F381646

General Info

Members Datasets Scaffolds Average Seq Length
277 146 277 169

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100647204|Ga0070707_1006472042
Length 189
Sequence MCGAAEPRRSRRRGRYARRVKTFNLRSAKLRSGEEFRDEVELELTPLEYGGQRYLPVPDTVPAALVITRASTGTVFQLRFVARLHGPCYRCLADAVVEIPADAREYQATNPEGSDELRTPYLTDDTLALDAWARDAIALALPEQILCGPDCKGLCPMCGKDLNVEPHEHEEEHEDPRWAVLAELRDKLD

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
63 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
72 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
73 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
74 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
75 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
76 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
77 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
78 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
79 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
87 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
91 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
92 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
93 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
94 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
97 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
98 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
115 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 12.64
Rhizosphere 85.56
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100005446 3300005329 Bacteria 10632
2 Ga0070683_100011237 3300005329 Bacteria 7726
3 Ga0070683_100604318 3300005329 Bacteria 1050
4 Ga0068868_101504731 3300005338 Bacteria 630
5 Ga0070674_100370518 3300005356 Bacteria 1162
6 Ga0070673_100730080 3300005364 Bacteria 911
7 Ga0070688_100430935 3300005365 Bacteria 982
8 Ga0070688_100524809 3300005365 Bacteria 897
9 Ga0070714_100774921 3300005435 Unclassified 928
10 Ga0070711_100250184 3300005439 Bacteria 1390
11 Ga0070711_100724335 3300005439 Unclassified 839
12 Ga0070711_100750531 3300005439 Bacteria 825
13 Ga0070705_100827469 3300005440 Bacteria 739
14 Ga0070678_101066796 3300005456 Bacteria 745
15 Ga0068867_100340459 3300005459 Bacteria 1248
16 Ga0068867_100918951 3300005459 Bacteria 789
17 Ga0070685_10291843 3300005466 Bacteria 1096
18 Ga0070706_100019552 3300005467 Bacteria 6246
19 Ga0070706_100157461 3300005467 Bacteria 2120
20 Ga0070707_100010716 3300005468 Bacteria 8540
21 Ga0070707_100647204 3300005468 Bacteria 1019
22 Ga0070698_100172114 3300005471 Bacteria 2106
23 Ga0070698_100500109 3300005471 Bacteria 1153
24 Ga0070699_100378168 3300005518 Bacteria 1278
25 Ga0070684_100003201 3300005535 Bacteria 12241
26 Ga0070684_100017955 3300005535 Bacteria 5816
27 Ga0070684_100018423 3300005535 Bacteria 5751
28 Ga0070697_100047333 3300005536 Bacteria 3487
29 Ga0070697_100101417 3300005536 Bacteria 2391
30 Ga0070693_100152792 3300005547 Bacteria 1464
31 Ga0070664_100011644 3300005564 Bacteria 7137
32 Ga0070664_100320739 3300005564 Bacteria 1404
33 Ga0068857_100014497 3300005577 Bacteria 6875
34 Ga0068857_100157343 3300005577 Bacteria 2061
35 Ga0068854_100943365 3300005578 Bacteria 761
36 Ga0070702_100473952 3300005615 Bacteria 913
37 Ga0070702_100704564 3300005615 Bacteria 770
38 Ga0068852_100813325 3300005616 Bacteria 949
39 Ga0068870_10135773 3300005840 Bacteria 1434
40 Ga0081455_10029454 3300005937 Bacteria 5006
41 Ga0081455_10406136 3300005937 Bacteria 944
42 Ga0081455_10505666 3300005937 Bacteria 810
43 Ga0081538_10061890 3300005981 Bacteria 2139
44 Ga0081540_1002689 3300005983 Bacteria 14457
45 Ga0081539_10008906 3300005985 Bacteria 8563
46 Ga0070717_10358444 3300006028 Bacteria 1305
47 Ga0070712_101207172 3300006175 Bacteria 658
48 Ga0075428_100207504 3300006844 Bacteria 2117
49 Ga0075428_100523272 3300006844 Bacteria 1268
50 Ga0075428_101270466 3300006844 Bacteria 775
51 Ga0075431_100087632 3300006847 Bacteria 3212
52 Ga0075431_100489398 3300006847 Bacteria 1222
53 Ga0075433_10410140 3300006852 Bacteria 1195
54 Ga0075433_10496961 3300006852 Bacteria 1074
55 Ga0075434_100219264 3300006871 Bacteria 1922
56 Ga0075434_100698450 3300006871 Bacteria 1032
57 Ga0075434_100948372 3300006871 Bacteria 875
58 Ga0075429_100339064 3300006880 Bacteria 1316
59 Ga0068865_100914748 3300006881 Bacteria 764
60 Ga0111539_10017960 3300009094 Bacteria 8761
61 Ga0111539_10328377 3300009094 Bacteria 1780
62 Ga0105245_10043182 3300009098 Bacteria 4022
63 Ga0105245_10661881 3300009098 Unclassified 1075
64 Ga0114129_10378023 3300009147 Bacteria 1871
65 Ga0114129_10540799 3300009147 Bacteria 1516
66 Ga0114129_10845664 3300009147 Bacteria 1164
67 Ga0105243_10162186 3300009148 Bacteria 1929
68 Ga0105243_10803708 3300009148 Bacteria 927
69 Ga0105242_11132822 3300009176 Unclassified 798
70 Ga0105239_10067002 3300010375 Bacteria 3944
71 Ga0105239_11640749 3300010375 Unclassified 744
72 Ga0157375_10540167 3300013308 Bacteria 1328
73 Ga0157375_11592091 3300013308 Unclassified 772
74 Ga0163163_10225436 3300014325 Bacteria 1923
75 Ga0163163_11729368 3300014325 Unclassified 686
76 Ga0157377_10172106 3300014745 Bacteria 1355
77 Ga0207684_10407530 3300025910 Unclassified 1168
78 Ga0207663_10423060 3300025916 Bacteria 1023
79 Ga0207646_10016251 3300025922 Bacteria 6987
80 Ga0207687_10152709 3300025927 Bacteria 1764
81 Ga0207669_10409936 3300025937 Unclassified 1064
82 Ga0207704_10478309 3300025938 Bacteria 999
83 Ga0207665_10256859 3300025939 Unclassified 1293
84 Ga0207689_10144082 3300025942 Unclassified 1963
85 Ga0207661_10046341 3300025944 Bacteria 3448
86 Ga0207661_10380430 3300025944 Bacteria 1278
87 Ga0207661_10680520 3300025944 Unclassified 946
88 Ga0207679_10122277 3300025945 Bacteria 2074
89 Ga0207679_10251819 3300025945 Bacteria 1502
90 Ga0207648_10093226 3300026089 Bacteria 2634
91 Ga0207674_10007042 3300026116 Bacteria 13150
92 Ga0207674_10167844 3300026116 Bacteria 2148
93 Ga0207698_10574399 3300026142 Unclassified 1108
94 Ga0207428_10108326 3300027907 Bacteria 2140
95 Ga0307416_100070353 3300032002 Bacteria 2901
96 Ga0307416_100145683 3300032002 Bacteria 2162
97 Ga0307416_100250869 3300032002 Bacteria 1722
98 Ga0307415_100158416 3300032126 Bacteria 1752
99 Ga0373926_0054827 3300035083 Bacteria 1444
100 Ga0373931_0423457 3300035691 Archaea 847
101 Ga0373935_0037258 3300035692 Bacteria 3043
102 Ga0373935_0609117 3300035692 Bacteria 799
103 Ga0373937_0503093 3300036401 Unclassified 1151
104 Ga0395899_0011808 3300037312 Bacteria 6686
105 Ga0395899_0035372 3300037312 Bacteria 3750
106 Ga0395899_0058893 3300037312 Bacteria 2832
107 Ga0395899_0117590 3300037312 Bacteria 1907
108 Ga0395899_0180131 3300037312 Bacteria 1484
109 Ga0395899_0215326 3300037312 Bacteria 1333
110 Ga0395899_0522238 3300037312 Bacteria 767
111 Ga0395899_0598600 3300037312 Bacteria 702
112 Ga0395900_0006475 3300037418 Bacteria 12211
113 Ga0395900_0030359 3300037418 Bacteria 5550
114 Ga0395900_0032016 3300037418 Bacteria 5406
115 Ga0395900_0040195 3300037418 Bacteria 4820
116 Ga0395900_0045721 3300037418 Bacteria 4509
117 Ga0395900_0093709 3300037418 Bacteria 3085
118 Ga0395900_0111654 3300037418 Bacteria 2807
119 Ga0395900_0265919 3300037418 Bacteria 1711
120 Ga0395900_0331645 3300037418 Bacteria 1499
121 Ga0395900_0640088 3300037418 Bacteria 1001
122 Ga0395900_0900505 3300037418 Unclassified 808
123 Ga0395900_1062854 3300037418 Bacteria 728
124 Ga0395898_0003650 3300037466 Bacteria 17118
125 Ga0395898_0018010 3300037466 Bacteria 7206
126 Ga0395898_0043986 3300037466 Bacteria 4399
127 Ga0395898_0061347 3300037466 Bacteria 3653
128 Ga0395898_0078323 3300037466 Unclassified 3189
129 Ga0395898_0088253 3300037466 Bacteria 2986
130 Ga0395898_0092461 3300037466 Bacteria 2909
131 Ga0395898_0105340 3300037466 Bacteria 2704
132 Ga0395898_0107391 3300037466 Bacteria 2677
133 Ga0395898_0358659 3300037466 Bacteria 1390
134 Ga0395898_0566328 3300037466 Unclassified 1078
135 Ga0395898_0681133 3300037466 Bacteria 970
136 Ga0395898_0684857 3300037466 Bacteria 967
137 Ga0395898_0971409 3300037466 Unclassified 786
138 Ga0395905_0008553 3300037471 Bacteria 10093
139 Ga0395905_0012459 3300037471 Bacteria 8186
140 Ga0395905_0035480 3300037471 Bacteria 4683
141 Ga0395905_0078907 3300037471 Bacteria 3085
142 Ga0395905_0094670 3300037471 Bacteria 2802
143 Ga0395905_0140303 3300037471 Bacteria 2274
144 Ga0395905_0244505 3300037471 Bacteria 1676
145 Ga0395905_0375005 3300037471 Bacteria 1316
146 Ga0395905_0421448 3300037471 Bacteria 1231
147 Ga0395905_0708519 3300037471 Bacteria 909
148 Ga0395901_0005827 3300038443 Bacteria 12473
149 Ga0395901_0005881 3300038443 Bacteria 12413
150 Ga0395901_0027466 3300038443 Bacteria 5848
151 Ga0395901_0035270 3300038443 Bacteria 5168
152 Ga0395901_0041044 3300038443 Bacteria 4794
153 Ga0395901_0041439 3300038443 Bacteria 4772
154 Ga0395901_0084476 3300038443 Bacteria 3318
155 Ga0395901_0102237 3300038443 Bacteria 3007
156 Ga0395901_0110260 3300038443 Unclassified 2889
157 Ga0395901_0132814 3300038443 Bacteria 2616
158 Ga0395901_0146629 3300038443 Bacteria 2480
159 Ga0395901_0200592 3300038443 Bacteria 2091
160 Ga0395901_0282538 3300038443 Bacteria 1724
161 Ga0395901_0325290 3300038443 Bacteria 1590
162 Ga0395901_0336413 3300038443 Bacteria 1560
163 Ga0395901_0355770 3300038443 Bacteria 1511
164 Ga0395901_0444607 3300038443 Unclassified 1326
165 Ga0395901_0719423 3300038443 Bacteria 994
166 Ga0395901_1089366 3300038443 Bacteria 770
167 Ga0395901_1425698 3300038443 Unclassified 650
168 Ga0439465_0162543 3300041413 Bacteria 801
169 Ga0451798_0367662 3300041458 Bacteria 689
170 Ga0451800_0309182 3300041459 Bacteria 762
171 Ga0451800_1626058 3300041459 Bacteria 861
172 Ga0451802_0348378 3300041460 Bacteria 907
173 Ga0451807_1147492 3300041486 Unclassified 729
174 Ga0451839_0154043 3300041496 Bacteria 1558
175 Ga0451839_0299970 3300041496 Bacteria 973
176 Ga0451847_0906983 3300041503 Bacteria 1088
177 Ga0451853_0193159 3300041512 Bacteria 2208
178 Ga0439458_0151697 3300042157 Unclassified 621
179 Ga0451576_1452544 3300045051 Bacteria 713
180 Ga0495592_0163328 3300046454 Bacteria 1530
181 Ga0495590_0050247 3300046457 Bacteria 1455
182 Ga0495653_0249972 3300046463 Bacteria 1177
183 Ga0495582_0058707 3300046473 Bacteria 2122
184 Ga0495605_0012302 3300046474 Bacteria 4751
185 Ga0495584_0013343 3300046491 Bacteria 4195
186 Ga0495584_0148557 3300046491 Bacteria 1191
187 Ga0495584_0279827 3300046491 Unclassified 848
188 Ga0495596_0023028 3300046500 Bacteria 2530
189 Ga0495583_0334120 3300046506 Unclassified 599
190 Ga0495628_0448670 3300046516 Unclassified 937
191 Ga0495631_0141820 3300046518 Bacteria 1032
192 Ga0495637_0215788 3300046520 Unclassified 700
193 Ga0495648_0357764 3300046524 Unclassified 665
194 Ga0495663_0018762 3300046525 Bacteria 1972
195 Ga0495665_0013584 3300046531 Bacteria 4401
196 Ga0495586_0338230 3300046535 Bacteria 864
197 Ga0495609_0046213 3300046538 Bacteria 1950
198 Ga0495633_0256390 3300046558 Bacteria 798
199 Ga0495656_0116319 3300046615 Bacteria 1257
200 Ga0495668_0369641 3300046616 Unclassified 787
201 Ga0495659_0129154 3300046664 Unclassified 1001
202 Ga0495659_0146180 3300046664 Unclassified 947
203 Ga0495659_0178074 3300046664 Bacteria 865
204 Ga0495588_0185384 3300046674 Bacteria 1099
205 Ga0495657_0651555 3300046675 Bacteria 607
206 Ga0495647_0034383 3300046681 Bacteria 1898
207 Ga0495658_0216546 3300046683 Bacteria 1198
208 Ga0495613_0042045 3300046689 Bacteria 3383
209 Ga0495613_0113634 3300046689 Bacteria 1950
210 Ga0495624_0234764 3300046690 Unclassified 1110
211 Ga0495670_0104912 3300046691 Bacteria 1459
212 Ga0495670_0185407 3300046691 Unclassified 1100
213 Ga0495671_0107570 3300046692 Bacteria 1362
214 Ga0495589_0116292 3300046794 Bacteria 1289
215 Ga0495589_0296629 3300046794 Unclassified 750
216 Ga0495581_0016211 3300047315 Bacteria 4332
217 Ga0495674_0510004 3300047319 Unclassified 961
218 Ga0495676_0062180 3300047321 Bacteria 2916
219 Ga0495676_0338130 3300047321 Bacteria 1008
220 Ga0495680_0271750 3300047322 Unclassified 1197
221 Ga0495677_0148603 3300047445 Unclassified 902
222 Ga0495685_106905 3300047447 Unclassified 922
223 Ga0496100_0021956 3300048903 Bacteria 3854
224 Ga0496100_0466095 3300048903 Bacteria 970
225 Ga0496100_0468459 3300048903 Bacteria 968
226 Ga0496100_0882692 3300048903 Unclassified 702
227 Ga0496101_0085691 3300048904 Bacteria 2335
228 Ga0496101_0356983 3300048904 Bacteria 1149
229 Ga0496102_0626646 3300048905 Bacteria 999
230 Ga0496103_0330103 3300048906 Unclassified 981
231 Ga0496104_0030453 3300048907 Bacteria 5015
232 Ga0496105_1037549 3300048908 Unclassified 611
233 Ga0496107_0170625 3300048910 Bacteria 1614
234 Ga0496107_0347031 3300048910 Bacteria 1105
235 Ga0496107_0795435 3300048910 Unclassified 693
236 Ga0496108_0013076 3300048911 Bacteria 6764
237 Ga0496108_0040119 3300048911 Bacteria 3902
238 Ga0496108_0548482 3300048911 Unclassified 1009
239 Ga0496108_0594054 3300048911 Bacteria 965
240 Ga0496108_1149847 3300048911 Bacteria 658
241 Ga0496109_0005595 3300048912 Bacteria 10517
242 Ga0496109_0133748 3300048912 Bacteria 2316
243 Ga0496109_0269416 3300048912 Bacteria 1604
244 Ga0496109_0375793 3300048912 Bacteria 1342
245 Ga0496109_0514002 3300048912 Bacteria 1130
246 Ga0496109_0918937 3300048912 Unclassified 813
247 Ga0496110_0257083 3300048913 Bacteria 1590
248 Ga0496110_0292627 3300048913 Bacteria 1483
249 Ga0496110_0810613 3300048913 Bacteria 841
250 Ga0496111_0009805 3300048914 Bacteria 6402
251 Ga0496112_0021206 3300048915 Bacteria 6175
252 Ga0496113_0025658 3300048916 Bacteria 4204
253 Ga0501039_0202516 3300049575 Bacteria 1561
254 Ga0501040_0835946 3300049576 Bacteria 667
255 Ga0501071_0225370 3300049587 Bacteria 1412
256 Ga0501075_0335686 3300049591 Bacteria 1152
257 Ga0501076_1412009 3300049592 Bacteria 572
258 Ga0501079_0390819 3300049741 Bacteria 1091
259 Ga0501045_0551222 3300049824 Bacteria 855
260 nmdc:mga00v17_943267_c1 3300050491 Bacteria 545
261 nmdc:mga05p37_26418_c1 3300050507 Bacteria 7062
262 nmdc:mga05p37_48886_c1 3300050507 Bacteria 5201
263 nmdc:mga09592_116106_c1 3300050508 Bacteria 2297
264 nmdc:mga06r32_222176_c1 3300050510 Bacteria 1877
265 nmdc:mga06r32_309422_c1 3300050510 Bacteria 1565
266 nmdc:mga08y16_101950_c1 3300050511 Bacteria 2988
267 nmdc:mga08y16_290702_c1 3300050511 Bacteria 1685
268 nmdc:mga08y16_440167_c1 3300050511 Bacteria 1330
269 nmdc:mga0n895_371720_c1 3300050512 Bacteria 1447
270 nmdc:mga0n895_602943_c1 3300050512 Bacteria 1100
271 nmdc:mga08x19_91640_c1 3300050514 Bacteria 2007
272 nmdc:mga0a205_520854_c1 3300050515 Bacteria 1045
273 nmdc:mga0a205_553053_c1 3300050515 Bacteria 1006
274 Ga0495601_0146803 3300053077 Bacteria 1539
275 Ga0501084_0611525 3300054114 Bacteria 921
276 Ga0501084_1197555 3300054114 Unclassified 637
277 Ga0530510_0230270 3300061734 Bacteria 1378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041503 Ga0451847_0906983 Ga0451847_0906983_226_738 159
2 3300046674 Ga0495588_0185384 Ga0495588_0185384_65_547 160
3 3300041496 Ga0451839_0154043 Ga0451839_0154043_347_838 163
4 3300041512 Ga0451853_0193159 Ga0451853_0193159_1542_2033 163
5 3300025944 Ga0207661_10680520 Ga0207661_106805202 167
6 3300005329 Ga0070683_100005446 Ga0070683_1000054469 168
7 3300005329 Ga0070683_100011237 Ga0070683_1000112376 168
8 3300005329 Ga0070683_100604318 Ga0070683_1006043182 168
9 3300005338 Ga0068868_101504731 Ga0068868_1015047311 168
10 3300005356 Ga0070674_100370518 Ga0070674_1003705182 168
11 3300005364 Ga0070673_100730080 Ga0070673_1007300802 168
12 3300005365 Ga0070688_100430935 Ga0070688_1004309352 168
13 3300005365 Ga0070688_100524809 Ga0070688_1005248092 168
14 3300005435 Ga0070714_100774921 Ga0070714_1007749212 168
15 3300005439 Ga0070711_100250184 Ga0070711_1002501842 168
16 3300005439 Ga0070711_100724335 Ga0070711_1007243351 168
17 3300005439 Ga0070711_100750531 Ga0070711_1007505312 168
18 3300005440 Ga0070705_100827469 Ga0070705_1008274691 168
19 3300005456 Ga0070678_101066796 Ga0070678_1010667961 168
20 3300005459 Ga0068867_100340459 Ga0068867_1003404592 168
21 3300005459 Ga0068867_100918951 Ga0068867_1009189512 168
22 3300005466 Ga0070685_10291843 Ga0070685_102918432 168
23 3300005467 Ga0070706_100019552 Ga0070706_1000195523 168
24 3300005467 Ga0070706_100157461 Ga0070706_1001574612 168
25 3300005468 Ga0070707_100010716 Ga0070707_1000107162 168
26 3300005468 Ga0070707_100647204 Ga0070707_1006472042 168
27 3300005471 Ga0070698_100172114 Ga0070698_1001721142 168
28 3300005471 Ga0070698_100500109 Ga0070698_1005001092 168
29 3300005518 Ga0070699_100378168 Ga0070699_1003781681 168
30 3300005535 Ga0070684_100003201 Ga0070684_1000032014 168
31 3300005535 Ga0070684_100017955 Ga0070684_1000179551 168
32 3300005535 Ga0070684_100018423 Ga0070684_1000184236 168
33 3300005536 Ga0070697_100047333 Ga0070697_1000473335 168
34 3300005536 Ga0070697_100101417 Ga0070697_1001014172 168
35 3300005547 Ga0070693_100152792 Ga0070693_1001527923 168
36 3300005564 Ga0070664_100011644 Ga0070664_1000116442 168
37 3300005564 Ga0070664_100320739 Ga0070664_1003207392 168
38 3300005577 Ga0068857_100014497 Ga0068857_1000144972 168
39 3300005577 Ga0068857_100157343 Ga0068857_1001573433 168
40 3300005578 Ga0068854_100943365 Ga0068854_1009433651 168
41 3300005615 Ga0070702_100473952 Ga0070702_1004739521 168
42 3300005615 Ga0070702_100704564 Ga0070702_1007045641 168
43 3300005616 Ga0068852_100813325 Ga0068852_1008133252 168
44 3300005840 Ga0068870_10135773 Ga0068870_101357731 168
45 3300005937 Ga0081455_10029454 Ga0081455_100294542 168
46 3300005937 Ga0081455_10406136 Ga0081455_104061361 168
47 3300005937 Ga0081455_10505666 Ga0081455_105056662 168
48 3300005981 Ga0081538_10061890 Ga0081538_100618902 168
49 3300005983 Ga0081540_1002689 Ga0081540_100268916 168
50 3300005985 Ga0081539_10008906 Ga0081539_100089064 168
51 3300006028 Ga0070717_10358444 Ga0070717_103584441 168
52 3300006175 Ga0070712_101207172 Ga0070712_1012071721 168
53 3300006844 Ga0075428_100207504 Ga0075428_1002075042 168
54 3300006844 Ga0075428_100523272 Ga0075428_1005232722 168
55 3300006844 Ga0075428_101270466 Ga0075428_1012704662 168
56 3300006847 Ga0075431_100087632 Ga0075431_1000876324 168
57 3300006847 Ga0075431_100489398 Ga0075431_1004893982 168
58 3300006852 Ga0075433_10410140 Ga0075433_104101402 168
59 3300006852 Ga0075433_10496961 Ga0075433_104969612 168
60 3300006871 Ga0075434_100219264 Ga0075434_1002192643 168
61 3300006871 Ga0075434_100698450 Ga0075434_1006984501 168
62 3300006871 Ga0075434_100948372 Ga0075434_1009483721 168
63 3300006880 Ga0075429_100339064 Ga0075429_1003390641 168
64 3300006881 Ga0068865_100914748 Ga0068865_1009147481 168
65 3300009094 Ga0111539_10017960 Ga0111539_100179608 168
66 3300009094 Ga0111539_10328377 Ga0111539_103283772 168
67 3300009098 Ga0105245_10043182 Ga0105245_100431823 168
68 3300009098 Ga0105245_10661881 Ga0105245_106618812 168
69 3300009147 Ga0114129_10378023 Ga0114129_103780233 168
70 3300009147 Ga0114129_10540799 Ga0114129_105407992 168
71 3300009147 Ga0114129_10845664 Ga0114129_108456641 168
72 3300009148 Ga0105243_10162186 Ga0105243_101621861 168
73 3300009148 Ga0105243_10803708 Ga0105243_108037082 168
74 3300009176 Ga0105242_11132822 Ga0105242_111328222 168
75 3300010375 Ga0105239_10067002 Ga0105239_100670022 168
76 3300010375 Ga0105239_11640749 Ga0105239_116407492 168
77 3300013308 Ga0157375_10540167 Ga0157375_105401673 168
78 3300013308 Ga0157375_11592091 Ga0157375_115920911 168
79 3300014325 Ga0163163_10225436 Ga0163163_102254362 168
80 3300014325 Ga0163163_11729368 Ga0163163_117293681 168
81 3300014745 Ga0157377_10172106 Ga0157377_101721062 168
82 3300025910 Ga0207684_10407530 Ga0207684_104075301 168
83 3300025916 Ga0207663_10423060 Ga0207663_104230601 168
84 3300025922 Ga0207646_10016251 Ga0207646_1001625110 168
85 3300025927 Ga0207687_10152709 Ga0207687_101527092 168
86 3300025937 Ga0207669_10409936 Ga0207669_104099362 168
87 3300025938 Ga0207704_10478309 Ga0207704_104783092 168
88 3300025939 Ga0207665_10256859 Ga0207665_102568592 168
89 3300025942 Ga0207689_10144082 Ga0207689_101440822 168
90 3300025944 Ga0207661_10046341 Ga0207661_100463414 168
91 3300025944 Ga0207661_10380430 Ga0207661_103804303 168
92 3300025945 Ga0207679_10122277 Ga0207679_101222771 168
93 3300025945 Ga0207679_10251819 Ga0207679_102518192 168
94 3300026089 Ga0207648_10093226 Ga0207648_100932265 168
95 3300026116 Ga0207674_10007042 Ga0207674_100070429 168
96 3300026116 Ga0207674_10167844 Ga0207674_101678443 168
97 3300026142 Ga0207698_10574399 Ga0207698_105743992 168
98 3300027907 Ga0207428_10108326 Ga0207428_101083262 168
99 3300032002 Ga0307416_100070353 Ga0307416_1000703534 168
100 3300032002 Ga0307416_100145683 Ga0307416_1001456833 168
101 3300032002 Ga0307416_100250869 Ga0307416_1002508693 168
102 3300032126 Ga0307415_100158416 Ga0307415_1001584162 168
103 3300035083 Ga0373926_0054827 Ga0373926_0054827_351_857 168
104 3300035691 Ga0373931_0423457 Ga0373931_0423457_309_818 168
105 3300035692 Ga0373935_0037258 Ga0373935_0037258_877_1383 168
106 3300035692 Ga0373935_0609117 Ga0373935_0609117_274_780 168
107 3300036401 Ga0373937_0503093 Ga0373937_0503093_37_549 168
108 3300037312 Ga0395899_0011808 Ga0395899_0011808_5540_6046 168
109 3300037312 Ga0395899_0035372 Ga0395899_0035372_2342_2848 168
110 3300037312 Ga0395899_0058893 Ga0395899_0058893_1575_2084 168
111 3300037312 Ga0395899_0117590 Ga0395899_0117590_1047_1553 168
112 3300037312 Ga0395899_0180131 Ga0395899_0180131_413_919 168
113 3300037312 Ga0395899_0215326 Ga0395899_0215326_613_1122 168
114 3300037312 Ga0395899_0522238 Ga0395899_0522238_187_696 168
115 3300037312 Ga0395899_0598600 Ga0395899_0598600_87_596 168
116 3300037418 Ga0395900_0006475 Ga0395900_0006475_2343_2849 168
117 3300037418 Ga0395900_0030359 Ga0395900_0030359_1234_1743 168
118 3300037418 Ga0395900_0032016 Ga0395900_0032016_2121_2633 168
119 3300037418 Ga0395900_0040195 Ga0395900_0040195_1262_1771 168
120 3300037418 Ga0395900_0045721 Ga0395900_0045721_1115_1624 168
121 3300037418 Ga0395900_0093709 Ga0395900_0093709_1318_1824 168
122 3300037418 Ga0395900_0111654 Ga0395900_0111654_1327_1836 168
123 3300037418 Ga0395900_0265919 Ga0395900_0265919_393_902 168
124 3300037418 Ga0395900_0331645 Ga0395900_0331645_848_1357 168
125 3300037418 Ga0395900_0640088 Ga0395900_0640088_332_841 168
126 3300037418 Ga0395900_0900505 Ga0395900_0900505_45_554 168
127 3300037418 Ga0395900_1062854 Ga0395900_1062854_147_656 168
128 3300037466 Ga0395898_0003650 Ga0395898_0003650_9357_9863 168
129 3300037466 Ga0395898_0018010 Ga0395898_0018010_697_1203 168
130 3300037466 Ga0395898_0043986 Ga0395898_0043986_3821_4330 168
131 3300037466 Ga0395898_0061347 Ga0395898_0061347_2697_3209 168
132 3300037466 Ga0395898_0078323 Ga0395898_0078323_64_573 168
133 3300037466 Ga0395898_0088253 Ga0395898_0088253_358_864 168
134 3300037466 Ga0395898_0092461 Ga0395898_0092461_249_758 168
135 3300037466 Ga0395898_0105340 Ga0395898_0105340_2020_2529 168
136 3300037466 Ga0395898_0107391 Ga0395898_0107391_600_1109 168
137 3300037466 Ga0395898_0358659 Ga0395898_0358659_554_1060 168
138 3300037466 Ga0395898_0566328 Ga0395898_0566328_413_922 168
139 3300037466 Ga0395898_0681133 Ga0395898_0681133_261_767 168
140 3300037466 Ga0395898_0684857 Ga0395898_0684857_19_540 168
141 3300037466 Ga0395898_0971409 Ga0395898_0971409_150_659 168
142 3300037471 Ga0395905_0008553 Ga0395905_0008553_1112_1621 168
143 3300037471 Ga0395905_0012459 Ga0395905_0012459_2151_2657 168
144 3300037471 Ga0395905_0035480 Ga0395905_0035480_2636_3145 168
145 3300037471 Ga0395905_0078907 Ga0395905_0078907_788_1294 168
146 3300037471 Ga0395905_0094670 Ga0395905_0094670_628_1140 168
147 3300037471 Ga0395905_0140303 Ga0395905_0140303_1656_2165 168
148 3300037471 Ga0395905_0244505 Ga0395905_0244505_980_1489 168
149 3300037471 Ga0395905_0375005 Ga0395905_0375005_170_679 168
150 3300037471 Ga0395905_0421448 Ga0395905_0421448_507_1016 168
151 3300037471 Ga0395905_0708519 Ga0395905_0708519_234_743 168
152 3300038443 Ga0395901_0005827 Ga0395901_0005827_8858_9367 168
153 3300038443 Ga0395901_0005881 Ga0395901_0005881_9500_10012 168
154 3300038443 Ga0395901_0027466 Ga0395901_0027466_2923_3429 168
155 3300038443 Ga0395901_0035270 Ga0395901_0035270_3896_4402 168
156 3300038443 Ga0395901_0041044 Ga0395901_0041044_2900_3421 168
157 3300038443 Ga0395901_0041439 Ga0395901_0041439_3864_4373 168
158 3300038443 Ga0395901_0084476 Ga0395901_0084476_171_680 168
159 3300038443 Ga0395901_0102237 Ga0395901_0102237_1533_2042 168
160 3300038443 Ga0395901_0110260 Ga0395901_0110260_2289_2798 168
161 3300038443 Ga0395901_0132814 Ga0395901_0132814_546_1055 168
162 3300038443 Ga0395901_0146629 Ga0395901_0146629_350_859 168
163 3300038443 Ga0395901_0200592 Ga0395901_0200592_894_1403 168
164 3300038443 Ga0395901_0282538 Ga0395901_0282538_600_1109 168
165 3300038443 Ga0395901_0325290 Ga0395901_0325290_345_854 168
166 3300038443 Ga0395901_0336413 Ga0395901_0336413_620_1126 168
167 3300038443 Ga0395901_0355770 Ga0395901_0355770_616_1125 168
168 3300038443 Ga0395901_0444607 Ga0395901_0444607_628_1134 168
169 3300038443 Ga0395901_0719423 Ga0395901_0719423_351_860 168
170 3300038443 Ga0395901_1089366 Ga0395901_1089366_23_532 168
171 3300038443 Ga0395901_1425698 Ga0395901_1425698_16_522 168
172 3300041413 Ga0439465_0162543 Ga0439465_0162543_161_670 168
173 3300041458 Ga0451798_0367662 Ga0451798_0367662_162_671 168
174 3300041459 Ga0451800_0309182 Ga0451800_0309182_146_682 168
175 3300041459 Ga0451800_1626058 Ga0451800_1626058_129_635 168
176 3300041460 Ga0451802_0348378 Ga0451802_0348378_161_667 168
177 3300041486 Ga0451807_1147492 Ga0451807_1147492_170_676 168
178 3300041496 Ga0451839_0299970 Ga0451839_0299970_411_920 168
179 3300042157 Ga0439458_0151697 Ga0439458_0151697_56_568 168
180 3300045051 Ga0451576_1452544 Ga0451576_1452544_111_623 168
181 3300046454 Ga0495592_0163328 Ga0495592_0163328_14_526 168
182 3300046457 Ga0495590_0050247 Ga0495590_0050247_279_785 168
183 3300046463 Ga0495653_0249972 Ga0495653_0249972_87_599 168
184 3300046473 Ga0495582_0058707 Ga0495582_0058707_1583_2089 168
185 3300046474 Ga0495605_0012302 Ga0495605_0012302_3576_4082 168
186 3300046491 Ga0495584_0013343 Ga0495584_0013343_305_811 168
187 3300046491 Ga0495584_0148557 Ga0495584_0148557_19_531 168
188 3300046491 Ga0495584_0279827 Ga0495584_0279827_23_529 168
189 3300046500 Ga0495596_0023028 Ga0495596_0023028_1099_1605 168
190 3300046506 Ga0495583_0334120 Ga0495583_0334120_13_522 168
191 3300046516 Ga0495628_0448670 Ga0495628_0448670_354_866 168
192 3300046518 Ga0495631_0141820 Ga0495631_0141820_426_932 168
193 3300046520 Ga0495637_0215788 Ga0495637_0215788_160_666 168
194 3300046524 Ga0495648_0357764 Ga0495648_0357764_88_594 168
195 3300046525 Ga0495663_0018762 Ga0495663_0018762_1016_1522 168
196 3300046531 Ga0495665_0013584 Ga0495665_0013584_49_555 168
197 3300046535 Ga0495586_0338230 Ga0495586_0338230_29_541 168
198 3300046538 Ga0495609_0046213 Ga0495609_0046213_789_1295 168
199 3300046558 Ga0495633_0256390 Ga0495633_0256390_68_580 168
200 3300046615 Ga0495656_0116319 Ga0495656_0116319_594_1100 168
201 3300046616 Ga0495668_0369641 Ga0495668_0369641_27_533 168
202 3300046664 Ga0495659_0129154 Ga0495659_0129154_393_899 168
203 3300046664 Ga0495659_0146180 Ga0495659_0146180_19_531 168
204 3300046664 Ga0495659_0178074 Ga0495659_0178074_29_535 168
205 3300046675 Ga0495657_0651555 Ga0495657_0651555_37_549 168
206 3300046681 Ga0495647_0034383 Ga0495647_0034383_440_946 168
207 3300046683 Ga0495658_0216546 Ga0495658_0216546_171_677 168
208 3300046689 Ga0495613_0042045 Ga0495613_0042045_1444_1950 168
209 3300046689 Ga0495613_0113634 Ga0495613_0113634_116_625 168
210 3300046690 Ga0495624_0234764 Ga0495624_0234764_262_768 168
211 3300046691 Ga0495670_0104912 Ga0495670_0104912_266_778 168
212 3300046691 Ga0495670_0185407 Ga0495670_0185407_516_1025 168
213 3300046692 Ga0495671_0107570 Ga0495671_0107570_319_825 168
214 3300046794 Ga0495589_0116292 Ga0495589_0116292_104_610 168
215 3300046794 Ga0495589_0296629 Ga0495589_0296629_65_571 168
216 3300047315 Ga0495581_0016211 Ga0495581_0016211_2470_2976 168
217 3300047319 Ga0495674_0510004 Ga0495674_0510004_251_763 168
218 3300047321 Ga0495676_0062180 Ga0495676_0062180_1044_1550 168
219 3300047321 Ga0495676_0338130 Ga0495676_0338130_87_593 168
220 3300047322 Ga0495680_0271750 Ga0495680_0271750_173_685 168
221 3300047445 Ga0495677_0148603 Ga0495677_0148603_235_741 168
222 3300047447 Ga0495685_106905 Ga0495685_106905_282_791 168
223 3300048903 Ga0496100_0021956 Ga0496100_0021956_1276_1785 168
224 3300048903 Ga0496100_0466095 Ga0496100_0466095_107_619 168
225 3300048903 Ga0496100_0468459 Ga0496100_0468459_327_839 168
226 3300048903 Ga0496100_0882692 Ga0496100_0882692_50_556 168
227 3300048904 Ga0496101_0085691 Ga0496101_0085691_977_1486 168
228 3300048904 Ga0496101_0356983 Ga0496101_0356983_260_766 168
229 3300048905 Ga0496102_0626646 Ga0496102_0626646_306_815 168
230 3300048906 Ga0496103_0330103 Ga0496103_0330103_220_729 168
231 3300048907 Ga0496104_0030453 Ga0496104_0030453_371_880 168
232 3300048908 Ga0496105_1037549 Ga0496105_1037549_68_577 168
233 3300048910 Ga0496107_0170625 Ga0496107_0170625_489_998 168
234 3300048910 Ga0496107_0347031 Ga0496107_0347031_300_809 168
235 3300048910 Ga0496107_0795435 Ga0496107_0795435_75_584 168
236 3300048911 Ga0496108_0013076 Ga0496108_0013076_4950_5459 168
237 3300048911 Ga0496108_0040119 Ga0496108_0040119_3269_3775 168
238 3300048911 Ga0496108_0548482 Ga0496108_0548482_138_647 168
239 3300048911 Ga0496108_0594054 Ga0496108_0594054_152_664 168
240 3300048911 Ga0496108_1149847 Ga0496108_1149847_26_538 168
241 3300048912 Ga0496109_0005595 Ga0496109_0005595_5660_6169 168
242 3300048912 Ga0496109_0133748 Ga0496109_0133748_908_1414 168
243 3300048912 Ga0496109_0269416 Ga0496109_0269416_308_817 168
244 3300048912 Ga0496109_0375793 Ga0496109_0375793_207_719 168
245 3300048912 Ga0496109_0514002 Ga0496109_0514002_227_739 168
246 3300048912 Ga0496109_0918937 Ga0496109_0918937_215_727 168
247 3300048913 Ga0496110_0257083 Ga0496110_0257083_16_522 168
248 3300048913 Ga0496110_0292627 Ga0496110_0292627_936_1445 168
249 3300048913 Ga0496110_0810613 Ga0496110_0810613_198_710 168
250 3300048914 Ga0496111_0009805 Ga0496111_0009805_1182_1691 168
251 3300048915 Ga0496112_0021206 Ga0496112_0021206_3071_3580 168
252 3300048916 Ga0496113_0025658 Ga0496113_0025658_914_1423 168
253 3300049575 Ga0501039_0202516 Ga0501039_0202516_937_1443 168
254 3300049576 Ga0501040_0835946 Ga0501040_0835946_92_601 168
255 3300049587 Ga0501071_0225370 Ga0501071_0225370_194_700 168
256 3300049591 Ga0501075_0335686 Ga0501075_0335686_251_760 168
257 3300049592 Ga0501076_1412009 Ga0501076_1412009_49_555 168
258 3300049741 Ga0501079_0390819 Ga0501079_0390819_102_617 168
259 3300049824 Ga0501045_0551222 Ga0501045_0551222_311_817 168
260 3300050491 nmdc:mga00v17_943267_c1 nmdc:mga00v17_943267_c1_12_518 168
261 3300050507 nmdc:mga05p37_26418_c1 nmdc:mga05p37_26418_c1_1260_1769 168
262 3300050507 nmdc:mga05p37_48886_c1 nmdc:mga05p37_48886_c1_4082_4591 168
263 3300050508 nmdc:mga09592_116106_c1 nmdc:mga09592_116106_c1_121_627 168
264 3300050510 nmdc:mga06r32_222176_c1 nmdc:mga06r32_222176_c1_151_657 168
265 3300050510 nmdc:mga06r32_309422_c1 nmdc:mga06r32_309422_c1_758_1279 168
266 3300050511 nmdc:mga08y16_101950_c1 nmdc:mga08y16_101950_c1_650_1159 168
267 3300050511 nmdc:mga08y16_290702_c1 nmdc:mga08y16_290702_c1_373_882 168
268 3300050511 nmdc:mga08y16_440167_c1 nmdc:mga08y16_440167_c1_507_1013 168
269 3300050512 nmdc:mga0n895_371720_c1 nmdc:mga0n895_371720_c1_847_1401 168
270 3300050512 nmdc:mga0n895_602943_c1 nmdc:mga0n895_602943_c1_120_626 168
271 3300050514 nmdc:mga08x19_91640_c1 nmdc:mga08x19_91640_c1_739_1248 168
272 3300050515 nmdc:mga0a205_520854_c1 nmdc:mga0a205_520854_c1_482_988 168
273 3300050515 nmdc:mga0a205_553053_c1 nmdc:mga0a205_553053_c1_471_977 168
274 3300053077 Ga0495601_0146803 Ga0495601_0146803_427_933 168
275 3300054114 Ga0501084_0611525 Ga0501084_0611525_229_744 168
276 3300054114 Ga0501084_1197555 Ga0501084_1197555_27_536 168
277 3300061734 Ga0530510_0230270 Ga0530510_0230270_66_575 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02620

YceD

Large ribosomal RNA subunit accumulation protein YceD

76

185

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ft1-assembly1.cif.gz_E crystal structure of gp37(dip) from bacteriophage phikz bound to rnase e of pseudomonas aeruginosa 0.6328 39 93
6hxv-assembly1.cif.gz_A crystal structure of the head and coiled-coil domains of zebrafish ccdc61 (f129e/d130a) 0.5682 11 65
6wxu-assembly1.cif.gz_D cryoem structure of mouse duox1-duoxa1 complex in the dimer-of-dimer state 0.5422 16 81
4z3t-assembly2.cif.gz_B meningococcal factor h binding protein mutant l130r/g133d 0.5184 11 89
2kc0-assembly1.cif.gz_A solution structure of the factor h binding protein 0.5008 10 103
ID Description Score Start End Superfamily
af_A0A1I9LSP3_82_195_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7899 46 90 3.10.450.50
af_Q2FWQ7_1_86_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.708 9 59 3.10.110.10
af_Q4DDJ2_1_218_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6493 48 92 3.40.50.720
3zgiC00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6375 10 61 2.60.40.3400
af_H2KYK6_139_269_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.5487 2 61 2.60.210.10
ID Description Score Start End GO Terms
AF-A0A660L4X5-F1-model_v4 DUF177 domain-containing protein 0.9303 3 164
AF-A0A6J6A020-F1-model_v4 Unannotated protein 0.9259 3 164
AF-A0A1M3BNU7-F1-model_v4 Metal-binding protein 0.9137 2 162
AF-A0A537ZSA6-F1-model_v4 EamA domain-containing protein 0.9106 1 168 GO:0016020
AF-A0A537ZSA6-F1-model_v4 EamA domain-containing protein 0.9054 1 168 GO:0016020

Feature Viewer

pLDDT pTM Quality
90.88 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map