F381361

General Info

Members Datasets Scaffolds Average Seq Length
276 145 552 193

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0113302|Ga0496102_0113302_783_1364
Length 183
Sequence MPALPVFHATVTPVTAAQLGRSWHPGCPVGPSGLRTLTVSYVGFDGRARRGQLVVARAVTTEERFPIRRMVPIAYYGGSDDRSAAADNTTGFNCRRAVASGPPRWSAHAYGTAIDINDLENPYLLRARVIPPAGAAYRDRTHIRPGMAVPGGVLVRAFAAAGWLWGGRWAGSPDYQHFSRTGR

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.29
Metatranscriptomes 4.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.7
Rhizosphere 90.58
Stem 0
Stem Tuber 0
Unclassified 4.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0113302 3300048905 Bacteria 2530
2 Ga0070658_10229746 3300005327 Bacteria 1571
3 Ga0070683_100127248 3300005329 Bacteria 2409
4 Ga0070680_100003843 3300005336 Bacteria 11222
5 Ga0070680_100021204 3300005336 Bacteria 5162
6 Ga0070680_100046837 3300005336 Bacteria 3518
7 Ga0070680_100081897 3300005336 Bacteria 2663
8 Ga0070680_100137490 3300005336 Bacteria 2047
9 Ga0070682_100124640 3300005337 Bacteria 1735
10 Ga0070682_100253576 3300005337 Bacteria 1270
11 Ga0070660_100103916 3300005339 Bacteria 2253
12 Ga0070660_100126043 3300005339 Bacteria 2046
13 Ga0070660_100161696 3300005339 Bacteria 1804
14 Ga0070661_100018310 3300005344 Bacteria 4978
15 Ga0070661_100097183 3300005344 Bacteria 2186
16 Ga0070661_100097866 3300005344 Bacteria 2179
17 Ga0070671_100073275 3300005355 Bacteria 2860
18 Ga0070674_100125135 3300005356 Bacteria 1908
19 Ga0070659_100063115 3300005366 Bacteria 2930
20 Ga0070709_10122097 3300005434 Bacteria 1767
21 Ga0070714_100313581 3300005435 Bacteria 1465
22 Ga0070713_100848819 3300005436 Bacteria 877
23 Ga0070711_100656333 3300005439 Bacteria 880
24 Ga0070708_100051746 3300005445 Bacteria 3639
25 Ga0070678_100921855 3300005456 Bacteria 800
26 Ga0070681_10006856 3300005458 Bacteria 11085
27 Ga0070681_10016795 3300005458 Bacteria 7309
28 Ga0070681_10056218 3300005458 Bacteria 3917
29 Ga0070681_10401020 3300005458 Bacteria 1283
30 Ga0070706_100117174 3300005467 Unclassified 2481
31 Ga0070698_100432873 3300005471 Bacteria 1250
32 Ga0070679_100015519 3300005530 Bacteria 7319
33 Ga0070679_100017870 3300005530 Bacteria 6869
34 Ga0070679_100034377 3300005530 Bacteria 5023
35 Ga0070679_100062729 3300005530 Bacteria 3705
36 Ga0070679_100073395 3300005530 Bacteria 3413
37 Ga0070679_100134184 3300005530 Bacteria 2457
38 Ga0070684_100112115 3300005535 Bacteria 2446
39 Ga0068853_100031830 3300005539 Bacteria 4464
40 Ga0068853_100157335 3300005539 Bacteria 2048
41 Ga0070686_100515499 3300005544 Bacteria 930
42 Ga0070696_100218919 3300005546 Bacteria 1428
43 Ga0070693_100256678 3300005547 Bacteria 1161
44 Ga0070665_100406452 3300005548 Bacteria 1370
45 Ga0068855_100105906 3300005563 Bacteria 3233
46 Ga0068855_100129239 3300005563 Bacteria 2886
47 Ga0068855_100210125 3300005563 Bacteria 2187
48 Ga0068857_100108113 3300005577 Bacteria 2499
49 Ga0068857_100726595 3300005577 Bacteria 945
50 Ga0068856_100024535 3300005614 Bacteria 5870
51 Ga0068852_100176482 3300005616 Bacteria 2006
52 Ga0068852_100999496 3300005616 Bacteria 855
53 Ga0070712_100149913 3300006175 Bacteria 1789
54 Ga0105240_10011387 3300009093 Bacteria 12389
55 Ga0105240_10193872 3300009093 Bacteria 2387
56 Ga0105242_10310991 3300009176 Unclassified 1442
57 Ga0105237_10050590 3300009545 Bacteria 4175
58 Ga0105238_10029775 3300009551 Bacteria 5561
59 Ga0105238_10059492 3300009551 Bacteria 3827
60 Ga0157371_10455087 3300013102 Bacteria 941
61 Ga0157370_10040414 3300013104 Bacteria 4503
62 Ga0157370_10052262 3300013104 Bacteria 3901
63 Ga0157370_10065312 3300013104 Bacteria 3443
64 Ga0157370_10099178 3300013104 Bacteria 2731
65 Ga0157370_10859992 3300013104 Bacteria 824
66 Ga0157369_10041221 3300013105 Bacteria 5040
67 Ga0157369_10302254 3300013105 Bacteria 1664
68 Ga0157372_10045163 3300013307 Bacteria 4885
69 Ga0157372_10078339 3300013307 Bacteria 3734
70 Ga0157372_10099729 3300013307 Bacteria 3313
71 Ga0157372_10266889 3300013307 Bacteria 1988
72 Ga0157372_10373795 3300013307 Bacteria 1661
73 Ga0157372_10938231 3300013307 Bacteria 1003
74 Ga0182008_10079757 3300014497 Bacteria 1610
75 Ga0182007_10174624 3300015262 Bacteria 740
76 Ga0197907_10289060 3300020069 Bacteria 1969
77 Ga0206356_10566142 3300020070 Bacteria 2364
78 Ga0206356_10765339 3300020070 Bacteria 1728
79 Ga0206356_11335724 3300020070 Bacteria 2237
80 Ga0206356_11611098 3300020070 Bacteria 693
81 Ga0206354_10817949 3300020081 Bacteria 4578
82 Ga0206354_11040466 3300020081 Bacteria 1083
83 Ga0206354_11572152 3300020081 Bacteria 2902
84 Ga0206353_10026577 3300020082 Bacteria 2144
85 Ga0206353_10750580 3300020082 Bacteria 6566
86 Ga0206353_11002139 3300020082 Bacteria 2260
87 Ga0206353_11451303 3300020082 Bacteria 3727
88 Ga0206353_11897305 3300020082 Bacteria 1878
89 Ga0213874_10123994 3300021377 Unclassified 881
90 Ga0207699_10317492 3300025906 Unclassified 1092
91 Ga0207705_10021486 3300025909 Bacteria 4607
92 Ga0207705_10172921 3300025909 Bacteria 1627
93 Ga0207705_10311639 3300025909 Bacteria 1208
94 Ga0207684_10225371 3300025910 Bacteria 1618
95 Ga0207707_10017243 3300025912 Bacteria 6294
96 Ga0207707_10019697 3300025912 Bacteria 5889
97 Ga0207707_10033363 3300025912 Bacteria 4505
98 Ga0207707_10364816 3300025912 Bacteria 1243
99 Ga0207693_10033070 3300025915 Bacteria 4082
100 Ga0207663_10804911 3300025916 Bacteria 748
101 Ga0207660_10026092 3300025917 Bacteria 3975
102 Ga0207660_10047854 3300025917 Bacteria 3025
103 Ga0207660_10147862 3300025917 Bacteria 1802
104 Ga0207657_10000220 3300025919 Bacteria 59453
105 Ga0207657_10010118 3300025919 Bacteria 9427
106 Ga0207657_10034915 3300025919 Bacteria 4514
107 Ga0207657_10066935 3300025919 Bacteria 3057
108 Ga0207649_10025362 3300025920 Bacteria 3455
109 Ga0207649_10209733 3300025920 Bacteria 1381
110 Ga0207649_10250163 3300025920 Bacteria 1276
111 Ga0207652_10008064 3300025921 Bacteria 8454
112 Ga0207652_10046015 3300025921 Bacteria 3721
113 Ga0207652_10072437 3300025921 Bacteria 2996
114 Ga0207652_10318427 3300025921 Bacteria 1404
115 Ga0207652_10543664 3300025921 Bacteria 1044
116 Ga0207694_10164515 3300025924 Bacteria 1793
117 Ga0207664_10131390 3300025929 Bacteria 2108
118 Ga0207664_10633131 3300025929 Bacteria 961
119 Ga0207644_10510050 3300025931 Bacteria 993
120 Ga0207690_10077216 3300025932 Bacteria 2315
121 Ga0207661_10051552 3300025944 Bacteria 3284
122 Ga0207661_10071702 3300025944 Bacteria 2832
123 Ga0207661_10211163 3300025944 Bacteria 1711
124 Ga0207661_10567328 3300025944 Bacteria 1040
125 Ga0207661_10572524 3300025944 Bacteria 1036
126 Ga0207667_10187145 3300025949 Bacteria 2125
127 Ga0207667_10192474 3300025949 Bacteria 2093
128 Ga0207667_10242256 3300025949 Bacteria 1845
129 Ga0207667_10354917 3300025949 Bacteria 1495
130 Ga0207667_10493948 3300025949 Bacteria 1242
131 Ga0207667_10963209 3300025949 Bacteria 842
132 Ga0207640_10121412 3300025981 Bacteria 1873
133 Ga0207639_10734434 3300026041 Bacteria 917
134 Ga0207678_10264756 3300026067 Bacteria 1474
135 Ga0207702_10097886 3300026078 Bacteria 2583
136 Ga0207702_10157363 3300026078 Bacteria 2072
137 Ga0207702_10170258 3300026078 Bacteria 1996
138 Ga0207702_10353288 3300026078 Bacteria 1407
139 Ga0207674_10164075 3300026116 Bacteria 2176
140 Ga0207674_10307761 3300026116 Bacteria 1534
141 Ga0207674_10334566 3300026116 Bacteria 1464
142 Ga0207683_10167968 3300026121 Unclassified 1986
143 Ga0207698_10021508 3300026142 Bacteria 4463
144 Ga0207698_10261001 3300026142 Bacteria 1591
145 Ga0265322_10038071 3300028654 Bacteria 1369
146 Ga0265338_10162295 3300028800 Unclassified 1724
147 Ga0265325_10035209 3300031241 Bacteria 2661
148 Ga0265331_10078913 3300031250 Bacteria 1532
149 Ga0265327_10063353 3300031251 Bacteria 1878
150 Ga0265313_10017094 3300031595 Bacteria 4138
151 Ga0265314_10343900 3300031711 Bacteria 823
152 Ga0265342_10154365 3300031712 Bacteria 1273
153 Ga0395899_0060269 3300037312 Bacteria 2796
154 Ga0395899_0114063 3300037312 Bacteria 1941
155 Ga0395900_0064021 3300037418 Bacteria 3780
156 Ga0395900_0197502 3300037418 Bacteria 2037
157 Ga0395900_0464535 3300037418 Bacteria 1220
158 Ga0395900_0899277 3300037418 Bacteria 809
159 Ga0395898_0005749 3300037466 Bacteria 13347
160 Ga0395898_0013396 3300037466 Bacteria 8446
161 Ga0395898_0020761 3300037466 Bacteria 6667
162 Ga0395898_0301198 3300037466 Bacteria 1529
163 Ga0395898_0351754 3300037466 Bacteria 1405
164 Ga0395898_0443895 3300037466 Bacteria 1236
165 Ga0395898_1028553 3300037466 Bacteria 759
166 Ga0395905_0076560 3300037471 Bacteria 3135
167 Ga0395905_0126118 3300037471 Unclassified 2407
168 Ga0395905_0577426 3300037471 Unclassified 1026
169 Ga0395905_0636486 3300037471 Bacteria 968
170 Ga0395901_0003165 3300038443 Bacteria 16560
171 Ga0395901_0013865 3300038443 Bacteria 8199
172 Ga0395901_0031375 3300038443 Bacteria 5480
173 Ga0395901_0145341 3300038443 Bacteria 2492
174 Ga0395901_0186194 3300038443 Unclassified 2177
175 Ga0395901_0313627 3300038443 Bacteria 1624
176 Ga0395901_0447371 3300038443 Bacteria 1322
177 Ga0436365_1032657 3300039437 Bacteria 3624
178 Ga0439448_0028551 3300042005 Bacteria 1763
179 Ga0466969_0093309 3300044656 Bacteria 1424
180 Ga0466969_0115848 3300044656 Bacteria 1251
181 Ga0466966_0004103 3300044684 Bacteria 9616
182 Ga0466961_0020351 3300044693 Bacteria 4268
183 Ga0466961_0579408 3300044693 Bacteria 675
184 Ga0466963_0002744 3300044694 Bacteria 9935
185 Ga0466963_0005888 3300044694 Bacteria 7224
186 Ga0466964_0005840 3300044706 Bacteria 4578
187 Ga0466964_0068491 3300044706 Bacteria 1494
188 Ga0466971_0121494 3300044719 Bacteria 1209
189 Ga0466968_0122186 3300044735 Bacteria 1179
190 Ga0466970_0012322 3300044765 Bacteria 4370
191 Ga0466957_0300725 3300044842 Bacteria 1078
192 Ga0466960_0057010 3300044901 Bacteria 1904
193 Ga0466959_0163784 3300045049 Bacteria 1562
194 Ga0466959_0590690 3300045049 Bacteria 747
195 Ga0466958_0033151 3300045836 Bacteria 3076
196 Ga0466958_0084271 3300045836 Bacteria 1960
197 Ga0466967_0001721 3300045976 Bacteria 13042
198 Ga0466967_0006338 3300045976 Bacteria 8356
199 Ga0466967_0704620 3300045976 Bacteria 1000
200 Ga0466967_1448592 3300045976 Bacteria 684
201 Ga0495641_0031737 3300046461 Bacteria 2521
202 Ga0495651_0027880 3300046462 Bacteria 4402
203 Ga0495582_0095406 3300046473 Bacteria 1661
204 Ga0495664_0009644 3300046477 Bacteria 5406
205 Ga0495594_0275767 3300046499 Bacteria 958
206 Ga0495608_0026927 3300046511 Bacteria 3916
207 Ga0495608_0079341 3300046511 Bacteria 2134
208 Ga0495618_0044441 3300046514 Bacteria 2802
209 Ga0495628_0082435 3300046516 Bacteria 2498
210 Ga0495628_0113930 3300046516 Bacteria 2078
211 Ga0495630_0004843 3300046517 Bacteria 9443
212 Ga0495652_0095053 3300046529 Bacteria 2429
213 Ga0495640_0007990 3300046533 Bacteria 8315
214 Ga0495640_0063181 3300046533 Bacteria 2509
215 Ga0495586_0418579 3300046535 Bacteria 771
216 Ga0495587_0045953 3300046536 Bacteria 2594
217 Ga0495645_0106716 3300046543 Bacteria 1986
218 Ga0495667_0001323 3300046559 Bacteria 16271
219 Ga0495667_0102751 3300046559 Bacteria 1848
220 Ga0495634_0096304 3300046642 Bacteria 1916
221 Ga0495657_0044532 3300046675 Bacteria 3018
222 Ga0495657_0103394 3300046675 Bacteria 1812
223 Ga0495599_0070769 3300046678 Bacteria 2177
224 Ga0495646_0080701 3300046680 Bacteria 1897
225 Ga0495658_0699502 3300046683 Unclassified 649
226 Ga0495600_0043856 3300046809 Bacteria 2917
227 Ga0495600_0084220 3300046809 Bacteria 2075
228 Ga0495604_0027445 3300047317 Bacteria 4528
229 Ga0495604_0169276 3300047317 Bacteria 1538
230 Ga0495604_0184724 3300047317 Bacteria 1457
231 Ga0495674_0004916 3300047319 Bacteria 12850
232 Ga0495674_0336779 3300047319 Bacteria 1227
233 Ga0495676_0136670 3300047321 Bacteria 1762
234 Ga0495680_0001597 3300047322 Bacteria 24161
235 Ga0495680_0150166 3300047322 Bacteria 1699
236 Ga0495675_0231037 3300047444 Bacteria 1116
237 Ga0495684_0081692 3300047471 Bacteria 2452
238 Ga0495684_0123671 3300047471 Bacteria 1947
239 Ga0495602_0079070 3300048088 Bacteria 2775
240 Ga0495602_0108407 3300048088 Bacteria 2261
241 Ga0496100_0078586 3300048903 Unclassified 2221
242 Ga0496100_0135603 3300048903 Bacteria 1738
243 Ga0496100_0211091 3300048903 Bacteria 1420
244 Ga0496100_0793055 3300048903 Bacteria 742
245 Ga0496101_0025766 3300048904 Bacteria 4082
246 Ga0496101_0266441 3300048904 Bacteria 1337
247 Ga0496102_0178133 3300048905 Bacteria 2002
248 Ga0496103_0121609 3300048906 Bacteria 1663
249 Ga0496104_0321702 3300048907 Unclassified 1460
250 Ga0496107_0014825 3300048910 Bacteria 5457
251 Ga0496107_0016118 3300048910 Bacteria 5243
252 Ga0496110_0009360 3300048913 Bacteria 7928
253 Ga0496111_0127697 3300048914 Bacteria 1880
254 Ga0496112_0006285 3300048915 Bacteria 10421
255 Ga0496112_0031244 3300048915 Bacteria 5163
256 Ga0496112_0081613 3300048915 Bacteria 3198
257 Ga0496112_0303818 3300048915 Bacteria 1541
258 Ga0496113_0359202 3300048916 Bacteria 1169
259 Ga0496114_0014778 3300048917 Bacteria 6275
260 Ga0496115_0001139 3300048918 Bacteria 19188
261 Ga0496115_0278340 3300048918 Bacteria 1374
262 Ga0496115_0341579 3300048918 Bacteria 1222
263 Ga0496115_0462919 3300048918 Bacteria 1023
264 Ga0501067_0003540 3300049583 Bacteria 8591
265 Ga0501069_0001355 3300049585 Bacteria 12016
266 Ga0501070_0047688 3300049586 Bacteria 3560
267 Ga0501070_0826106 3300049586 Unclassified 726
268 Ga0501074_0114496 3300049590 Bacteria 1929
269 Ga0501080_0250435 3300049742 Bacteria 1615
270 Ga0501044_0331773 3300049823 Bacteria 1444
271 Ga0495601_0087264 3300053077 Bacteria 2006
272 Ga0495601_0171393 3300053077 Bacteria 1418
273 Ga0495595_0020583 3300053084 Bacteria 2872
274 Ga0495595_0083486 3300053084 Bacteria 1525
275 Ga0495595_0137131 3300053084 Bacteria 1199
276 Ga0495619_0059072 3300053085 Bacteria 2547
277 Ga0496102_0113302
278 Ga0070658_10229746
279 Ga0070683_100127248
280 Ga0070680_100003843
281 Ga0070680_100021204
282 Ga0070680_100046837
283 Ga0070680_100081897
284 Ga0070680_100137490
285 Ga0070682_100124640
286 Ga0070682_100253576
287 Ga0070660_100103916
288 Ga0070660_100126043
289 Ga0070660_100161696
290 Ga0070661_100018310
291 Ga0070661_100097183
292 Ga0070661_100097866
293 Ga0070671_100073275
294 Ga0070674_100125135
295 Ga0070659_100063115
296 Ga0070709_10122097
297 Ga0070714_100313581
298 Ga0070713_100848819
299 Ga0070711_100656333
300 Ga0070708_100051746
301 Ga0070678_100921855
302 Ga0070681_10006856
303 Ga0070681_10016795
304 Ga0070681_10056218
305 Ga0070681_10401020
306 Ga0070706_100117174
307 Ga0070698_100432873
308 Ga0070679_100015519
309 Ga0070679_100017870
310 Ga0070679_100034377
311 Ga0070679_100062729
312 Ga0070679_100073395
313 Ga0070679_100134184
314 Ga0070684_100112115
315 Ga0068853_100031830
316 Ga0068853_100157335
317 Ga0070686_100515499
318 Ga0070696_100218919
319 Ga0070693_100256678
320 Ga0070665_100406452
321 Ga0068855_100105906
322 Ga0068855_100129239
323 Ga0068855_100210125
324 Ga0068857_100108113
325 Ga0068857_100726595
326 Ga0068856_100024535
327 Ga0068852_100176482
328 Ga0068852_100999496
329 Ga0070712_100149913
330 Ga0105240_10011387
331 Ga0105240_10193872
332 Ga0105242_10310991
333 Ga0105237_10050590
334 Ga0105238_10029775
335 Ga0105238_10059492
336 Ga0157371_10455087
337 Ga0157370_10040414
338 Ga0157370_10052262
339 Ga0157370_10065312
340 Ga0157370_10099178
341 Ga0157370_10859992
342 Ga0157369_10041221
343 Ga0157369_10302254
344 Ga0157372_10045163
345 Ga0157372_10078339
346 Ga0157372_10099729
347 Ga0157372_10266889
348 Ga0157372_10373795
349 Ga0157372_10938231
350 Ga0182008_10079757
351 Ga0182007_10174624
352 Ga0197907_10289060
353 Ga0206356_10566142
354 Ga0206356_10765339
355 Ga0206356_11335724
356 Ga0206356_11611098
357 Ga0206354_10817949
358 Ga0206354_11040466
359 Ga0206354_11572152
360 Ga0206353_10026577
361 Ga0206353_10750580
362 Ga0206353_11002139
363 Ga0206353_11451303
364 Ga0206353_11897305
365 Ga0213874_10123994
366 Ga0207699_10317492
367 Ga0207705_10021486
368 Ga0207705_10172921
369 Ga0207705_10311639
370 Ga0207684_10225371
371 Ga0207707_10017243
372 Ga0207707_10019697
373 Ga0207707_10033363
374 Ga0207707_10364816
375 Ga0207693_10033070
376 Ga0207663_10804911
377 Ga0207660_10026092
378 Ga0207660_10047854
379 Ga0207660_10147862
380 Ga0207657_10000220
381 Ga0207657_10010118
382 Ga0207657_10034915
383 Ga0207657_10066935
384 Ga0207649_10025362
385 Ga0207649_10209733
386 Ga0207649_10250163
387 Ga0207652_10008064
388 Ga0207652_10046015
389 Ga0207652_10072437
390 Ga0207652_10318427
391 Ga0207652_10543664
392 Ga0207694_10164515
393 Ga0207664_10131390
394 Ga0207664_10633131
395 Ga0207644_10510050
396 Ga0207690_10077216
397 Ga0207661_10051552
398 Ga0207661_10071702
399 Ga0207661_10211163
400 Ga0207661_10567328
401 Ga0207661_10572524
402 Ga0207667_10187145
403 Ga0207667_10192474
404 Ga0207667_10242256
405 Ga0207667_10354917
406 Ga0207667_10493948
407 Ga0207667_10963209
408 Ga0207640_10121412
409 Ga0207639_10734434
410 Ga0207678_10264756
411 Ga0207702_10097886
412 Ga0207702_10157363
413 Ga0207702_10170258
414 Ga0207702_10353288
415 Ga0207674_10164075
416 Ga0207674_10307761
417 Ga0207674_10334566
418 Ga0207683_10167968
419 Ga0207698_10021508
420 Ga0207698_10261001
421 Ga0265322_10038071
422 Ga0265338_10162295
423 Ga0265325_10035209
424 Ga0265331_10078913
425 Ga0265327_10063353
426 Ga0265313_10017094
427 Ga0265314_10343900
428 Ga0265342_10154365
429 Ga0395899_0060269
430 Ga0395899_0114063
431 Ga0395900_0064021
432 Ga0395900_0197502
433 Ga0395900_0464535
434 Ga0395900_0899277
435 Ga0395898_0005749
436 Ga0395898_0013396
437 Ga0395898_0020761
438 Ga0395898_0301198
439 Ga0395898_0351754
440 Ga0395898_0443895
441 Ga0395898_1028553
442 Ga0395905_0076560
443 Ga0395905_0126118
444 Ga0395905_0577426
445 Ga0395905_0636486
446 Ga0395901_0003165
447 Ga0395901_0013865
448 Ga0395901_0031375
449 Ga0395901_0145341
450 Ga0395901_0186194
451 Ga0395901_0313627
452 Ga0395901_0447371
453 Ga0436365_1032657
454 Ga0439448_0028551
455 Ga0466969_0093309
456 Ga0466969_0115848
457 Ga0466966_0004103
458 Ga0466961_0020351
459 Ga0466961_0579408
460 Ga0466963_0002744
461 Ga0466963_0005888
462 Ga0466964_0005840
463 Ga0466964_0068491
464 Ga0466971_0121494
465 Ga0466968_0122186
466 Ga0466970_0012322
467 Ga0466957_0300725
468 Ga0466960_0057010
469 Ga0466959_0163784
470 Ga0466959_0590690
471 Ga0466958_0033151
472 Ga0466958_0084271
473 Ga0466967_0001721
474 Ga0466967_0006338
475 Ga0466967_0704620
476 Ga0466967_1448592
477 Ga0495641_0031737
478 Ga0495651_0027880
479 Ga0495582_0095406
480 Ga0495664_0009644
481 Ga0495594_0275767
482 Ga0495608_0026927
483 Ga0495608_0079341
484 Ga0495618_0044441
485 Ga0495628_0082435
486 Ga0495628_0113930
487 Ga0495630_0004843
488 Ga0495652_0095053
489 Ga0495640_0007990
490 Ga0495640_0063181
491 Ga0495586_0418579
492 Ga0495587_0045953
493 Ga0495645_0106716
494 Ga0495667_0001323
495 Ga0495667_0102751
496 Ga0495634_0096304
497 Ga0495657_0044532
498 Ga0495657_0103394
499 Ga0495599_0070769
500 Ga0495646_0080701
501 Ga0495658_0699502
502 Ga0495600_0043856
503 Ga0495600_0084220
504 Ga0495604_0027445
505 Ga0495604_0169276
506 Ga0495604_0184724
507 Ga0495674_0004916
508 Ga0495674_0336779
509 Ga0495676_0136670
510 Ga0495680_0001597
511 Ga0495680_0150166
512 Ga0495675_0231037
513 Ga0495684_0081692
514 Ga0495684_0123671
515 Ga0495602_0079070
516 Ga0495602_0108407
517 Ga0496100_0078586
518 Ga0496100_0135603
519 Ga0496100_0211091
520 Ga0496100_0793055
521 Ga0496101_0025766
522 Ga0496101_0266441
523 Ga0496102_0178133
524 Ga0496103_0121609
525 Ga0496104_0321702
526 Ga0496107_0014825
527 Ga0496107_0016118
528 Ga0496110_0009360
529 Ga0496111_0127697
530 Ga0496112_0006285
531 Ga0496112_0031244
532 Ga0496112_0081613
533 Ga0496112_0303818
534 Ga0496113_0359202
535 Ga0496114_0014778
536 Ga0496115_0001139
537 Ga0496115_0278340
538 Ga0496115_0341579
539 Ga0496115_0462919
540 Ga0501067_0003540
541 Ga0501069_0001355
542 Ga0501070_0047688
543 Ga0501070_0826106
544 Ga0501074_0114496
545 Ga0501080_0250435
546 Ga0501044_0331773
547 Ga0495601_0087264
548 Ga0495601_0171393
549 Ga0495595_0020583
550 Ga0495595_0083486
551 Ga0495595_0137131
552 Ga0495619_0059072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13539

Peptidase_M15_4

D-alanyl-D-alanine carboxypeptidase

100

180

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5icu-assembly1.cif.gz_A the crystal structure of copc from methylosinus trichosporium ob3b 0.7996 33 54
6ta4-assembly1.cif.gz_K human kinesin-5 motor domain in the amppnp state bound to microtubules 0.7684 34 54
5o63-assembly1.cif.gz_A crystal structure of ubalai restriction endonuclease b3 domain domain (mutant l24m l53m l95m) with cognate dna 0.7616 34 56
7ywp-assembly1.cif.gz_A closed conformation of oligopeptidase b from serratia proteomaculans with covalently bound tck 0.7598 28 58
2wex-assembly1.cif.gz_A crystal structure of human apom in complex with glycerol 1- myristic acid 0.7374 33 56
ID Description Score Start End Superfamily
af_O62361_567_620_2.20.25.420 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ZPR1, zinc finger domain 0.8174 33 59 2.20.25.420
5icuA00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7996 33 54 2.60.40.1220
af_A0A1D6NFR3_1_200_2.60.40.1210 Mainly Beta;Sandwich;Immunoglobulin-like;Cellobiose dehydrogenase, cytochrome domain 0.7906 35 52 2.60.40.1210
af_A0A0R4I9N1_38_199_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7881 36 52 2.60.120.200
af_A1A5V9_1_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.771 6 52 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2W6CM35-F1-model_v4 Peptidase M15C domain-containing protein 0.9513 5 193 GO:0008233
AF-A0A3C1CFL6-F1-model_v4 Peptidase M15C domain-containing protein 0.9401 2 193 GO:0008233
GO:0016020
AF-A0A1Q7W481-F1-model_v4 Peptidase M15C domain-containing protein 0.9399 5 193 GO:0008233
AF-A0A1C4YPQ9-F1-model_v4 D-alanyl-D-alanine carboxypeptidase 0.9394 4 189 GO:0004180
AF-A0A1Q7UGM9-F1-model_v4 Peptidase M15C domain-containing protein 0.938 7 193 GO:0008233

Map