F381430

General Info

Members Datasets Scaffolds Average Seq Length
276 176 552 178

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_529229_c1|nmdc:mga06r32_529229_c1_228_878
Length 216
Sequence LLVGVDRRAFHPIEAMRGRSGHVTVDASRDQGDGAMAIGPVQLIVLGFEHPEFHGEIIAELERLKESDTVRVIDALAVHKDADGEIEVMHLSNLSKDEAIELGSKVGALIGLGIEGEEGMDAGAAAGAEAATDGVSVFSDEEAWDVVEDIPNDSAAALILLEHHWAVPLRDAIARARGFRISDGFISPLDLVEIGLVSSEDAEALHALETSRRAPA

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
51 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
52 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
53 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
119 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 2.54
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.71
Rhizosphere 93.48
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_529229_c1 3300050510 Bacteria 1154
2 JGI24745J21846_1027526 3300002073 Bacteria 680
3 JGI25404J52841_10009959 3300003659 Bacteria 2039
4 Ga0058859_11762618 3300004798 Bacteria 775
5 Ga0058863_11699003 3300004799 Bacteria 798
6 Ga0058860_10023782 3300004801 Bacteria 645
7 Ga0058860_12173723 3300004801 Bacteria 837
8 Ga0070683_100790029 3300005329 Bacteria 910
9 Ga0070683_100947287 3300005329 Bacteria 826
10 Ga0068868_100057713 3300005338 Bacteria 3067
11 Ga0070691_10346511 3300005341 Bacteria 824
12 Ga0070692_10265503 3300005345 Bacteria 1034
13 Ga0070668_100098063 3300005347 Bacteria 2319
14 Ga0070659_100152011 3300005366 Bacteria 1889
15 Ga0070659_100288431 3300005366 Bacteria 1366
16 Ga0070659_100692770 3300005366 Bacteria 881
17 Ga0070703_10160698 3300005406 Bacteria 852
18 Ga0070709_10353186 3300005434 Bacteria 1087
19 Ga0070714_100249867 3300005435 Bacteria 1639
20 Ga0070711_100137799 3300005439 Bacteria 1826
21 Ga0070711_100620385 3300005439 Bacteria 904
22 Ga0070700_100013996 3300005441 Bacteria 4521
23 Ga0070663_100426136 3300005455 Bacteria 1089
24 Ga0070662_100250548 3300005457 Bacteria 1423
25 Ga0070685_10066055 3300005466 Bacteria 2130
26 Ga0070707_100146581 3300005468 Bacteria 2298
27 Ga0070684_100913712 3300005535 Bacteria 823
28 Ga0070696_100127748 3300005546 Bacteria 1846
29 Ga0070665_100863350 3300005548 Bacteria 918
30 Ga0068857_100453114 3300005577 Bacteria 1200
31 Ga0068854_100190045 3300005578 Bacteria 1608
32 Ga0068854_100922504 3300005578 Bacteria 769
33 Ga0068856_100834318 3300005614 Bacteria 941
34 Ga0070702_100344064 3300005615 Bacteria 1048
35 Ga0068852_100209497 3300005616 Bacteria 1848
36 Ga0068852_100652201 3300005616 Bacteria 1060
37 Ga0068864_100513776 3300005618 Bacteria 1154
38 Ga0068864_100588108 3300005618 Bacteria 1079
39 Ga0068861_100045626 3300005719 Bacteria 3301
40 Ga0068858_100053594 3300005842 Bacteria 3731
41 Ga0068860_100158891 3300005843 Bacteria 2179
42 Ga0068862_100269759 3300005844 Bacteria 1556
43 Ga0081455_10070038 3300005937 Bacteria 2913
44 Ga0081455_10485614 3300005937 Bacteria 834
45 Ga0081538_10001956 3300005981 Bacteria 20633
46 Ga0070717_10321990 3300006028 Bacteria 1378
47 Ga0070717_10331349 3300006028 Bacteria 1358
48 Ga0070715_10073277 3300006163 Bacteria 1535
49 Ga0070712_100292812 3300006175 Bacteria 1315
50 Ga0075431_100526571 3300006847 Bacteria 1171
51 Ga0075433_11008650 3300006852 Bacteria 725
52 Ga0111539_10245309 3300009094 Bacteria 2085
53 Ga0111539_10364107 3300009094 Bacteria 1683
54 Ga0105245_10008057 3300009098 Bacteria 9211
55 Ga0105245_10023062 3300009098 Bacteria 5462
56 Ga0105245_10137753 3300009098 Bacteria 2295
57 Ga0105245_10486572 3300009098 Bacteria 1248
58 Ga0105245_10535554 3300009098 Bacteria 1191
59 Ga0114129_12202786 3300009147 Bacteria 663
60 Ga0105243_11878481 3300009148 Bacteria 631
61 Ga0105242_10298687 3300009176 Bacteria 1469
62 Ga0105237_10632949 3300009545 Bacteria 1077
63 Ga0105238_10839674 3300009551 Bacteria 935
64 Ga0105238_11288024 3300009551 Bacteria 757
65 Ga0105249_10045415 3300009553 Bacteria 3995
66 Ga0157329_1006467 3300012491 Bacteria 827
67 Ga0157335_1007303 3300012492 Bacteria 822
68 Ga0157319_1005074 3300012497 Bacteria 891
69 Ga0157347_1014231 3300012502 Bacteria 876
70 Ga0157371_10193419 3300013102 Bacteria 1457
71 Ga0157374_10919379 3300013296 Bacteria 893
72 Ga0157378_10687296 3300013297 Bacteria 1042
73 Ga0163162_10417756 3300013306 Bacteria 1473
74 Ga0157372_10234883 3300013307 Bacteria 2126
75 Ga0157375_10239312 3300013308 Bacteria 1975
76 Ga0157375_10777489 3300013308 Bacteria 1107
77 Ga0163163_11388195 3300014325 Bacteria 764
78 Ga0157379_10076823 3300014968 Bacteria 2990
79 Ga0157379_10684462 3300014968 Bacteria 962
80 Ga0163161_10038195 3300017792 Bacteria 3443
81 Ga0197907_11235679 3300020069 Bacteria 1052
82 Ga0206350_10057929 3300020080 Bacteria 777
83 Ga0224712_10235760 3300022467 Bacteria 841
84 Ga0207692_10007479 3300025898 Bacteria 4479
85 Ga0207692_10147264 3300025898 Bacteria 1345
86 Ga0207688_10184945 3300025901 Bacteria 1244
87 Ga0207647_10228753 3300025904 Bacteria 1070
88 Ga0207685_10029502 3300025905 Bacteria 1942
89 Ga0207699_10002730 3300025906 Bacteria 8349
90 Ga0207699_10293473 3300025906 Bacteria 1133
91 Ga0207699_10522420 3300025906 Bacteria 859
92 Ga0207684_10511465 3300025910 Bacteria 1029
93 Ga0207693_10002805 3300025915 Bacteria 15103
94 Ga0207693_10201453 3300025915 Bacteria 1565
95 Ga0207693_10380932 3300025915 Bacteria 1103
96 Ga0207663_10010102 3300025916 Bacteria 5008
97 Ga0207663_10077408 3300025916 Bacteria 2165
98 Ga0207681_10531806 3300025923 Bacteria 966
99 Ga0207687_10034464 3300025927 Bacteria 3437
100 Ga0207687_10174090 3300025927 Bacteria 1662
101 Ga0207700_10005830 3300025928 Bacteria 7401
102 Ga0207664_10009175 3300025929 Bacteria 6933
103 Ga0207664_10183777 3300025929 Bacteria 1796
104 Ga0207664_10276709 3300025929 Bacteria 1472
105 Ga0207665_10003479 3300025939 Bacteria 10518
106 Ga0207689_10378287 3300025942 Bacteria 1179
107 Ga0207661_10923648 3300025944 Bacteria 804
108 Ga0207712_10019567 3300025961 Bacteria 4424
109 Ga0207640_10156846 3300025981 Bacteria 1679
110 Ga0207640_10333871 3300025981 Bacteria 1212
111 Ga0207703_10172916 3300026035 Bacteria 1901
112 Ga0207641_10350785 3300026088 Bacteria 1406
113 Ga0207648_11630843 3300026089 Bacteria 606
114 Ga0207675_100003519 3300026118 Bacteria 15286
115 Ga0207683_10189676 3300026121 Bacteria 1866
116 Ga0207698_10096878 3300026142 Bacteria 2432
117 Ga0207698_10324135 3300026142 Bacteria 1444
118 Ga0207428_10281918 3300027907 Bacteria 1233
119 Ga0268266_11266106 3300028379 Bacteria 713
120 Ga0268264_10186250 3300028381 Bacteria 1889
121 Ga0307405_10545368 3300031731 Bacteria 937
122 Ga0307409_100037635 3300031995 Bacteria 3569
123 Ga0307416_101384222 3300032002 Bacteria 809
124 Ga0307415_100019767 3300032126 Bacteria 4096
125 Ga0373926_0063316 3300035083 Bacteria 1350
126 Ga0373928_0143022 3300035084 Bacteria 657
127 Ga0373934_0000153 3300035086 Bacteria 25139
128 Ga0373936_0147062 3300035113 Bacteria 1020
129 Ga0373953_0000034 3300035117 Bacteria 35875
130 Ga0373954_0001628 3300035118 Bacteria 9187
131 Ga0373954_0200008 3300035118 Bacteria 982
132 Ga0373956_0000760 3300035119 Bacteria 13353
133 Ga0373956_0251155 3300035119 Bacteria 841
134 Ga0373957_0000023 3300035120 Bacteria 39727
135 Ga0373946_0190128 3300035171 Bacteria 979
136 Ga0373955_0000677 3300035172 Bacteria 14561
137 Ga0373955_0607668 3300035172 Bacteria 670
138 Ga0373924_0010719 3300035410 Bacteria 3390
139 Ga0373935_0148212 3300035692 Bacteria 1590
140 Ga0373927_0207908 3300035695 Bacteria 1285
141 Ga0373933_0000284 3300035724 Bacteria 32713
142 Ga0373933_0226705 3300035724 Bacteria 1199
143 Ga0373947_0041197 3300035725 Bacteria 2753
144 Ga0373937_0000163 3300036401 Bacteria 64367
145 Ga0373937_0181881 3300036401 Bacteria 1974
146 Ga0373937_0343261 3300036401 Bacteria 1414
147 Ga0373937_0725740 3300036401 Bacteria 941
148 Ga0373925_0006679 3300037068 Bacteria 8461
149 Ga0395900_0013861 3300037418 Bacteria 8227
150 Ga0395900_0346733 3300037418 Bacteria 1459
151 Ga0395898_0137996 3300037466 Bacteria 2335
152 Ga0395898_0428133 3300037466 Bacteria 1261
153 Ga0395905_0589687 3300037471 Bacteria 1013
154 Ga0436363_0923762 3300039450 Bacteria 1443
155 Ga0495592_0000043 3300046454 Bacteria 122354
156 Ga0495592_0187609 3300046454 Bacteria 1403
157 Ga0495592_0232759 3300046454 Bacteria 1226
158 Ga0495592_0325552 3300046454 Bacteria 992
159 Ga0495590_0216630 3300046457 Unclassified 707
160 Ga0495591_123118 3300046458 Bacteria 632
161 Ga0495651_0000138 3300046462 Bacteria 54067
162 Ga0495651_0013417 3300046462 Bacteria 6336
163 Ga0495651_0344795 3300046462 Bacteria 986
164 Ga0495653_0114014 3300046463 Bacteria 1937
165 Ga0495653_0489785 3300046463 Unclassified 768
166 Ga0495580_0175753 3300046472 Bacteria 1479
167 Ga0495582_0031146 3300046473 Bacteria 2931
168 Ga0495605_0191159 3300046474 Bacteria 896
169 Ga0495662_0012687 3300046476 Bacteria 4111
170 Ga0495664_0346768 3300046477 Bacteria 894
171 Ga0495584_0451184 3300046491 Bacteria 654
172 Ga0495608_0000016 3300046511 Bacteria 196738
173 Ga0495608_0379729 3300046511 Bacteria 866
174 Ga0495608_0481923 3300046511 Bacteria 752
175 Ga0495616_0273408 3300046513 Bacteria 720
176 Ga0495618_0485259 3300046514 Bacteria 746
177 Ga0495628_0000034 3300046516 Bacteria 115264
178 Ga0495628_0072082 3300046516 Bacteria 2692
179 Ga0495628_0241751 3300046516 Bacteria 1350
180 Ga0495644_0063859 3300046523 Unclassified 1384
181 Ga0495644_0111741 3300046523 Bacteria 1037
182 Ga0495663_0046895 3300046525 Bacteria 1329
183 Ga0495666_0171666 3300046526 Bacteria 1003
184 Ga0495652_0001347 3300046529 Bacteria 27374
185 Ga0495652_0018506 3300046529 Bacteria 6210
186 Ga0495652_0103447 3300046529 Bacteria 2305
187 Ga0495652_0121339 3300046529 Bacteria 2084
188 Ga0495652_0158941 3300046529 Bacteria 1757
189 Ga0495640_0122369 3300046533 Bacteria 1690
190 Ga0495587_0000044 3300046536 Bacteria 108443
191 Ga0495587_0134386 3300046536 Bacteria 1413
192 Ga0495587_0243152 3300046536 Bacteria 1012
193 Ga0495609_0129188 3300046538 Bacteria 1083
194 Ga0495667_0000052 3300046559 Bacteria 108432
195 Ga0495667_0045755 3300046559 Bacteria 2896
196 Ga0495667_0046023 3300046559 Bacteria 2886
197 Ga0495667_0126622 3300046559 Bacteria 1648
198 Ga0495667_0360904 3300046559 Bacteria 917
199 Ga0495634_0024333 3300046642 Bacteria 4248
200 Ga0495634_0057175 3300046642 Bacteria 2605
201 Ga0495635_0200646 3300046663 Bacteria 1353
202 Ga0495635_0326967 3300046663 Bacteria 1026
203 Ga0495659_0088099 3300046664 Bacteria 1188
204 Ga0495657_0000015 3300046675 Bacteria 187657
205 Ga0495657_0010213 3300046675 Bacteria 7069
206 Ga0495657_0065920 3300046675 Bacteria 2380
207 Ga0495657_0076914 3300046675 Bacteria 2167
208 Ga0495657_0599199 3300046675 Bacteria 638
209 Ga0495599_0000035 3300046678 Bacteria 103981
210 Ga0495599_0014526 3300046678 Bacteria 4876
211 Ga0495599_0085384 3300046678 Bacteria 1971
212 Ga0495623_0001173 3300046679 Bacteria 17776
213 Ga0495623_0061194 3300046679 Bacteria 2361
214 Ga0495646_0037409 3300046680 Bacteria 3002
215 Ga0495646_0062583 3300046680 Bacteria 2212
216 Ga0495646_0079905 3300046680 Bacteria 1908
217 Ga0495646_0105006 3300046680 Bacteria 1615
218 Ga0495658_0179273 3300046683 Bacteria 1314
219 Ga0495658_0366914 3300046683 Unclassified 916
220 Ga0495658_0554112 3300046683 Bacteria 736
221 Ga0495670_0062634 3300046691 Bacteria 1872
222 Ga0495670_0294781 3300046691 Unclassified 869
223 Ga0495600_0001224 3300046809 Bacteria 14068
224 Ga0495600_0094134 3300046809 Bacteria 1954
225 Ga0495600_0367274 3300046809 Bacteria 899
226 Ga0495581_0001545 3300047315 Bacteria 12848
227 Ga0495604_0000048 3300047317 Bacteria 108810
228 Ga0495604_0041106 3300047317 Bacteria 3627
229 Ga0495674_0217028 3300047319 Bacteria 1582
230 Ga0495674_0242575 3300047319 Bacteria 1485
231 Ga0495680_0000069 3300047322 Bacteria 88766
232 Ga0495680_0020090 3300047322 Bacteria 5628
233 Ga0495680_0029437 3300047322 Bacteria 4497
234 Ga0495680_0044428 3300047322 Bacteria 3513
235 Ga0495680_0168350 3300047322 Bacteria 1587
236 Ga0495680_0173419 3300047322 Bacteria 1560
237 Ga0495675_0034097 3300047444 Bacteria 3248
238 Ga0495684_0025246 3300047471 Bacteria 4569
239 Ga0495684_0347670 3300047471 Bacteria 1053
240 Ga0495684_0387335 3300047471 Bacteria 984
241 Ga0495593_0017744 3300047673 Bacteria 4007
242 Ga0495593_0047329 3300047673 Bacteria 2288
243 Ga0495602_0000200 3300048088 Bacteria 55719
244 Ga0495602_0045581 3300048088 Bacteria 3967
245 Ga0495602_0068548 3300048088 Bacteria 3045
246 Ga0495602_0243274 3300048088 Bacteria 1345
247 Ga0496100_0049279 3300048903 Bacteria 2723
248 Ga0496101_0012201 3300048904 Bacteria 5729
249 Ga0496102_0027033 3300048905 Bacteria 5124
250 Ga0496102_0096919 3300048905 Bacteria 2735
251 Ga0496102_0248865 3300048905 Bacteria 1676
252 Ga0496106_0011721 3300048909 Bacteria 6472
253 Ga0496106_0045447 3300048909 Bacteria 3298
254 Ga0496107_0012399 3300048910 Bacteria 5949
255 Ga0496108_1140731 3300048911 Bacteria 661
256 Ga0496111_0456295 3300048914 Bacteria 943
257 Ga0496114_0212625 3300048917 Bacteria 1696
258 Ga0496114_0285811 3300048917 Bacteria 1455
259 Ga0496115_0009489 3300048918 Bacteria 7228
260 Ga0501075_0114777 3300049591 Bacteria 2048
261 Ga0501075_0600999 3300049591 Bacteria 839
262 Ga0501076_0243242 3300049592 Bacteria 1472
263 Ga0501076_0921540 3300049592 Bacteria 720
264 nmdc:mga08y16_109774_c1 3300050511 Bacteria 2872
265 nmdc:mga08y16_391700_c1 3300050511 Bacteria 1423
266 nmdc:mga0a205_849044_c1 3300050515 Bacteria 760
267 Ga0495601_0045837 3300053077 Bacteria 2751
268 Ga0495612_0165537 3300053078 Bacteria 967
269 Ga0495655_0146545 3300053083 Bacteria 739
270 Ga0495595_0001990 3300053084 Bacteria 7951
271 Ga0495595_0253984 3300053084 Bacteria 880
272 Ga0495595_0262438 3300053084 Bacteria 866
273 Ga0495619_0304313 3300053085 Bacteria 1104
274 Ga0495619_0356370 3300053085 Bacteria 1012
275 Ga0495619_0371285 3300053085 Bacteria 989
276 3003006403 3002998708 Bacteria 11715108
277 nmdc:mga06r32_529229_c1
278 JGI24745J21846_1027526
279 JGI25404J52841_10009959
280 Ga0058859_11762618
281 Ga0058863_11699003
282 Ga0058860_10023782
283 Ga0058860_12173723
284 Ga0070683_100790029
285 Ga0070683_100947287
286 Ga0068868_100057713
287 Ga0070691_10346511
288 Ga0070692_10265503
289 Ga0070668_100098063
290 Ga0070659_100152011
291 Ga0070659_100288431
292 Ga0070659_100692770
293 Ga0070703_10160698
294 Ga0070709_10353186
295 Ga0070714_100249867
296 Ga0070711_100137799
297 Ga0070711_100620385
298 Ga0070700_100013996
299 Ga0070663_100426136
300 Ga0070662_100250548
301 Ga0070685_10066055
302 Ga0070707_100146581
303 Ga0070684_100913712
304 Ga0070696_100127748
305 Ga0070665_100863350
306 Ga0068857_100453114
307 Ga0068854_100190045
308 Ga0068854_100922504
309 Ga0068856_100834318
310 Ga0070702_100344064
311 Ga0068852_100209497
312 Ga0068852_100652201
313 Ga0068864_100513776
314 Ga0068864_100588108
315 Ga0068861_100045626
316 Ga0068858_100053594
317 Ga0068860_100158891
318 Ga0068862_100269759
319 Ga0081455_10070038
320 Ga0081455_10485614
321 Ga0081538_10001956
322 Ga0070717_10321990
323 Ga0070717_10331349
324 Ga0070715_10073277
325 Ga0070712_100292812
326 Ga0075431_100526571
327 Ga0075433_11008650
328 Ga0111539_10245309
329 Ga0111539_10364107
330 Ga0105245_10008057
331 Ga0105245_10023062
332 Ga0105245_10137753
333 Ga0105245_10486572
334 Ga0105245_10535554
335 Ga0114129_12202786
336 Ga0105243_11878481
337 Ga0105242_10298687
338 Ga0105237_10632949
339 Ga0105238_10839674
340 Ga0105238_11288024
341 Ga0105249_10045415
342 Ga0157329_1006467
343 Ga0157335_1007303
344 Ga0157319_1005074
345 Ga0157347_1014231
346 Ga0157371_10193419
347 Ga0157374_10919379
348 Ga0157378_10687296
349 Ga0163162_10417756
350 Ga0157372_10234883
351 Ga0157375_10239312
352 Ga0157375_10777489
353 Ga0163163_11388195
354 Ga0157379_10076823
355 Ga0157379_10684462
356 Ga0163161_10038195
357 Ga0197907_11235679
358 Ga0206350_10057929
359 Ga0224712_10235760
360 Ga0207692_10007479
361 Ga0207692_10147264
362 Ga0207688_10184945
363 Ga0207647_10228753
364 Ga0207685_10029502
365 Ga0207699_10002730
366 Ga0207699_10293473
367 Ga0207699_10522420
368 Ga0207684_10511465
369 Ga0207693_10002805
370 Ga0207693_10201453
371 Ga0207693_10380932
372 Ga0207663_10010102
373 Ga0207663_10077408
374 Ga0207681_10531806
375 Ga0207687_10034464
376 Ga0207687_10174090
377 Ga0207700_10005830
378 Ga0207664_10009175
379 Ga0207664_10183777
380 Ga0207664_10276709
381 Ga0207665_10003479
382 Ga0207689_10378287
383 Ga0207661_10923648
384 Ga0207712_10019567
385 Ga0207640_10156846
386 Ga0207640_10333871
387 Ga0207703_10172916
388 Ga0207641_10350785
389 Ga0207648_11630843
390 Ga0207675_100003519
391 Ga0207683_10189676
392 Ga0207698_10096878
393 Ga0207698_10324135
394 Ga0207428_10281918
395 Ga0268266_11266106
396 Ga0268264_10186250
397 Ga0307405_10545368
398 Ga0307409_100037635
399 Ga0307416_101384222
400 Ga0307415_100019767
401 Ga0373926_0063316
402 Ga0373928_0143022
403 Ga0373934_0000153
404 Ga0373936_0147062
405 Ga0373953_0000034
406 Ga0373954_0001628
407 Ga0373954_0200008
408 Ga0373956_0000760
409 Ga0373956_0251155
410 Ga0373957_0000023
411 Ga0373946_0190128
412 Ga0373955_0000677
413 Ga0373955_0607668
414 Ga0373924_0010719
415 Ga0373935_0148212
416 Ga0373927_0207908
417 Ga0373933_0000284
418 Ga0373933_0226705
419 Ga0373947_0041197
420 Ga0373937_0000163
421 Ga0373937_0181881
422 Ga0373937_0343261
423 Ga0373937_0725740
424 Ga0373925_0006679
425 Ga0395900_0013861
426 Ga0395900_0346733
427 Ga0395898_0137996
428 Ga0395898_0428133
429 Ga0395905_0589687
430 Ga0436363_0923762
431 Ga0495592_0000043
432 Ga0495592_0187609
433 Ga0495592_0232759
434 Ga0495592_0325552
435 Ga0495590_0216630
436 Ga0495591_123118
437 Ga0495651_0000138
438 Ga0495651_0013417
439 Ga0495651_0344795
440 Ga0495653_0114014
441 Ga0495653_0489785
442 Ga0495580_0175753
443 Ga0495582_0031146
444 Ga0495605_0191159
445 Ga0495662_0012687
446 Ga0495664_0346768
447 Ga0495584_0451184
448 Ga0495608_0000016
449 Ga0495608_0379729
450 Ga0495608_0481923
451 Ga0495616_0273408
452 Ga0495618_0485259
453 Ga0495628_0000034
454 Ga0495628_0072082
455 Ga0495628_0241751
456 Ga0495644_0063859
457 Ga0495644_0111741
458 Ga0495663_0046895
459 Ga0495666_0171666
460 Ga0495652_0001347
461 Ga0495652_0018506
462 Ga0495652_0103447
463 Ga0495652_0121339
464 Ga0495652_0158941
465 Ga0495640_0122369
466 Ga0495587_0000044
467 Ga0495587_0134386
468 Ga0495587_0243152
469 Ga0495609_0129188
470 Ga0495667_0000052
471 Ga0495667_0045755
472 Ga0495667_0046023
473 Ga0495667_0126622
474 Ga0495667_0360904
475 Ga0495634_0024333
476 Ga0495634_0057175
477 Ga0495635_0200646
478 Ga0495635_0326967
479 Ga0495659_0088099
480 Ga0495657_0000015
481 Ga0495657_0010213
482 Ga0495657_0065920
483 Ga0495657_0076914
484 Ga0495657_0599199
485 Ga0495599_0000035
486 Ga0495599_0014526
487 Ga0495599_0085384
488 Ga0495623_0001173
489 Ga0495623_0061194
490 Ga0495646_0037409
491 Ga0495646_0062583
492 Ga0495646_0079905
493 Ga0495646_0105006
494 Ga0495658_0179273
495 Ga0495658_0366914
496 Ga0495658_0554112
497 Ga0495670_0062634
498 Ga0495670_0294781
499 Ga0495600_0001224
500 Ga0495600_0094134
501 Ga0495600_0367274
502 Ga0495581_0001545
503 Ga0495604_0000048
504 Ga0495604_0041106
505 Ga0495674_0217028
506 Ga0495674_0242575
507 Ga0495680_0000069
508 Ga0495680_0020090
509 Ga0495680_0029437
510 Ga0495680_0044428
511 Ga0495680_0168350
512 Ga0495680_0173419
513 Ga0495675_0034097
514 Ga0495684_0025246
515 Ga0495684_0347670
516 Ga0495684_0387335
517 Ga0495593_0017744
518 Ga0495593_0047329
519 Ga0495602_0000200
520 Ga0495602_0045581
521 Ga0495602_0068548
522 Ga0495602_0243274
523 Ga0496100_0049279
524 Ga0496101_0012201
525 Ga0496102_0027033
526 Ga0496102_0096919
527 Ga0496102_0248865
528 Ga0496106_0011721
529 Ga0496106_0045447
530 Ga0496107_0012399
531 Ga0496108_1140731
532 Ga0496111_0456295
533 Ga0496114_0212625
534 Ga0496114_0285811
535 Ga0496115_0009489
536 Ga0501075_0114777
537 Ga0501075_0600999
538 Ga0501076_0243242
539 Ga0501076_0921540
540 nmdc:mga08y16_109774_c1
541 nmdc:mga08y16_391700_c1
542 nmdc:mga0a205_849044_c1
543 Ga0495601_0045837
544 Ga0495612_0165537
545 Ga0495655_0146545
546 Ga0495595_0001990
547 Ga0495595_0253984
548 Ga0495595_0262438
549 Ga0495619_0304313
550 Ga0495619_0356370
551 Ga0495619_0371285
552 3003006403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v43-assembly1.cif.gz_B crystal structure of the flavin oxygenase with cofactor and substrate bound involved in folate catabolism 0.7358 2 149
2ici-assembly1.cif.gz_A crystal structure of streptococcal pyrogenic exotoxin i 0.7012 37 61
2bv3-assembly1.cif.gz_A crystal structure of a mutant elongation factor g trapped with a gtp analogue 0.6834 4 151
3ooj-assembly1.cif.gz_B c1a mutant of e. coli glms in complex with glucose-6p and glutamate 0.6834 7 55
3ooj-assembly1.cif.gz_E c1a mutant of e. coli glms in complex with glucose-6p and glutamate 0.6752 7 55
ID Description Score Start End Superfamily
af_R4GEK6_29_122_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7168 36 60 2.60.40.10
af_Q80Z71_1233_1320_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6473 36 55 2.60.40.10
2wskA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.629 37 55 2.60.40.10
af_C6KSM4_846_937_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.623 4 151 3.30.70.240
af_A4I843_888_1009_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6229 4 151 3.30.70.240
ID Description Score Start End GO Terms
AF-Q021L4-F1-model_v4 Uncharacterized protein 0.787 5 154
AF-A0A3D5DQJ0-F1-model_v4 DUF1269 domain-containing protein 0.7767 1 130
AF-A0A3D5DQJ0-F1-model_v4 DUF1269 domain-containing protein 0.7663 1 130
AF-A0A5E7Z317-F1-model_v4 FAD/FMN-dependent dehydrogenase 0.7472 5 148 GO:0004458
GO:0008720
GO:0071949
GO:1903457
AF-A0A4S3TIW0-F1-model_v4 DUF1269 domain-containing protein 0.7406 6 148

Map