F381760

General Info

Members Datasets Scaffolds Average Seq Length
277 172 554 138

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10170694|Ga0105242_101706941
Length 152
Sequence VAITIDPTREEITAMKMHTYVNFAGQCAEAFHYYEQHLGGKIGMMMTHGQAPDQSKVTAEMKDAVLHARISVGETELLGADIPSAQPMRSAYLSLGVDSDAEAERIFAALSQGGEVFMAMQETFFASRFAQLRDRFGINWMIIHQRPMNAPA

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 4.33
Rhizosphere 94.95
Stem 0
Stem Tuber 0
Unclassified 39.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10170694 3300009176 Unclassified 1911
2 Ga0065707_10391935 3300005295 Bacteria 863
3 Ga0065707_10759654 3300005295 Unclassified 615
4 Ga0070658_10075299 3300005327 Bacteria 2768
5 Ga0070658_10396512 3300005327 Unclassified 1185
6 Ga0070658_10825854 3300005327 Unclassified 805
7 Ga0070676_10047316 3300005328 Bacteria 2512
8 Ga0070683_100082570 3300005329 Bacteria 3009
9 Ga0070683_100249500 3300005329 Bacteria 1688
10 Ga0070683_100421708 3300005329 Unclassified 1273
11 Ga0070670_100265560 3300005331 Unclassified 1497
12 Ga0068869_100870495 3300005334 Bacteria 778
13 Ga0070666_10081375 3300005335 Bacteria 2214
14 Ga0070666_10892324 3300005335 Bacteria 657
15 Ga0070680_100562193 3300005336 Bacteria 978
16 Ga0070682_100086725 3300005337 Bacteria 2039
17 Ga0070660_100110053 3300005339 Bacteria 2191
18 Ga0070660_100598660 3300005339 Bacteria 922
19 Ga0070660_100640590 3300005339 Bacteria 890
20 Ga0070661_100092991 3300005344 Bacteria 2235
21 Ga0070675_100740087 3300005354 Bacteria 897
22 Ga0070671_101300939 3300005355 Bacteria 641
23 Ga0070671_101840822 3300005355 Unclassified 538
24 Ga0070673_101982121 3300005364 Bacteria 553
25 Ga0070688_100875140 3300005365 Unclassified 707
26 Ga0070659_100022953 3300005366 Bacteria 4769
27 Ga0070705_100371904 3300005440 Bacteria 1049
28 Ga0070705_100744840 3300005440 Bacteria 774
29 Ga0070708_100036445 3300005445 Unclassified 4290
30 Ga0070708_101022092 3300005445 Bacteria 775
31 Ga0070708_101790175 3300005445 Unclassified 570
32 Ga0070663_100470267 3300005455 Unclassified 1039
33 Ga0070678_100684969 3300005456 Unclassified 922
34 Ga0070678_101263613 3300005456 Unclassified 686
35 Ga0070662_100484301 3300005457 Bacteria 1030
36 Ga0070662_100827788 3300005457 Bacteria 788
37 Ga0070662_101166119 3300005457 Unclassified 662
38 Ga0070681_10020105 3300005458 Bacteria 6691
39 Ga0070681_10128063 3300005458 Bacteria 2471
40 Ga0070681_11253458 3300005458 Unclassified 664
41 Ga0068867_100123756 3300005459 Bacteria 2002
42 Ga0070707_100046098 3300005468 Bacteria 4171
43 Ga0070707_100377609 3300005468 Bacteria 1377
44 Ga0070698_100003338 3300005471 Bacteria 17666
45 Ga0070698_100018345 3300005471 Bacteria 7368
46 Ga0070699_100548625 3300005518 Unclassified 1052
47 Ga0070679_100650072 3300005530 Unclassified 997
48 Ga0070679_100752825 3300005530 Bacteria 917
49 Ga0070679_100860307 3300005530 Unclassified 850
50 Ga0070684_100090817 3300005535 Bacteria 2716
51 Ga0070684_100192656 3300005535 Unclassified 1855
52 Ga0070684_100626320 3300005535 Bacteria 1001
53 Ga0070697_100010916 3300005536 Bacteria 7095
54 Ga0070697_101985100 3300005536 Unclassified 521
55 Ga0068853_101317963 3300005539 Unclassified 698
56 Ga0070672_100068298 3300005543 Bacteria 2819
57 Ga0070696_100004219 3300005546 Bacteria 9574
58 Ga0070696_100095896 3300005546 Bacteria 2119
59 Ga0070665_100425802 3300005548 Bacteria 1336
60 Ga0070665_100450615 3300005548 Bacteria 1296
61 Ga0070704_100025026 3300005549 Unclassified 3925
62 Ga0068855_101587000 3300005563 Bacteria 670
63 Ga0070664_100022922 3300005564 Bacteria 5151
64 Ga0070664_100438333 3300005564 Unclassified 1198
65 Ga0068857_100881003 3300005577 Bacteria 858
66 Ga0068854_101354020 3300005578 Bacteria 642
67 Ga0068856_100009707 3300005614 Bacteria 9347
68 Ga0068856_100703935 3300005614 Bacteria 1030
69 Ga0068856_101223225 3300005614 Bacteria 767
70 Ga0068852_100209368 3300005616 Bacteria 1849
71 Ga0068852_100840063 3300005616 Bacteria 934
72 Ga0068852_101069234 3300005616 Unclassified 827
73 Ga0068859_100914033 3300005617 Unclassified 962
74 Ga0068859_101103221 3300005617 Bacteria 873
75 Ga0068864_100494528 3300005618 Unclassified 1176
76 Ga0068864_100504670 3300005618 Bacteria 1164
77 Ga0068851_10275334 3300005834 Unclassified 961
78 Ga0068863_100027467 3300005841 Bacteria 5428
79 Ga0068863_100148472 3300005841 Bacteria 2243
80 Ga0068863_100852830 3300005841 Unclassified 910
81 Ga0068863_101989072 3300005841 Unclassified 591
82 Ga0068858_100879414 3300005842 Unclassified 876
83 Ga0068858_102025869 3300005842 Unclassified 569
84 Ga0068860_100550350 3300005843 Unclassified 1156
85 Ga0068860_100785297 3300005843 Unclassified 965
86 Ga0068860_102537818 3300005843 Unclassified 532
87 Ga0081455_10009332 3300005937 Bacteria 10099
88 Ga0070717_10548409 3300006028 Bacteria 1047
89 Ga0097621_100349218 3300006237 Unclassified 1315
90 Ga0097621_100511073 3300006237 Bacteria 1089
91 Ga0068871_100130841 3300006358 Bacteria 2128
92 Ga0068871_100338905 3300006358 Unclassified 1327
93 Ga0068871_100410626 3300006358 Bacteria 1207
94 Ga0068871_100929977 3300006358 Unclassified 807
95 Ga0068871_101637632 3300006358 Unclassified 610
96 Ga0097620_100913810 3300006931 Unclassified 962
97 Ga0097620_101103290 3300006931 Bacteria 873
98 Ga0105245_10150943 3300009098 Bacteria 2197
99 Ga0105245_10913830 3300009098 Bacteria 920
100 Ga0114129_11709425 3300009147 Bacteria 767
101 Ga0105243_10313278 3300009148 Unclassified 1427
102 Ga0105242_10656611 3300009176 Unclassified 1021
103 Ga0105248_10034170 3300009177 Bacteria 5684
104 Ga0105248_10102329 3300009177 Bacteria 3229
105 Ga0105248_10140225 3300009177 Unclassified 2727
106 Ga0105248_12554288 3300009177 Unclassified 582
107 Ga0105237_10267074 3300009545 Bacteria 1714
108 Ga0105239_11670477 3300010375 Bacteria 737
109 Ga0105246_10555295 3300011119 Bacteria 985
110 Ga0105246_12132175 3300011119 Unclassified 544
111 Ga0157373_10075257 3300013100 Bacteria 2382
112 Ga0157373_10245229 3300013100 Bacteria 1267
113 Ga0157371_11210860 3300013102 Unclassified 582
114 Ga0157370_10802813 3300013104 Unclassified 856
115 Ga0157370_11969077 3300013104 Bacteria 524
116 Ga0157369_10072415 3300013105 Bacteria 3699
117 Ga0157369_10601549 3300013105 Bacteria 1135
118 Ga0157374_10027726 3300013296 Bacteria 5113
119 Ga0157374_10044974 3300013296 Bacteria 4084
120 Ga0157374_10506482 3300013296 Bacteria 1212
121 Ga0157378_10594214 3300013297 Bacteria 1117
122 Ga0157378_10894298 3300013297 Viruses 918
123 Ga0163162_11492006 3300013306 Unclassified 770
124 Ga0157372_10048121 3300013307 Bacteria 4739
125 Ga0157372_10303842 3300013307 Bacteria 1856
126 Ga0157372_11071088 3300013307 Bacteria 933
127 Ga0157372_12348876 3300013307 Unclassified 612
128 Ga0157375_10016529 3300013308 Bacteria 6633
129 Ga0157375_10527443 3300013308 Unclassified 1344
130 Ga0157375_11827117 3300013308 Bacteria 721
131 Ga0163163_10022616 3300014325 Bacteria 5958
132 Ga0163163_10227399 3300014325 Unclassified 1914
133 Ga0163163_10977101 3300014325 Bacteria 910
134 Ga0157377_11049741 3300014745 Unclassified 621
135 Ga0157379_10472285 3300014968 Bacteria 1160
136 Ga0157379_10579808 3300014968 Bacteria 1045
137 Ga0157376_10020234 3300014969 Bacteria 5144
138 Ga0157376_10659447 3300014969 Unclassified 1048
139 Ga0157376_10878884 3300014969 Unclassified 913
140 Ga0163161_10275081 3300017792 Bacteria 1319
141 Ga0207656_10253298 3300025321 Unclassified 863
142 Ga0207688_10881211 3300025901 Unclassified 567
143 Ga0207647_10473386 3300025904 Unclassified 700
144 Ga0207645_10010587 3300025907 Bacteria 6328
145 Ga0207645_10055357 3300025907 Bacteria 2532
146 Ga0207705_10117092 3300025909 Unclassified 1973
147 Ga0207707_10007173 3300025912 Bacteria 9702
148 Ga0207707_10093062 3300025912 Bacteria 2633
149 Ga0207707_10452330 3300025912 Unclassified 1099
150 Ga0207671_10227249 3300025914 Bacteria 1463
151 Ga0207660_10370775 3300025917 Bacteria 1150
152 Ga0207657_10589916 3300025919 Bacteria 867
153 Ga0207649_10214839 3300025920 Bacteria 1366
154 Ga0207652_10666137 3300025921 Unclassified 930
155 Ga0207646_10033775 3300025922 Bacteria 4625
156 Ga0207681_11382417 3300025923 Unclassified 591
157 Ga0207650_10797075 3300025925 Unclassified 801
158 Ga0207659_10263776 3300025926 Unclassified 1402
159 Ga0207687_10610321 3300025927 Bacteria 920
160 Ga0207664_10558481 3300025929 Bacteria 1027
161 Ga0207644_10061868 3300025931 Bacteria 2713
162 Ga0207644_11015984 3300025931 Bacteria 696
163 Ga0207690_10029159 3300025932 Bacteria 3506
164 Ga0207690_10229079 3300025932 Unclassified 1425
165 Ga0207706_10605210 3300025933 Bacteria 941
166 Ga0207686_10989932 3300025934 Unclassified 682
167 Ga0207686_11595955 3300025934 Unclassified 539
168 Ga0207670_10313421 3300025936 Bacteria 1232
169 Ga0207665_11010951 3300025939 Unclassified 661
170 Ga0207691_10040009 3300025940 Unclassified 4335
171 Ga0207711_10120562 3300025941 Unclassified 2341
172 Ga0207711_10152228 3300025941 Unclassified 2088
173 Ga0207711_10632640 3300025941 Unclassified 998
174 Ga0207711_11830053 3300025941 Unclassified 550
175 Ga0207661_10029118 3300025944 Unclassified 4238
176 Ga0207661_10410158 3300025944 Bacteria 1229
177 Ga0207679_10024449 3300025945 Bacteria 4142
178 Ga0207679_10510016 3300025945 Unclassified 1074
179 Ga0207679_10754732 3300025945 Unclassified 885
180 Ga0207679_11667276 3300025945 Unclassified 584
181 Ga0207667_10075111 3300025949 Bacteria 3510
182 Ga0207667_10232002 3300025949 Unclassified 1890
183 Ga0207667_10741234 3300025949 Bacteria 982
184 Ga0207651_10905194 3300025960 Bacteria 786
185 Ga0207651_10914674 3300025960 Unclassified 782
186 Ga0207640_10143860 3300025981 Bacteria 1742
187 Ga0207703_10114134 3300026035 Bacteria 2310
188 Ga0207702_10006715 3300026078 Bacteria 9888
189 Ga0207702_11006392 3300026078 Bacteria 827
190 Ga0207641_10083965 3300026088 Bacteria 2771
191 Ga0207641_10397331 3300026088 Bacteria 1323
192 Ga0207641_10460074 3300026088 Bacteria 1231
193 Ga0207641_10852285 3300026088 Bacteria 903
194 Ga0207648_10686513 3300026089 Unclassified 948
195 Ga0207676_10403651 3300026095 Bacteria 1278
196 Ga0207676_12031140 3300026095 Unclassified 573
197 Ga0207683_10649621 3300026121 Unclassified 977
198 Ga0207683_11255936 3300026121 Unclassified 686
199 Ga0207698_10503256 3300026142 Bacteria 1179
200 Ga0207698_10593459 3300026142 Unclassified 1091
201 Ga0268266_10291377 3300028379 Bacteria 1520
202 Ga0268264_10482601 3300028381 Unclassified 1206
203 Ga0268264_11552531 3300028381 Unclassified 673
204 Ga0265324_10024259 3300029957 Bacteria 2155
205 Ga0265332_10018219 3300031238 Bacteria 3097
206 Ga0265328_10032658 3300031239 Bacteria 1931
207 Ga0265320_10003583 3300031240 Bacteria 10381
208 Ga0265325_10077968 3300031241 Bacteria 1651
209 Ga0265329_10023188 3300031242 Bacteria 2069
210 Ga0265340_10014466 3300031247 Bacteria 4119
211 Ga0265331_10276735 3300031250 Bacteria 752
212 Ga0265316_10022423 3300031344 Bacteria 5323
213 Ga0265316_10046248 3300031344 Bacteria 3449
214 Ga0265316_10610171 3300031344 Unclassified 773
215 Ga0265314_10280766 3300031711 Bacteria 942
216 Ga0265342_10081433 3300031712 Bacteria 1869
217 Ga0307410_10410451 3300031852 Unclassified 1096
218 Ga0307409_100111943 3300031995 Unclassified 2291
219 Ga0373953_0201387 3300035117 Bacteria 861
220 Ga0373954_0593783 3300035118 Unclassified 549
221 Ga0373935_0256179 3300035692 Bacteria 1226
222 Ga0373937_0484571 3300036401 Bacteria 1175
223 Ga0395905_0176013 3300037471 Bacteria 2009
224 Ga0436365_0096325 3300039437 Bacteria 2038
225 Ga0453684_2144640 3300044712 Unclassified 559
226 Ga0451576_1776150 3300045051 Unclassified 638
227 Ga0466967_0050674 3300045976 Unclassified 3636
228 Ga0495629_0096545 3300046459 Bacteria 2062
229 Ga0495653_0353825 3300046463 Unclassified 944
230 Ga0495580_0111464 3300046472 Bacteria 1900
231 Ga0495580_0377558 3300046472 Bacteria 958
232 Ga0495580_0665258 3300046472 Unclassified 684
233 Ga0495662_0294987 3300046476 Unclassified 798
234 Ga0495664_0196469 3300046477 Unclassified 1223
235 Ga0495630_0724462 3300046517 Unclassified 761
236 Ga0495666_0120501 3300046526 Bacteria 1229
237 Ga0495665_0581429 3300046531 Unclassified 561
238 Ga0495645_0326810 3300046543 Bacteria 994
239 Ga0495635_0437102 3300046663 Bacteria 866
240 Ga0495659_0067263 3300046664 Bacteria 1336
241 Ga0495599_0102654 3300046678 Bacteria 1782
242 Ga0495599_0443375 3300046678 Unclassified 769
243 Ga0495604_0606570 3300047317 Unclassified 701
244 Ga0495674_0001641 3300047319 Bacteria 21990
245 Ga0495674_0230622 3300047319 Bacteria 1528
246 Ga0495676_0793993 3300047321 Unclassified 610
247 Ga0495675_0154814 3300047444 Bacteria 1414
248 Ga0495684_0007410 3300047471 Bacteria 8504
249 Ga0495602_0561188 3300048088 Bacteria 790
250 Ga0495614_0082751 3300048089 Bacteria 1392
251 Ga0496104_0114530 3300048907 Bacteria 2586
252 Ga0496106_0015684 3300048909 Bacteria 5605
253 Ga0496108_0115403 3300048911 Bacteria 2300
254 Ga0496108_1623527 3300048911 Unclassified 534
255 Ga0496109_0235920 3300048912 Bacteria 1721
256 Ga0496109_0803199 3300048912 Bacteria 879
257 Ga0496112_0026516 3300048915 Bacteria 5577
258 Ga0496112_0145090 3300048915 Unclassified 2342
259 Ga0496112_0505759 3300048915 Bacteria 1143
260 Ga0496113_0316649 3300048916 Unclassified 1250
261 Ga0496113_0916959 3300048916 Bacteria 692
262 Ga0496114_0035897 3300048917 Bacteria 4096
263 Ga0501298_123253 3300049521 Unclassified 612
264 Ga0501032_0396350 3300049569 Unclassified 887
265 Ga0501034_0064047 3300049571 Bacteria 3690
266 Ga0501038_0113624 3300049574 Bacteria 2241
267 Ga0501038_0975138 3300049574 Unclassified 623
268 Ga0501047_0009969 3300049581 Bacteria 8981
269 Ga0501047_0085898 3300049581 Bacteria 3023
270 Ga0501070_0034912 3300049586 Bacteria 4203
271 Ga0501079_0409102 3300049741 Unclassified 1064
272 Ga0501044_0088326 3300049823 Bacteria 3129
273 Ga0501044_0101831 3300049823 Unclassified 2889
274 nmdc:mga05p37_255293_c1 3300050507 Bacteria 2101
275 Ga0495595_0372320 3300053084 Unclassified 722
276 Ga0500556_0025587 3300053104 Bacteria 1952
277 Ga0530510_0097926 3300061734 Bacteria 2145
278 Ga0105242_10170694
279 Ga0065707_10391935
280 Ga0065707_10759654
281 Ga0070658_10075299
282 Ga0070658_10396512
283 Ga0070658_10825854
284 Ga0070676_10047316
285 Ga0070683_100082570
286 Ga0070683_100249500
287 Ga0070683_100421708
288 Ga0070670_100265560
289 Ga0068869_100870495
290 Ga0070666_10081375
291 Ga0070666_10892324
292 Ga0070680_100562193
293 Ga0070682_100086725
294 Ga0070660_100110053
295 Ga0070660_100598660
296 Ga0070660_100640590
297 Ga0070661_100092991
298 Ga0070675_100740087
299 Ga0070671_101300939
300 Ga0070671_101840822
301 Ga0070673_101982121
302 Ga0070688_100875140
303 Ga0070659_100022953
304 Ga0070705_100371904
305 Ga0070705_100744840
306 Ga0070708_100036445
307 Ga0070708_101022092
308 Ga0070708_101790175
309 Ga0070663_100470267
310 Ga0070678_100684969
311 Ga0070678_101263613
312 Ga0070662_100484301
313 Ga0070662_100827788
314 Ga0070662_101166119
315 Ga0070681_10020105
316 Ga0070681_10128063
317 Ga0070681_11253458
318 Ga0068867_100123756
319 Ga0070707_100046098
320 Ga0070707_100377609
321 Ga0070698_100003338
322 Ga0070698_100018345
323 Ga0070699_100548625
324 Ga0070679_100650072
325 Ga0070679_100752825
326 Ga0070679_100860307
327 Ga0070684_100090817
328 Ga0070684_100192656
329 Ga0070684_100626320
330 Ga0070697_100010916
331 Ga0070697_101985100
332 Ga0068853_101317963
333 Ga0070672_100068298
334 Ga0070696_100004219
335 Ga0070696_100095896
336 Ga0070665_100425802
337 Ga0070665_100450615
338 Ga0070704_100025026
339 Ga0068855_101587000
340 Ga0070664_100022922
341 Ga0070664_100438333
342 Ga0068857_100881003
343 Ga0068854_101354020
344 Ga0068856_100009707
345 Ga0068856_100703935
346 Ga0068856_101223225
347 Ga0068852_100209368
348 Ga0068852_100840063
349 Ga0068852_101069234
350 Ga0068859_100914033
351 Ga0068859_101103221
352 Ga0068864_100494528
353 Ga0068864_100504670
354 Ga0068851_10275334
355 Ga0068863_100027467
356 Ga0068863_100148472
357 Ga0068863_100852830
358 Ga0068863_101989072
359 Ga0068858_100879414
360 Ga0068858_102025869
361 Ga0068860_100550350
362 Ga0068860_100785297
363 Ga0068860_102537818
364 Ga0081455_10009332
365 Ga0070717_10548409
366 Ga0097621_100349218
367 Ga0097621_100511073
368 Ga0068871_100130841
369 Ga0068871_100338905
370 Ga0068871_100410626
371 Ga0068871_100929977
372 Ga0068871_101637632
373 Ga0097620_100913810
374 Ga0097620_101103290
375 Ga0105245_10150943
376 Ga0105245_10913830
377 Ga0114129_11709425
378 Ga0105243_10313278
379 Ga0105242_10656611
380 Ga0105248_10034170
381 Ga0105248_10102329
382 Ga0105248_10140225
383 Ga0105248_12554288
384 Ga0105237_10267074
385 Ga0105239_11670477
386 Ga0105246_10555295
387 Ga0105246_12132175
388 Ga0157373_10075257
389 Ga0157373_10245229
390 Ga0157371_11210860
391 Ga0157370_10802813
392 Ga0157370_11969077
393 Ga0157369_10072415
394 Ga0157369_10601549
395 Ga0157374_10027726
396 Ga0157374_10044974
397 Ga0157374_10506482
398 Ga0157378_10594214
399 Ga0157378_10894298
400 Ga0163162_11492006
401 Ga0157372_10048121
402 Ga0157372_10303842
403 Ga0157372_11071088
404 Ga0157372_12348876
405 Ga0157375_10016529
406 Ga0157375_10527443
407 Ga0157375_11827117
408 Ga0163163_10022616
409 Ga0163163_10227399
410 Ga0163163_10977101
411 Ga0157377_11049741
412 Ga0157379_10472285
413 Ga0157379_10579808
414 Ga0157376_10020234
415 Ga0157376_10659447
416 Ga0157376_10878884
417 Ga0163161_10275081
418 Ga0207656_10253298
419 Ga0207688_10881211
420 Ga0207647_10473386
421 Ga0207645_10010587
422 Ga0207645_10055357
423 Ga0207705_10117092
424 Ga0207707_10007173
425 Ga0207707_10093062
426 Ga0207707_10452330
427 Ga0207671_10227249
428 Ga0207660_10370775
429 Ga0207657_10589916
430 Ga0207649_10214839
431 Ga0207652_10666137
432 Ga0207646_10033775
433 Ga0207681_11382417
434 Ga0207650_10797075
435 Ga0207659_10263776
436 Ga0207687_10610321
437 Ga0207664_10558481
438 Ga0207644_10061868
439 Ga0207644_11015984
440 Ga0207690_10029159
441 Ga0207690_10229079
442 Ga0207706_10605210
443 Ga0207686_10989932
444 Ga0207686_11595955
445 Ga0207670_10313421
446 Ga0207665_11010951
447 Ga0207691_10040009
448 Ga0207711_10120562
449 Ga0207711_10152228
450 Ga0207711_10632640
451 Ga0207711_11830053
452 Ga0207661_10029118
453 Ga0207661_10410158
454 Ga0207679_10024449
455 Ga0207679_10510016
456 Ga0207679_10754732
457 Ga0207679_11667276
458 Ga0207667_10075111
459 Ga0207667_10232002
460 Ga0207667_10741234
461 Ga0207651_10905194
462 Ga0207651_10914674
463 Ga0207640_10143860
464 Ga0207703_10114134
465 Ga0207702_10006715
466 Ga0207702_11006392
467 Ga0207641_10083965
468 Ga0207641_10397331
469 Ga0207641_10460074
470 Ga0207641_10852285
471 Ga0207648_10686513
472 Ga0207676_10403651
473 Ga0207676_12031140
474 Ga0207683_10649621
475 Ga0207683_11255936
476 Ga0207698_10503256
477 Ga0207698_10593459
478 Ga0268266_10291377
479 Ga0268264_10482601
480 Ga0268264_11552531
481 Ga0265324_10024259
482 Ga0265332_10018219
483 Ga0265328_10032658
484 Ga0265320_10003583
485 Ga0265325_10077968
486 Ga0265329_10023188
487 Ga0265340_10014466
488 Ga0265331_10276735
489 Ga0265316_10022423
490 Ga0265316_10046248
491 Ga0265316_10610171
492 Ga0265314_10280766
493 Ga0265342_10081433
494 Ga0307410_10410451
495 Ga0307409_100111943
496 Ga0373953_0201387
497 Ga0373954_0593783
498 Ga0373935_0256179
499 Ga0373937_0484571
500 Ga0395905_0176013
501 Ga0436365_0096325
502 Ga0453684_2144640
503 Ga0451576_1776150
504 Ga0466967_0050674
505 Ga0495629_0096545
506 Ga0495653_0353825
507 Ga0495580_0111464
508 Ga0495580_0377558
509 Ga0495580_0665258
510 Ga0495662_0294987
511 Ga0495664_0196469
512 Ga0495630_0724462
513 Ga0495666_0120501
514 Ga0495665_0581429
515 Ga0495645_0326810
516 Ga0495635_0437102
517 Ga0495659_0067263
518 Ga0495599_0102654
519 Ga0495599_0443375
520 Ga0495604_0606570
521 Ga0495674_0001641
522 Ga0495674_0230622
523 Ga0495676_0793993
524 Ga0495675_0154814
525 Ga0495684_0007410
526 Ga0495602_0561188
527 Ga0495614_0082751
528 Ga0496104_0114530
529 Ga0496106_0015684
530 Ga0496108_0115403
531 Ga0496108_1623527
532 Ga0496109_0235920
533 Ga0496109_0803199
534 Ga0496112_0026516
535 Ga0496112_0145090
536 Ga0496112_0505759
537 Ga0496113_0316649
538 Ga0496113_0916959
539 Ga0496114_0035897
540 Ga0501298_123253
541 Ga0501032_0396350
542 Ga0501034_0064047
543 Ga0501038_0113624
544 Ga0501038_0975138
545 Ga0501047_0009969
546 Ga0501047_0085898
547 Ga0501070_0034912
548 Ga0501079_0409102
549 Ga0501044_0088326
550 Ga0501044_0101831
551 nmdc:mga05p37_255293_c1
552 Ga0495595_0372320
553 Ga0500556_0025587
554 Ga0530510_0097926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

16

142

0.89

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

15

143

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.8982 1 134
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8968 1 135
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8842 1 135
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.8791 1 134
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8719 1 132
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.939 78 132 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9052 73 132 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.886 7 135 3.10.180.10
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8791 7 135 3.10.180.10
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8768 7 137 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7X0E8Y7-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.9752 79 137
AF-A0A2V7ZPD4-F1-model_v4 VOC family protein 0.9731 1 67
AF-A0A537JRP0-F1-model_v4 VOC family protein 0.9664 1 108
AF-A0A519TSY8-F1-model_v4 PhnB-like domain-containing protein 0.9635 76 134
AF-A0A2V8ESD5-F1-model_v4 VOC family protein 0.9634 30 137

Map