F381697

General Info

Members Datasets Scaffolds Average Seq Length
277 166 554 225

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10002306|Ga0081539_1000230611
Length 238
Sequence MSLGKELGRETNVRFGILGTGVVGKTIAARLAGLGHDVMVGTRDPEETAARTEPDAFGGSPFSVWIEEHPEVQLATFGEAAAHGETVVNATPGSVSLEVLDLAGEDNLSGKILMDISNPLDFSQGMPPTLSVSNTDSLGEQIQRRFPDAKVVKTLHTMNSYLMVDPTQLAGAEHTVFVCGNDPESKAKVTELLQSFGWGDIIDLGDITTARGTEMLLPIWLRLFGALQKPIFNFKIVR

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
49 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
50 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
51 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
52 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
53 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
54 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
55 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
56 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
57 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
58 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
59 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
60 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
61 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
64 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
65 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
66 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
67 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
68 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
69 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
70 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
71 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
72 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
73 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
74 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
75 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
93 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
94 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
144 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
161 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
162 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
163 2643221711 Terrabacter sp. Root85 Isolate Unclassified
164 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
165 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
166 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 0
Isolates 2.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 5.78
Rhizosphere 90.25
Stem 0
Stem Tuber 0
Unclassified 5.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10002306 3300005985 Bacteria 27511
2 JGI25406J46586_10006818 3300003203 Bacteria 5245
3 rootH1_10047279 3300003316 Bacteria 2285
4 Ga0070670_100959752 3300005331 Bacteria 776
5 Ga0070677_10017517 3300005333 Bacteria 2566
6 Ga0070682_100232666 3300005337 Bacteria 1318
7 Ga0070668_100380142 3300005347 Bacteria 1201
8 Ga0070667_100112514 3300005367 Bacteria 2361
9 Ga0070667_100406384 3300005367 Bacteria 1240
10 Ga0070708_100056864 3300005445 Bacteria 3481
11 Ga0070678_100062256 3300005456 Bacteria 2755
12 Ga0070707_100005138 3300005468 Bacteria 12258
13 Ga0070707_100592878 3300005468 Bacteria 1070
14 Ga0070696_100499342 3300005546 Bacteria 968
15 Ga0070665_100057492 3300005548 Bacteria 3899
16 Ga0068855_100981496 3300005563 Bacteria 888
17 Ga0068856_100250140 3300005614 Bacteria 1787
18 Ga0068863_100148311 3300005841 Bacteria 2244
19 Ga0068858_100591753 3300005842 Bacteria 1076
20 Ga0081538_10002021 3300005981 Bacteria 20288
21 Ga0097621_100128426 3300006237 Bacteria 2155
22 Ga0075433_10138525 3300006852 Unclassified 2163
23 Ga0075434_100020947 3300006871 Bacteria 6350
24 Ga0068865_100230644 3300006881 Bacteria 1452
25 Ga0075436_100163758 3300006914 Unclassified 1568
26 Ga0075435_100188710 3300007076 Bacteria 1744
27 Ga0105251_10005393 3300009011 Bacteria 8373
28 Ga0105244_10025718 3300009036 Bacteria 3195
29 Ga0105244_10086345 3300009036 Bacteria 1547
30 Ga0105245_10000316 3300009098 Bacteria 45965
31 Ga0105245_10130229 3300009098 Bacteria 2359
32 Ga0105242_10361262 3300009176 Bacteria 1344
33 Ga0105248_10042289 3300009177 Bacteria 5110
34 Ga0157369_10165366 3300013105 Bacteria 2334
35 Ga0157375_10051020 3300013308 Bacteria 4061
36 Ga0157376_10128773 3300014969 Bacteria 2256
37 Ga0163161_10000140 3300017792 Bacteria 66684
38 Ga0209050_1014736 3300025298 Bacteria 3341
39 Ga0207680_10049935 3300025903 Bacteria 2493
40 Ga0207646_10001242 3300025922 Bacteria 31935
41 Ga0207687_10006470 3300025927 Bacteria 7737
42 Ga0207687_10435332 3300025927 Bacteria 1085
43 Ga0207664_10000009 3300025929 Bacteria 299246
44 Ga0207711_10074982 3300025941 Bacteria 2943
45 Ga0207667_10832325 3300025949 Bacteria 918
46 Ga0207677_10561939 3300026023 Bacteria 996
47 Ga0207702_10306110 3300026078 Bacteria 1509
48 Ga0207683_10129197 3300026121 Bacteria 2272
49 Ga0265316_10248029 3300031344 Bacteria 1308
50 Ga0307410_10230458 3300031852 Unclassified 1430
51 Ga0307407_10104705 3300031903 Bacteria 1764
52 Ga0307409_100390579 3300031995 Bacteria 1326
53 Ga0307409_100613579 3300031995 Unclassified 1077
54 Ga0307414_10498667 3300032004 Unclassified 1077
55 Ga0439466_0047947 3300041411 Bacteria 1407
56 Ga0451839_1596570 3300041496 Bacteria 699
57 Ga0439448_0001146 3300042005 Bacteria 6707
58 Ga0439449_0004464 3300042007 Bacteria 5400
59 Ga0439450_000110 3300042008 Bacteria 8428
60 Ga0439454_001552 3300042011 Unclassified 2238
61 Ga0439455_0000581 3300042012 Bacteria 5253
62 Ga0439457_041566 3300042014 Bacteria 1024
63 Ga0439463_000534 3300042016 Bacteria 10658
64 Ga0439463_060183 3300042016 Bacteria 971
65 Ga0439444_0001839 3300042437 Unclassified 2814
66 Ga0439464_0001108 3300042439 Bacteria 6208
67 Ga0439460_0000213 3300042461 Bacteria 11536
68 Ga0450916_001342 3300042530 Bacteria 2437
69 Ga0451577_0001655 3300042876 Bacteria 28814
70 Ga0439440_0000257 3300042993 Bacteria 8592
71 Ga0495592_0272465 3300046454 Bacteria 1110
72 Ga0495603_0038027 3300046455 Bacteria 2887
73 Ga0495603_0308048 3300046455 Bacteria 910
74 Ga0495629_0012269 3300046459 Bacteria 6206
75 Ga0495629_0046068 3300046459 Bacteria 3059
76 Ga0495629_0213980 3300046459 Bacteria 1331
77 Ga0495629_0215303 3300046459 Bacteria 1326
78 Ga0495651_0001759 3300046462 Bacteria 16720
79 Ga0495651_0149481 3300046462 Bacteria 1685
80 Ga0495653_0001814 3300046463 Bacteria 16828
81 Ga0495653_0020067 3300046463 Bacteria 5416
82 Ga0495653_0086259 3300046463 Bacteria 2307
83 Ga0495653_0130616 3300046463 Bacteria 1779
84 Ga0495653_0141293 3300046463 Bacteria 1693
85 Ga0495653_0178206 3300046463 Bacteria 1461
86 Ga0495580_0023465 3300046472 Bacteria 4529
87 Ga0495582_0065871 3300046473 Bacteria 2001
88 Ga0495582_0077487 3300046473 Bacteria 1844
89 Ga0495582_0110672 3300046473 Bacteria 1543
90 Ga0495662_0000140 3300046476 Bacteria 27992
91 Ga0495662_0000570 3300046476 Bacteria 16973
92 Ga0495662_0043596 3300046476 Bacteria 2165
93 Ga0495662_0055973 3300046476 Bacteria 1905
94 Ga0495664_0015008 3300046477 Bacteria 4399
95 Ga0495664_0074151 3300046477 Bacteria 2035
96 Ga0495664_0274058 3300046477 Bacteria 1019
97 Ga0495594_0139454 3300046499 Bacteria 1375
98 Ga0495594_0168502 3300046499 Bacteria 1246
99 Ga0495608_0000976 3300046511 Bacteria 20198
100 Ga0495608_0002678 3300046511 Bacteria 12794
101 Ga0495608_0034723 3300046511 Bacteria 3404
102 Ga0495608_0232176 3300046511 Bacteria 1155
103 Ga0495618_0010116 3300046514 Bacteria 5703
104 Ga0495628_0019605 3300046516 Bacteria 5588
105 Ga0495628_0105233 3300046516 Bacteria 2174
106 Ga0495628_0146400 3300046516 Bacteria 1800
107 Ga0495630_0010298 3300046517 Bacteria 6747
108 Ga0495630_0037190 3300046517 Bacteria 3639
109 Ga0495630_0082460 3300046517 Bacteria 2427
110 Ga0495630_0112349 3300046517 Unclassified 2063
111 Ga0495630_0403274 3300046517 Bacteria 1048
112 Ga0495630_0552943 3300046517 Bacteria 882
113 Ga0495643_0220140 3300046522 Bacteria 901
114 Ga0495666_0000202 3300046526 Bacteria 25401
115 Ga0495652_0193288 3300046529 Bacteria 1551
116 Ga0495652_0378349 3300046529 Bacteria 1007
117 Ga0495665_0004579 3300046531 Bacteria 7464
118 Ga0495665_0028551 3300046531 Bacteria 2991
119 Ga0495665_0031315 3300046531 Bacteria 2847
120 Ga0495640_0009186 3300046533 Bacteria 7715
121 Ga0495640_0015693 3300046533 Bacteria 5690
122 Ga0495640_0021918 3300046533 Bacteria 4680
123 Ga0495640_0033345 3300046533 Unclassified 3658
124 Ga0495586_0003416 3300046535 Bacteria 8516
125 Ga0495586_0011440 3300046535 Bacteria 4718
126 Ga0495586_0057961 3300046535 Bacteria 2102
127 Ga0495587_0053565 3300046536 Bacteria 2378
128 Ga0495587_0127951 3300046536 Bacteria 1452
129 Ga0495645_0003098 3300046543 Bacteria 11264
130 Ga0495667_0010251 3300046559 Bacteria 6340
131 Ga0495667_0021616 3300046559 Bacteria 4341
132 Ga0495667_0036953 3300046559 Bacteria 3256
133 Ga0495634_0081381 3300046642 Bacteria 2117
134 Ga0495634_0185590 3300046642 Bacteria 1300
135 Ga0495634_0614523 3300046642 Bacteria 630
136 Ga0495635_0000006 3300046663 Bacteria 301820
137 Ga0495635_0011360 3300046663 Bacteria 6247
138 Ga0495635_0246597 3300046663 Bacteria 1204
139 Ga0495635_0419965 3300046663 Unclassified 887
140 Ga0495659_0019513 3300046664 Bacteria 2269
141 Ga0495588_0001848 3300046674 Bacteria 9027
142 Ga0495657_0015445 3300046675 Bacteria 5588
143 Ga0495657_0019270 3300046675 Bacteria 4924
144 Ga0495657_0342868 3300046675 Bacteria 885
145 Ga0495599_0188786 3300046678 Bacteria 1268
146 Ga0495599_0474074 3300046678 Bacteria 739
147 Ga0495623_0007879 3300046679 Bacteria 6929
148 Ga0495623_0045645 3300046679 Bacteria 2782
149 Ga0495646_0087306 3300046680 Bacteria 1808
150 Ga0495658_0215651 3300046683 Bacteria 1200
151 Ga0495613_0000092 3300046689 Bacteria 86976
152 Ga0495613_0003660 3300046689 Bacteria 11520
153 Ga0495613_0025106 3300046689 Bacteria 4441
154 Ga0495624_0008041 3300046690 Bacteria 7387
155 Ga0495624_0049727 3300046690 Bacteria 2658
156 Ga0495600_0029642 3300046809 Bacteria 3543
157 Ga0495600_0069513 3300046809 Bacteria 2301
158 Ga0495581_0000128 3300047315 Bacteria 32831
159 Ga0495581_0118594 3300047315 Bacteria 1539
160 Ga0495581_0142714 3300047315 Bacteria 1397
161 Ga0495581_0164357 3300047315 Bacteria 1298
162 Ga0495604_0004747 3300047317 Bacteria 10769
163 Ga0495604_0120618 3300047317 Bacteria 1899
164 Ga0495674_0006313 3300047319 Bacteria 11366
165 Ga0495674_0044899 3300047319 Bacteria 3926
166 Ga0495674_0238974 3300047319 Bacteria 1497
167 Ga0495676_0023372 3300047321 Bacteria 5367
168 Ga0495676_0181668 3300047321 Bacteria 1474
169 Ga0495676_0255181 3300047321 Bacteria 1194
170 Ga0495676_0287663 3300047321 Bacteria 1111
171 Ga0495680_0000050 3300047322 Bacteria 95945
172 Ga0495680_0002921 3300047322 Bacteria 17164
173 Ga0495675_0006402 3300047444 Bacteria 7207
174 Ga0495675_0038168 3300047444 Bacteria 3058
175 Ga0495684_0024546 3300047471 Bacteria 4641
176 Ga0495684_0027143 3300047471 Unclassified 4395
177 Ga0495684_0097185 3300047471 Bacteria 2228
178 Ga0495684_0119638 3300047471 Bacteria 1984
179 Ga0495684_0289015 3300047471 Bacteria 1181
180 Ga0495684_0531458 3300047471 Bacteria 804
181 Ga0495593_0023300 3300047673 Bacteria 3443
182 Ga0495593_0097994 3300047673 Bacteria 1506
183 Ga0495602_0063928 3300048088 Bacteria 3185
184 Ga0496100_0507618 3300048903 Bacteria 929
185 Ga0496101_0060885 3300048904 Bacteria 2740
186 Ga0496101_0467389 3300048904 Bacteria 995
187 Ga0496102_0055728 3300048905 Bacteria 3604
188 Ga0496103_0116979 3300048906 Bacteria 1696
189 Ga0496103_0127791 3300048906 Bacteria 1621
190 Ga0496106_0089755 3300048909 Bacteria 2370
191 Ga0496107_0052852 3300048910 Bacteria 2930
192 Ga0496107_0143262 3300048910 Bacteria 1766
193 Ga0496108_0059445 3300048911 Bacteria 3214
194 Ga0496108_0720271 3300048911 Bacteria 864
195 Ga0496109_0112118 3300048912 Bacteria 2536
196 Ga0496112_0388115 3300048915 Bacteria 1337
197 Ga0496113_0185599 3300048916 Bacteria 1649
198 Ga0496114_0079496 3300048917 Bacteria 2768
199 Ga0496115_0086136 3300048918 Bacteria 2563
200 Ga0496124_0070094 3300048927 Bacteria 2909
201 Ga0501298_065083 3300049521 Unclassified 778
202 Ga0501031_0116856 3300049568 Bacteria 1742
203 Ga0501033_0051352 3300049570 Bacteria 3056
204 Ga0501033_0228057 3300049570 Bacteria 1324
205 Ga0501034_0259786 3300049571 Bacteria 1680
206 Ga0501038_0033387 3300049574 Bacteria 4534
207 Ga0501038_0121197 3300049574 Bacteria 2156
208 Ga0501039_0007434 3300049575 Bacteria 8361
209 Ga0501039_0015290 3300049575 Bacteria 5874
210 Ga0501040_0020734 3300049576 Bacteria 4382
211 Ga0501040_0022737 3300049576 Bacteria 4200
212 Ga0501040_0107881 3300049576 Bacteria 1946
213 Ga0501040_0147719 3300049576 Bacteria 1657
214 Ga0501041_0030623 3300049577 Bacteria 3248
215 Ga0501041_0194870 3300049577 Bacteria 1269
216 Ga0501041_0221707 3300049577 Bacteria 1186
217 Ga0501042_0168319 3300049578 Bacteria 1581
218 Ga0501042_0583314 3300049578 Bacteria 813
219 Ga0501046_0001182 3300049580 Bacteria 25399
220 Ga0501046_0066869 3300049580 Bacteria 2800
221 Ga0501047_0007089 3300049581 Bacteria 10525
222 Ga0501048_0011087 3300049582 Bacteria 6720
223 Ga0501048_0152886 3300049582 Bacteria 1632
224 Ga0501067_0015912 3300049583 Bacteria 4160
225 Ga0501068_0033343 3300049584 Bacteria 3066
226 Ga0501069_0052568 3300049585 Bacteria 2268
227 Ga0501069_0140451 3300049585 Bacteria 1385
228 Ga0501070_0406481 3300049586 Bacteria 1101
229 Ga0501071_0015321 3300049587 Bacteria 5262
230 Ga0501071_0320092 3300049587 Bacteria 1178
231 Ga0501072_0002822 3300049588 Bacteria 13046
232 Ga0501072_0547049 3300049588 Bacteria 914
233 Ga0501074_0051014 3300049590 Bacteria 2986
234 Ga0501074_0464042 3300049590 Bacteria 897
235 Ga0501075_0003770 3300049591 Bacteria 10185
236 Ga0501075_0150004 3300049591 Bacteria 1777
237 Ga0501076_0040131 3300049592 Bacteria 3677
238 Ga0501076_0040216 3300049592 Bacteria 3673
239 Ga0501077_0097767 3300049593 Bacteria 1860
240 Ga0501217_077247 3300049661 Unclassified 916
241 Ga0501243_031751 3300049675 Bacteria 904
242 Ga0501079_0124574 3300049741 Bacteria 2004
243 Ga0501079_0317404 3300049741 Bacteria 1220
244 Ga0501080_0055654 3300049742 Bacteria 3684
245 Ga0501080_0152536 3300049742 Bacteria 2135
246 Ga0501081_0017848 3300049743 Bacteria 4705
247 Ga0501081_0213607 3300049743 Bacteria 1401
248 Ga0501035_0164108 3300049822 Bacteria 1922
249 Ga0501044_0036085 3300049823 Bacteria 5174
250 Ga0501045_0059833 3300049824 Bacteria 2792
251 Ga0501045_0068825 3300049824 Bacteria 2601
252 Ga0501045_0088684 3300049824 Bacteria 2285
253 nmdc:mga0rr50_370325_c1 3300050513 Bacteria 1207
254 nmdc:mga08x19_315004_c1 3300050514 Bacteria 1088
255 nmdc:mga0a205_46285_c1 3300050515 Bacteria 4195
256 Ga0495601_0031012 3300053077 Bacteria 3322
257 Ga0495601_0053126 3300053077 Bacteria 2560
258 Ga0495595_0000181 3300053084 Bacteria 25220
259 Ga0495619_0006178 3300053085 Bacteria 7591
260 Ga0495619_0015081 3300053085 Bacteria 4883
261 Ga0495619_0056250 3300053085 Bacteria 2608
262 Ga0500578_0055136 3300053086 Unclassified 2544
263 Ga0501084_0107500 3300054114 Bacteria 2343
264 Ga0501084_0613981 3300054114 Bacteria 918
265 Ga0501082_0014339 3300060353 Bacteria 6820
266 Ga0501082_0222105 3300060353 Bacteria 1644
267 Ga0501082_0242179 3300060353 Bacteria 1569
268 Ga0530510_0003545 3300061734 Bacteria 10747
269 Ga0530510_0038477 3300061734 Bacteria 3453
270 Ga0530510_0196855 3300061734 Bacteria 1496
271 2643850930 2643221567 Bacteria 4163945
272 2644134671 2643221624 Bacteria 4384879
273 2644610158 2643221711 Bacteria 4865335
274 2740033447 2739367866 Bacteria 4215900
275 2740033610 2739367866 Bacteria 4215900
276 2819424233 2818991318 Bacteria 5266538
277 2819729323 2818991469 Bacteria 4644110
278 Ga0081539_10002306
279 JGI25406J46586_10006818
280 rootH1_10047279
281 Ga0070670_100959752
282 Ga0070677_10017517
283 Ga0070682_100232666
284 Ga0070668_100380142
285 Ga0070667_100112514
286 Ga0070667_100406384
287 Ga0070708_100056864
288 Ga0070678_100062256
289 Ga0070707_100005138
290 Ga0070707_100592878
291 Ga0070696_100499342
292 Ga0070665_100057492
293 Ga0068855_100981496
294 Ga0068856_100250140
295 Ga0068863_100148311
296 Ga0068858_100591753
297 Ga0081538_10002021
298 Ga0097621_100128426
299 Ga0075433_10138525
300 Ga0075434_100020947
301 Ga0068865_100230644
302 Ga0075436_100163758
303 Ga0075435_100188710
304 Ga0105251_10005393
305 Ga0105244_10025718
306 Ga0105244_10086345
307 Ga0105245_10000316
308 Ga0105245_10130229
309 Ga0105242_10361262
310 Ga0105248_10042289
311 Ga0157369_10165366
312 Ga0157375_10051020
313 Ga0157376_10128773
314 Ga0163161_10000140
315 Ga0209050_1014736
316 Ga0207680_10049935
317 Ga0207646_10001242
318 Ga0207687_10006470
319 Ga0207687_10435332
320 Ga0207664_10000009
321 Ga0207711_10074982
322 Ga0207667_10832325
323 Ga0207677_10561939
324 Ga0207702_10306110
325 Ga0207683_10129197
326 Ga0265316_10248029
327 Ga0307410_10230458
328 Ga0307407_10104705
329 Ga0307409_100390579
330 Ga0307409_100613579
331 Ga0307414_10498667
332 Ga0439466_0047947
333 Ga0451839_1596570
334 Ga0439448_0001146
335 Ga0439449_0004464
336 Ga0439450_000110
337 Ga0439454_001552
338 Ga0439455_0000581
339 Ga0439457_041566
340 Ga0439463_000534
341 Ga0439463_060183
342 Ga0439444_0001839
343 Ga0439464_0001108
344 Ga0439460_0000213
345 Ga0450916_001342
346 Ga0451577_0001655
347 Ga0439440_0000257
348 Ga0495592_0272465
349 Ga0495603_0038027
350 Ga0495603_0308048
351 Ga0495629_0012269
352 Ga0495629_0046068
353 Ga0495629_0213980
354 Ga0495629_0215303
355 Ga0495651_0001759
356 Ga0495651_0149481
357 Ga0495653_0001814
358 Ga0495653_0020067
359 Ga0495653_0086259
360 Ga0495653_0130616
361 Ga0495653_0141293
362 Ga0495653_0178206
363 Ga0495580_0023465
364 Ga0495582_0065871
365 Ga0495582_0077487
366 Ga0495582_0110672
367 Ga0495662_0000140
368 Ga0495662_0000570
369 Ga0495662_0043596
370 Ga0495662_0055973
371 Ga0495664_0015008
372 Ga0495664_0074151
373 Ga0495664_0274058
374 Ga0495594_0139454
375 Ga0495594_0168502
376 Ga0495608_0000976
377 Ga0495608_0002678
378 Ga0495608_0034723
379 Ga0495608_0232176
380 Ga0495618_0010116
381 Ga0495628_0019605
382 Ga0495628_0105233
383 Ga0495628_0146400
384 Ga0495630_0010298
385 Ga0495630_0037190
386 Ga0495630_0082460
387 Ga0495630_0112349
388 Ga0495630_0403274
389 Ga0495630_0552943
390 Ga0495643_0220140
391 Ga0495666_0000202
392 Ga0495652_0193288
393 Ga0495652_0378349
394 Ga0495665_0004579
395 Ga0495665_0028551
396 Ga0495665_0031315
397 Ga0495640_0009186
398 Ga0495640_0015693
399 Ga0495640_0021918
400 Ga0495640_0033345
401 Ga0495586_0003416
402 Ga0495586_0011440
403 Ga0495586_0057961
404 Ga0495587_0053565
405 Ga0495587_0127951
406 Ga0495645_0003098
407 Ga0495667_0010251
408 Ga0495667_0021616
409 Ga0495667_0036953
410 Ga0495634_0081381
411 Ga0495634_0185590
412 Ga0495634_0614523
413 Ga0495635_0000006
414 Ga0495635_0011360
415 Ga0495635_0246597
416 Ga0495635_0419965
417 Ga0495659_0019513
418 Ga0495588_0001848
419 Ga0495657_0015445
420 Ga0495657_0019270
421 Ga0495657_0342868
422 Ga0495599_0188786
423 Ga0495599_0474074
424 Ga0495623_0007879
425 Ga0495623_0045645
426 Ga0495646_0087306
427 Ga0495658_0215651
428 Ga0495613_0000092
429 Ga0495613_0003660
430 Ga0495613_0025106
431 Ga0495624_0008041
432 Ga0495624_0049727
433 Ga0495600_0029642
434 Ga0495600_0069513
435 Ga0495581_0000128
436 Ga0495581_0118594
437 Ga0495581_0142714
438 Ga0495581_0164357
439 Ga0495604_0004747
440 Ga0495604_0120618
441 Ga0495674_0006313
442 Ga0495674_0044899
443 Ga0495674_0238974
444 Ga0495676_0023372
445 Ga0495676_0181668
446 Ga0495676_0255181
447 Ga0495676_0287663
448 Ga0495680_0000050
449 Ga0495680_0002921
450 Ga0495675_0006402
451 Ga0495675_0038168
452 Ga0495684_0024546
453 Ga0495684_0027143
454 Ga0495684_0097185
455 Ga0495684_0119638
456 Ga0495684_0289015
457 Ga0495684_0531458
458 Ga0495593_0023300
459 Ga0495593_0097994
460 Ga0495602_0063928
461 Ga0496100_0507618
462 Ga0496101_0060885
463 Ga0496101_0467389
464 Ga0496102_0055728
465 Ga0496103_0116979
466 Ga0496103_0127791
467 Ga0496106_0089755
468 Ga0496107_0052852
469 Ga0496107_0143262
470 Ga0496108_0059445
471 Ga0496108_0720271
472 Ga0496109_0112118
473 Ga0496112_0388115
474 Ga0496113_0185599
475 Ga0496114_0079496
476 Ga0496115_0086136
477 Ga0496124_0070094
478 Ga0501298_065083
479 Ga0501031_0116856
480 Ga0501033_0051352
481 Ga0501033_0228057
482 Ga0501034_0259786
483 Ga0501038_0033387
484 Ga0501038_0121197
485 Ga0501039_0007434
486 Ga0501039_0015290
487 Ga0501040_0020734
488 Ga0501040_0022737
489 Ga0501040_0107881
490 Ga0501040_0147719
491 Ga0501041_0030623
492 Ga0501041_0194870
493 Ga0501041_0221707
494 Ga0501042_0168319
495 Ga0501042_0583314
496 Ga0501046_0001182
497 Ga0501046_0066869
498 Ga0501047_0007089
499 Ga0501048_0011087
500 Ga0501048_0152886
501 Ga0501067_0015912
502 Ga0501068_0033343
503 Ga0501069_0052568
504 Ga0501069_0140451
505 Ga0501070_0406481
506 Ga0501071_0015321
507 Ga0501071_0320092
508 Ga0501072_0002822
509 Ga0501072_0547049
510 Ga0501074_0051014
511 Ga0501074_0464042
512 Ga0501075_0003770
513 Ga0501075_0150004
514 Ga0501076_0040131
515 Ga0501076_0040216
516 Ga0501077_0097767
517 Ga0501217_077247
518 Ga0501243_031751
519 Ga0501079_0124574
520 Ga0501079_0317404
521 Ga0501080_0055654
522 Ga0501080_0152536
523 Ga0501081_0017848
524 Ga0501081_0213607
525 Ga0501035_0164108
526 Ga0501044_0036085
527 Ga0501045_0059833
528 Ga0501045_0068825
529 Ga0501045_0088684
530 nmdc:mga0rr50_370325_c1
531 nmdc:mga08x19_315004_c1
532 nmdc:mga0a205_46285_c1
533 Ga0495601_0031012
534 Ga0495601_0053126
535 Ga0495595_0000181
536 Ga0495619_0006178
537 Ga0495619_0015081
538 Ga0495619_0056250
539 Ga0500578_0055136
540 Ga0501084_0107500
541 Ga0501084_0613981
542 Ga0501082_0014339
543 Ga0501082_0222105
544 Ga0501082_0242179
545 Ga0530510_0003545
546 Ga0530510_0038477
547 Ga0530510_0196855
548 2643850930
549 2644134671
550 2644610158
551 2740033447
552 2740033610
553 2819424233
554 2819729323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

14

119

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dtt-assembly1.cif.gz_B crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution 0.9765 2 226
3dtt-assembly1.cif.gz_A crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution 0.9755 2 226
3dtt-assembly1.cif.gz_B crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution 0.9592 2 226
3dtt-assembly1.cif.gz_A crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution 0.9581 2 226
3nrn-assembly1.cif.gz_A crystal structure of pf1083 protein from pyrococcus furiosus, northeast structural genomics consortium target pfr223 0.9562 1 32
ID Description Score Start End Superfamily
3dttA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9756 2 226 3.40.50.720
3dttA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 2 226 3.40.50.720
af_A0A1D6E3F3_39_301_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9469 2 32 3.50.50.60
6cr0A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9467 2 28 3.50.50.60
3i3lA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9427 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3C1DWD4-F1-model_v4 NADP oxidoreductase 0.9843 1 198 GO:0005886
GO:0008823
GO:0015677
GO:0052851
AF-A0A7K2L400-F1-model_v4 NAD(P)-binding domain-containing protein 0.983 1 59
AF-A0A1C5J4M5-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9813 1 226
AF-A0A3C1DWD4-F1-model_v4 NADP oxidoreductase 0.9794 1 198 GO:0005886
GO:0008823
GO:0015677
GO:0052851
AF-A0A5J4KW38-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9789 1 115

Map