594
89 Ga0075434_100079401 3300006871 Unclassified 3278
90 Ga0075434_100109325 3300006871 Unclassified 2775
91 Ga0075434_100520331 3300006871 Bacteria 1210
92 Ga0075436_100002265 3300006914 Bacteria 13279
93 Ga0075436_100068911 3300006914 Unclassified 2444
94 Ga0075436_100096296 3300006914 Bacteria 2059
95 Ga0075436_100418729 3300006914 Unclassified 972
96 Ga0075436_100677345 3300006914 Unclassified 763
97 Ga0097620_100442096 3300006931 Unclassified 1397
98 Ga0075435_100116731 3300007076 Bacteria 2224
99 Ga0075435_100188227 3300007076 Unclassified 1746
100 Ga0075435_100260547 3300007076 Unclassified 1477
101 Ga0075435_100501552 3300007076 Bacteria 1049
102 Ga0099794_10011591 3300007265 Bacteria 3779
103 Ga0099794_10012579 3300007265 Bacteria 3657
104 Ga0099794_10020527 3300007265 Bacteria 2991
105 Ga0099794_10038597 3300007265 Bacteria 2263
106 Ga0099794_10055698 3300007265 Bacteria 1911
107 Ga0099794_10060382 3300007265 Unclassified 1841
108 Ga0099794_10065600 3300007265 Bacteria 1770
109 Ga0099794_10071123 3300007265 Bacteria 1704
110 Ga0099794_10443811 3300007265 Unclassified 680
111 Ga0099794_10509675 3300007265 Unclassified 634
112 Ga0099795_10072760 3300007788 Unclassified 1300
113 Ga0099795_10083771 3300007788 Bacteria 1225
114 Ga0105247_10076853 3300009101 Bacteria 2097
115 Ga0105243_10102452 3300009148 Bacteria 2379
116 Ga0105243_10986656 3300009148 Unclassified 844
117 Ga0105241_10139390 3300009174 Unclassified 1973
118 Ga0105242_11843565 3300009176 Unclassified 644
119 Ga0105248_12088765 3300009177 Bacteria 644
120 Ga0105237_10342526 3300009545 Bacteria 1499
121 Ga0105249_11226949 3300009553 Unclassified 821
122 Ga0099796_10094322 3300010159 Bacteria 1117
123 Ga0099796_10116129 3300010159 Unclassified 1024
124 Ga0105239_11587869 3300010375 Unclassified 756
125 Ga0157373_10186895 3300013100 Unclassified 1459
126 Ga0157371_10249238 3300013102 Unclassified 1278
127 Ga0157370_10646880 3300013104 Unclassified 966
128 Ga0157369_10000399 3300013105 Bacteria 57828
129 Ga0157369_10678489 3300013105 Unclassified 1062
130 Ga0157374_10005283 3300013296 Bacteria 10841
131 Ga0157374_10041259 3300013296 Unclassified 4252
132 Ga0157378_10000694 3300013297 Bacteria 31676
133 Ga0157378_10025370 3300013297 Bacteria 5220
134 Ga0157378_10161270 3300013297 Bacteria 2097
135 Ga0163162_10009094 3300013306 Bacteria 9657
136 Ga0157372_10049595 3300013307 Bacteria 4668
137 Ga0157372_10194876 3300013307 Bacteria 2347
138 Ga0157375_10121469 3300013308 Bacteria 2722
139 Ga0163163_10157785 3300014325 Bacteria 2313
140 Ga0157379_10526322 3300014968 Bacteria 1098
141 Ga0157376_10000070 3300014969 Bacteria 82778
142 Ga0157376_10411551 3300014969 Unclassified 1310
143 Ga0207653_10001171 3300025885 Bacteria 8566
144 Ga0207710_10129712 3300025900 Bacteria 1210
145 Ga0207685_10077759 3300025905 Bacteria 1364
146 Ga0207685_10129105 3300025905 Bacteria 1119
147 Ga0207699_10028853 3300025906 Bacteria 3089
148 Ga0207699_10072301 3300025906 Unclassified 2112
149 Ga0207699_10307447 3300025906 Bacteria 1109
150 Ga0207699_10495130 3300025906 Unclassified 882
151 Ga0207684_10009365 3300025910 Bacteria 8653
152 Ga0207684_10162277 3300025910 Unclassified 1925
153 Ga0207671_10334130 3300025914 Bacteria 1200
154 Ga0207693_10007292 3300025915 Bacteria 9099
155 Ga0207693_10036027 3300025915 Bacteria 3899
156 Ga0207693_10056407 3300025915 Bacteria 3080
157 Ga0207693_10297056 3300025915 Unclassified 1265
158 Ga0207693_10460939 3300025915 Bacteria 993
159 Ga0207663_10012288 3300025916 Bacteria 4625
160 Ga0207663_10041533 3300025916 Unclassified 2803
161 Ga0207663_10445441 3300025916 Unclassified 998
162 Ga0207663_10928508 3300025916 Bacteria 696
163 Ga0207660_10140120 3300025917 Bacteria 1848
164 Ga0207657_10204463 3300025919 Unclassified 1587
165 Ga0207652_10053520 3300025921 Bacteria 3467
166 Ga0207652_10422908 3300025921 Unclassified 1201
167 Ga0207646_10010921 3300025922 Bacteria 8822
168 Ga0207646_10091725 3300025922 Unclassified 2719
169 Ga0207646_10645868 3300025922 Unclassified 948
170 Ga0207700_10015067 3300025928 Bacteria 5086
171 Ga0207700_10061685 3300025928 Bacteria 2844
172 Ga0207700_11635497 3300025928 Unclassified 569
173 Ga0207664_10318912 3300025929 Bacteria 1371
174 Ga0207690_10100341 3300025932 Bacteria 2066
175 Ga0207709_10174595 3300025935 Unclassified 1511
176 Ga0207709_10609397 3300025935 Unclassified 865
177 Ga0207665_10000032 3300025939 Bacteria 91671
178 Ga0207665_10003427 3300025939 Bacteria 10609
179 Ga0207665_10014542 3300025939 Bacteria 5182
180 Ga0207665_10063704 3300025939 Bacteria 2504
181 Ga0207665_10143715 3300025939 Bacteria 1704
182 Ga0207665_10248266 3300025939 Bacteria 1314
183 Ga0207665_10685488 3300025939 Bacteria 805
184 Ga0207665_10697277 3300025939 Unclassified 798
185 Ga0207711_11130132 3300025941 Bacteria 724
186 Ga0207689_10103476 3300025942 Bacteria 2339
187 Ga0207689_10998975 3300025942 Bacteria 706
188 Ga0207667_10021349 3300025949 Bacteria 7176
189 Ga0207667_10526596 3300025949 Bacteria 1197
190 Ga0207712_10301961 3300025961 Bacteria 1314
191 Ga0207640_10979057 3300025981 Bacteria 743
192 Ga0207658_10127271 3300025986 Bacteria 2041
193 Ga0207703_10009243 3300026035 Bacteria 7750
194 Ga0207702_10086614 3300026078 Bacteria 2732
195 Ga0207702_10182521 3300026078 Unclassified 1933
196 Ga0207702_10651390 3300026078 Bacteria 1036
197 Ga0207641_10001717 3300026088 Bacteria 21227
198 Ga0207641_10123308 3300026088 Bacteria 2316
199 Ga0207648_10913724 3300026089 Bacteria 820
200 Ga0207648_12145213 3300026089 Unclassified 519
201 Ga0209179_1076595 3300027512 Unclassified 736
202 Ga0209588_1001584 3300027671 Bacteria 5983
203 Ga0209588_1001716 3300027671 Bacteria 5788
204 Ga0209588_1004870 3300027671 Bacteria 3817
205 Ga0209588_1010696 3300027671 Unclassified 2762
206 Ga0209588_1011853 3300027671 Unclassified 2640
207 Ga0209588_1086278 3300027671 Unclassified 1013
208 Ga0209588_1159641 3300027671 Unclassified 712
209 Ga0265354_1000080 3300028016 Bacteria 16422
210 Ga0265354_1001934 3300028016 Bacteria 2746
211 Ga0268266_10001361 3300028379 Bacteria 29494
212 Ga0268264_10015634 3300028381 Bacteria 6217
213 Ga0268264_10704766 3300028381 Bacteria 1003
214 Ga0265319_1051143 3300028563 Bacteria 1363
215 Ga0265318_10268634 3300028577 Bacteria 622
216 Ga0265765_1007038 3300030879 Bacteria 1208
217 Ga0265760_10020147 3300031090 Unclassified 1924
218 Ga0265760_10051141 3300031090 Bacteria 1244
219 Ga0265325_10415044 3300031241 Unclassified 589
220 Ga0265340_10138180 3300031247 Bacteria 1115
221 Ga0265340_10277242 3300031247 Unclassified 745
222 Ga0316212_1003232 3300033547 Bacteria 2344
223 Ga0316212_1003351 3300033547 Bacteria 2310
224 Ga0373940_0257272 3300035088 Bacteria 590
225 Ga0373932_0388327 3300035112 Bacteria 538
226 Ga0373954_0073427 3300035118 Bacteria 1628
227 Ga0373956_0167966 3300035119 Unclassified 1035
228 Ga0373946_0094428 3300035171 Unclassified 1330
229 Ga0373955_0709889 3300035172 Unclassified 617
230 Ga0373931_0715530 3300035691 Unclassified 662
231 Ga0373931_0870831 3300035691 Bacteria 604
232 Ga0373935_0372928 3300035692 Unclassified 1021
233 Ga0373927_0139094 3300035695 Bacteria 1587
234 Ga0373925_0016296 3300037068 Bacteria 5381
235 Ga0451839_0119937 3300041496 Bacteria 785
236 Ga0451847_0324558 3300041503 Bacteria 616
237 Ga0495603_0207046 3300046455 Unclassified 1133
238 Ga0495580_0096779 3300046472 Bacteria 2053
239 Ga0495580_0187457 3300046472 Bacteria 1427
240 Ga0495582_0002105 3300046473 Bacteria 11130
241 Ga0495628_0600153 3300046516 Unclassified 786
242 Ga0495630_0041853 3300046517 Bacteria 3421
243 Ga0495587_0006250 3300046536 Bacteria 7777
244 Ga0495658_0136642 3300046683 Bacteria 1496
245 Ga0495604_0255161 3300047317 Bacteria 1194
246 Ga0495676_0890756 3300047321 Unclassified 570
247 Ga0495614_0369534 3300048089 Unclassified 670
248 Ga0495614_0369573 3300048089 Unclassified 670
249 Ga0496102_0005385 3300048905 Bacteria 10865
250 Ga0496103_0035202 3300048906 Bacteria 3065
251 Ga0496104_0340739 3300048907 Unclassified 1412
252 Ga0496106_0017697 3300048909 Bacteria 5271
253 Ga0496107_0039468 3300048910 Bacteria 3387
254 Ga0496111_0316566 3300048914 Unclassified 1156
255 Ga0496112_0061261 3300048915 Bacteria 3709
256 Ga0496114_0003660 3300048917 Bacteria 11827
257 Ga0496114_0975433 3300048917 Unclassified 730
258 Ga0496115_0007604 3300048918 Bacteria 7982
259 Ga0496115_0108153 3300048918 Bacteria 2283
260 nmdc:mga0n895_27778_c1 3300050512 Bacteria 5378
261 nmdc:mga0n895_56059_c1 3300050512 Bacteria 3881
262 nmdc:mga0n895_67611_c1 3300050512 Bacteria 3539
263 nmdc:mga0rr50_100158_c1 3300050513 Bacteria 2275
264 nmdc:mga0rr50_165610_c1 3300050513 Unclassified 1797
265 nmdc:mga0rr50_553204_c1 3300050513 Unclassified 980
266 nmdc:mga0rr50_62997_c1 3300050513 Bacteria 2799
267 nmdc:mga0rr50_66249_c1 3300050513 Bacteria 1882
268 nmdc:mga08x19_103547_c1 3300050514 Bacteria 1891
269 nmdc:mga08x19_135656_c1 3300050514 Bacteria 1659
270 nmdc:mga08x19_1359_c1 3300050514 Bacteria 15167
271 nmdc:mga08x19_267654_c1 3300050514 Bacteria 1182
272 nmdc:mga08x19_386190_c1 3300050514 Unclassified 981
273 nmdc:mga08x19_448761_c1 3300050514 Unclassified 908
274 nmdc:mga08x19_8109_c1 3300050514 Bacteria 6240
275 nmdc:mga0a205_230928_c1 3300050515 Unclassified 1733
276 nmdc:mga0a205_360917_c1 3300050515 Bacteria 1319
277 Ga0495612_0139538 3300053078 Bacteria 1051
278 Ga0496102_1078969
279 Ga0065707_10116489
280 Ga0070680_100063456
281 Ga0070660_100121206
282 Ga0070660_100362164
283 Ga0070675_101005855
284 Ga0070659_100029311
285 Ga0070659_100134391
286 Ga0070667_101142295
287 Ga0070667_101274477
288 Ga0070703_10001856
289 Ga0070709_10030381
290 Ga0070709_10082375
291 Ga0070709_10174294
292 Ga0070713_100037464
293 Ga0070713_100196627
294 Ga0070713_100221942
295 Ga0070713_100240701
296 Ga0070713_100399398
297 Ga0070711_100021594
298 Ga0070711_100235371
299 Ga0070711_100515920
300 Ga0070711_100703132
301 Ga0070705_100002256
302 Ga0070694_100003278
303 Ga0070694_100296635
304 Ga0070708_100035512
305 Ga0070708_100036557
306 Ga0070708_100052515
307 Ga0070708_100206072
308 Ga0070706_100006454
309 Ga0070706_100140967
310 Ga0070706_100163355
311 Ga0070706_100580423
312 Ga0070706_100768833
313 Ga0070707_100061756
314 Ga0070707_100198296
315 Ga0070707_100315564
316 Ga0070698_100203727
317 Ga0070698_101736094
318 Ga0070699_100046007
319 Ga0070699_100375272
320 Ga0070679_100051908
321 Ga0070697_100000061
322 Ga0070697_100012677
323 Ga0070697_100026204
324 Ga0070697_100376571
325 Ga0070686_100024472
326 Ga0070695_100001117
327 Ga0070695_100158522
328 Ga0070696_100002008
329 Ga0070693_100000014
330 Ga0070693_100027830
331 Ga0070693_100033767
332 Ga0070665_100001678
333 Ga0070665_100961823
334 Ga0070704_100003164
335 Ga0068855_100003658
336 Ga0068854_100455499
337 Ga0068856_100019632
338 Ga0068856_100497289
339 Ga0068859_100442110
340 Ga0068863_100008359
341 Ga0068863_100126422
342 Ga0068858_100068330
343 Ga0068860_100021553
344 Ga0068860_100593711
345 Ga0081455_10055579
346 Ga0081540_1138890
347 Ga0070717_10035396
348 Ga0070715_10015541
349 Ga0070716_100000707
350 Ga0070716_100001222
351 Ga0070716_100034847
352 Ga0070716_100052177
353 Ga0070716_100055230
354 Ga0070716_100112877
355 Ga0070716_100205172
356 Ga0070716_100371898
357 Ga0070712_100033697
358 Ga0070712_100080106
359 Ga0070712_100188780
360 Ga0070712_100265830
361 Ga0070712_100592798
362 Ga0070712_100597726
363 Ga0075433_10158483
364 Ga0075433_10533203
365 Ga0075434_100066374
366 Ga0075434_100079401
367 Ga0075434_100109325
368 Ga0075434_100520331
369 Ga0075436_100002265
370 Ga0075436_100068911
371 Ga0075436_100096296
372 Ga0075436_100418729
373 Ga0075436_100677345
374 Ga0097620_100442096
375 Ga0075435_100116731
376 Ga0075435_100188227
377 Ga0075435_100260547
378 Ga0075435_100501552
379 Ga0099794_10011591
380 Ga0099794_10012579
381 Ga0099794_10020527
382 Ga0099794_10038597
383 Ga0099794_10055698
384 Ga0099794_10060382
385 Ga0099794_10065600
386 Ga0099794_10071123
387 Ga0099794_10443811
388 Ga0099794_10509675
389 Ga0099795_10072760
390 Ga0099795_10083771
391 Ga0105247_10076853
392 Ga0105243_10102452
393 Ga0105243_10986656
394 Ga0105241_10139390
395 Ga0105242_11843565
396 Ga0105248_12088765
397 Ga0105237_10342526
398 Ga0105249_11226949
399 Ga0099796_10094322
400 Ga0099796_10116129
401 Ga0105239_11587869
402 Ga0157373_10186895
403 Ga0157371_10249238
404 Ga0157370_10646880
405 Ga0157369_10000399
406 Ga0157369_10678489
407 Ga0157374_10005283
408 Ga0157374_10041259
409 Ga0157378_10000694
410 Ga0157378_10025370
411 Ga0157378_10161270
412 Ga0163162_10009094
413 Ga0157372_10049595
414 Ga0157372_10194876
415 Ga0157375_10121469
416 Ga0163163_10157785
417 Ga0157379_10526322
418 Ga0157376_10000070
419 Ga0157376_10411551
420 Ga0207653_10001171
421 Ga0207710_10129712
422 Ga0207685_10077759
423 Ga0207685_10129105
424 Ga0207699_10028853
425 Ga0207699_10072301
426 Ga0207699_10307447
427 Ga0207699_10495130
428 Ga0207684_10009365
429 Ga0207684_10162277
430 Ga0207671_10334130
431 Ga0207693_10007292
432 Ga0207693_10036027
433 Ga0207693_10056407
434 Ga0207693_10297056
435 Ga0207693_10460939
436 Ga0207663_10012288
437 Ga0207663_10041533
438 Ga0207663_10445441
439 Ga0207663_10928508
440 Ga0207660_10140120
441 Ga0207657_10204463
442 Ga0207652_10053520
443 Ga0207652_10422908
444 Ga0207646_10010921
445 Ga0207646_10091725
446 Ga0207646_10645868
447 Ga0207700_10015067
448 Ga0207700_10061685
449 Ga0207700_11635497
450 Ga0207664_10318912
451 Ga0207690_10100341
452 Ga0207709_10174595
453 Ga0207709_10609397
454 Ga0207665_10000032
455 Ga0207665_10003427
456 Ga0207665_10014542
457 Ga0207665_10063704
458 Ga0207665_10143715
459 Ga0207665_10248266
460 Ga0207665_10685488
461 Ga0207665_10697277
462 Ga0207711_11130132
463 Ga0207689_10103476
464 Ga0207689_10998975
465 Ga0207667_10021349
466 Ga0207667_10526596
467 Ga0207712_10301961
468 Ga0207640_10979057
469 Ga0207658_10127271
470 Ga0207703_10009243
471 Ga0207702_10086614
472 Ga0207702_10182521
473 Ga0207702_10651390
474 Ga0207641_10001717
475 Ga0207641_10123308
476 Ga0207648_10913724
477 Ga0207648_12145213
478 Ga0209179_1076595
479 Ga0209588_1001584
480 Ga0209588_1001716
481 Ga0209588_1004870
482 Ga0209588_1010696
483 Ga0209588_1011853
484 Ga0209588_1086278
485 Ga0209588_1159641
486 Ga0265354_1000080
487 Ga0265354_1001934
488 Ga0268266_10001361
489 Ga0268264_10015634
490 Ga0268264_10704766
491 Ga0265319_1051143
492 Ga0265318_10268634
493 Ga0265765_1007038
494 Ga0265760_10020147
495 Ga0265760_10051141
496 Ga0265325_10415044
497 Ga0265340_10138180
498 Ga0265340_10277242
499 Ga0316212_1003232
500 Ga0316212_1003351
501 Ga0373940_0257272
502 Ga0373932_0388327
503 Ga0373954_0073427
504 Ga0373956_0167966
505 Ga0373946_0094428
506 Ga0373955_0709889
507 Ga0373931_0715530
508 Ga0373931_0870831
509 Ga0373935_0372928
510 Ga0373927_0139094
511 Ga0373925_0016296
512 Ga0451839_0119937
513 Ga0451847_0324558
514 Ga0495603_0207046
515 Ga0495580_0096779
516 Ga0495580_0187457
517 Ga0495582_0002105
518 Ga0495628_0600153
519 Ga0495630_0041853
520 Ga0495587_0006250
521 Ga0495658_0136642
522 Ga0495604_0255161
523 Ga0495676_0890756
524 Ga0495614_0369534
525 Ga0495614_0369573
526 Ga0496102_0005385
527 Ga0496103_0035202
528 Ga0496104_0340739
529 Ga0496106_0017697
530 Ga0496107_0039468
531 Ga0496111_0316566
532 Ga0496112_0061261
533 Ga0496114_0003660
534 Ga0496114_0975433
535 Ga0496115_0007604
536 Ga0496115_0108153
537 nmdc:mga0n895_27778_c1
538 nmdc:mga0n895_56059_c1
539 nmdc:mga0n895_67611_c1
540 nmdc:mga0rr50_100158_c1
541 nmdc:mga0rr50_165610_c1
542 nmdc:mga0rr50_553204_c1
543 nmdc:mga0rr50_62997_c1
544 nmdc:mga0rr50_66249_c1
545 nmdc:mga08x19_103547_c1
546 nmdc:mga08x19_135656_c1
547 nmdc:mga08x19_1359_c1
548 nmdc:mga08x19_267654_c1
549 nmdc:mga08x19_386190_c1
550 nmdc:mga08x19_448761_c1
551 nmdc:mga08x19_8109_c1
552 nmdc:mga0a205_230928_c1
553 nmdc:mga0a205_360917_c1
554 Ga0495612_0139538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

77

167

0.84

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

45

165

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.9086 50 137
7ypu-assembly2.cif.gz_C orfe-coa-glycylthricin complex 0.8681 49 150
2vbq-assembly1.cif.gz_A structure of aac(6')-iy in complex with bisubstrate analog coa-s- monomethyl-acetylneamine. 0.8677 7 142
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8674 51 150
3fyn-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3 0.8656 10 142
ID Description Score Start End Superfamily
af_P16691_3_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8781 7 142 3.40.630.30
af_Q6H820_22_180_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8767 50 132 3.40.630.30
af_O64737_28_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8752 46 142 3.40.630.30
3fynA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8742 10 142 3.40.630.30
af_Q06592_5_156_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8656 3 142 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2N2P8K9-F1-model_v4 GNAT family N-acetyltransferase 0.972 6 142 GO:0016747
AF-A0A3M1DEI6-F1-model_v4 GNAT family N-acetyltransferase 0.9692 7 120 GO:0016747
AF-A0A1C6LZB1-F1-model_v4 N-acetylglutamate synthase and related acetyltransferases 0.9686 7 142 GO:0016747
AF-A0A1F8QE31-F1-model_v4 N-acetyltransferase domain-containing protein 0.9685 9 142 GO:0016747
AF-A0A4V1T197-F1-model_v4 GNAT family N-acetyltransferase 0.968 7 142 GO:0008080

Map