F381316

General Info

Members Datasets Scaffolds Average Seq Length
276 181 552 248

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0032933|Ga0495641_0032933_761_1603
Length 280
Sequence MPAGRSLSKCRYWFDLPASILKTMKPLIGVTTSELRPGELATLRRHGEPPHAEMALGITYARAVEAAGGVPVVMPPLASAAIPALVSRLDGLLLSGGPDLAPAAYDQRPHVELGSTEPHLDAFEYAVVREALELGLPILGICRGAQALNVARGGTLHQHLPDLPATVLTHRQCEAGESLTHDVDVVAGTKLRRIVRSARLGVNSFHHQAVDRLGEGLRVSARASDGTVEAIEDPRRPFVLGVQWHAEMLLEERPHRMLFEGLVTAAAGVTPLPVAEPLAA

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.26
Nodule 0
Rhizoplane 10.14
Rhizosphere 86.23
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0032933 3300046461 Bacteria 2464
2 Ga0070683_100001251 3300005329 Bacteria 19338
3 Ga0070683_100040379 3300005329 Bacteria 4290
4 Ga0070683_100083790 3300005329 Bacteria 2987
5 Ga0070683_100091755 3300005329 Unclassified 2852
6 Ga0070683_100292734 3300005329 Bacteria 1548
7 Ga0070682_100164192 3300005337 Bacteria 1537
8 Ga0070682_100190377 3300005337 Bacteria 1440
9 Ga0068868_100132781 3300005338 Bacteria 2039
10 Ga0070660_100275501 3300005339 Bacteria 1376
11 Ga0070691_10022499 3300005341 Unclassified 2925
12 Ga0070691_10178189 3300005341 Bacteria 1105
13 Ga0070687_100030942 3300005343 Bacteria 2621
14 Ga0070668_100078652 3300005347 Bacteria 2580
15 Ga0070671_100332768 3300005355 Bacteria 1295
16 Ga0070674_100043499 3300005356 Bacteria 3056
17 Ga0070659_100021937 3300005366 Bacteria 4872
18 Ga0070709_10110508 3300005434 Bacteria 1847
19 Ga0070714_100246791 3300005435 Bacteria 1650
20 Ga0070713_100003261 3300005436 Bacteria 10706
21 Ga0070713_100072534 3300005436 Bacteria 2912
22 Ga0070713_100083326 3300005436 Bacteria 2733
23 Ga0070710_10089587 3300005437 Bacteria 1812
24 Ga0070701_10098261 3300005438 Bacteria 1617
25 Ga0070711_100127482 3300005439 Bacteria 1891
26 Ga0070700_100037038 3300005441 Bacteria 2963
27 Ga0070700_100037730 3300005441 Bacteria 2941
28 Ga0070708_100013713 3300005445 Bacteria 6649
29 Ga0070678_100109405 3300005456 Bacteria 2159
30 Ga0070681_10130374 3300005458 Bacteria 2447
31 Ga0070681_10335853 3300005458 Unclassified 1420
32 Ga0068867_100143310 3300005459 Bacteria 1870
33 Ga0070707_100069506 3300005468 Bacteria 3390
34 Ga0070707_100142654 3300005468 Bacteria 2331
35 Ga0070698_100008142 3300005471 Bacteria 11335
36 Ga0070699_100119735 3300005518 Bacteria 2314
37 Ga0070684_100005862 3300005535 Bacteria 9455
38 Ga0070684_100182126 3300005535 Unclassified 1910
39 Ga0070684_100336216 3300005535 Bacteria 1388
40 Ga0070697_100042030 3300005536 Bacteria 3700
41 Ga0070672_100163536 3300005543 Bacteria 1848
42 Ga0070686_100232870 3300005544 Bacteria 1337
43 Ga0070665_100000627 3300005548 Bacteria 48156
44 Ga0070664_100047476 3300005564 Unclassified 3627
45 Ga0070664_100398355 3300005564 Bacteria 1258
46 Ga0070664_100427620 3300005564 Bacteria 1214
47 Ga0068857_100000813 3300005577 Bacteria 23351
48 Ga0068854_100107102 3300005578 Bacteria 2104
49 Ga0068856_100003377 3300005614 Bacteria 16163
50 Ga0068856_100826245 3300005614 Bacteria 946
51 Ga0070702_100155852 3300005615 Bacteria 1471
52 Ga0068859_100338492 3300005617 Bacteria 1599
53 Ga0068864_100277254 3300005618 Bacteria 1564
54 Ga0068866_10155446 3300005718 Bacteria 1329
55 Ga0068866_10330550 3300005718 Bacteria 962
56 Ga0068861_100256017 3300005719 Bacteria 1496
57 Ga0068851_10144789 3300005834 Bacteria 1295
58 Ga0068851_10234148 3300005834 Bacteria 1036
59 Ga0068870_10154111 3300005840 Bacteria 1356
60 Ga0068863_100494637 3300005841 Bacteria 1204
61 Ga0068858_100141733 3300005842 Bacteria 2257
62 Ga0081538_10001958 3300005981 Bacteria 20618
63 Ga0081538_10030609 3300005981 Bacteria 3649
64 Ga0081540_1002040 3300005983 Bacteria 16845
65 Ga0081540_1127410 3300005983 Bacteria 1045
66 Ga0081539_10002920 3300005985 Bacteria 22553
67 Ga0070717_10089630 3300006028 Unclassified 2594
68 Ga0070717_10203327 3300006028 Bacteria 1736
69 Ga0075365_10185296 3300006038 Bacteria 1456
70 Ga0075365_10263751 3300006038 Bacteria 1211
71 Ga0075364_10023052 3300006051 Bacteria 3939
72 Ga0075364_10192504 3300006051 Bacteria 1381
73 Ga0075432_10084798 3300006058 Bacteria 1153
74 Ga0070712_100014784 3300006175 Bacteria 5014
75 Ga0075367_10032465 3300006178 Bacteria 3004
76 Ga0075428_100056737 3300006844 Bacteria 4289
77 Ga0075431_100578173 3300006847 Bacteria 1109
78 Ga0068865_100113520 3300006881 Bacteria 2002
79 Ga0068865_100647243 3300006881 Bacteria 898
80 Ga0097620_100338495 3300006931 Bacteria 1599
81 Ga0111539_10212765 3300009094 Bacteria 2252
82 Ga0111539_10463249 3300009094 Bacteria 1476
83 Ga0111539_10713591 3300009094 Bacteria 1167
84 Ga0105245_10040609 3300009098 Bacteria 4145
85 Ga0105245_10076944 3300009098 Bacteria 3041
86 Ga0105245_10084759 3300009098 Bacteria 2904
87 Ga0105245_10424951 3300009098 Bacteria 1333
88 Ga0114129_10535664 3300009147 Bacteria 1525
89 Ga0105243_10137983 3300009148 Bacteria 2077
90 Ga0105243_10149418 3300009148 Bacteria 2002
91 Ga0105243_10289997 3300009148 Bacteria 1478
92 Ga0105243_10471907 3300009148 Bacteria 1182
93 Ga0105237_10331100 3300009545 Bacteria 1527
94 Ga0105246_10424255 3300011119 Bacteria 1111
95 Ga0157369_10002862 3300013105 Bacteria 20611
96 Ga0157372_10163614 3300013307 Unclassified 2572
97 Ga0157380_10333207 3300014326 Bacteria 1412
98 Ga0157380_10362716 3300014326 Bacteria 1360
99 Ga0157380_10625591 3300014326 Bacteria 1069
100 Ga0157377_10223183 3300014745 Bacteria 1207
101 Ga0224712_10007461 3300022467 Unclassified 3187
102 Ga0224572_1000441 3300024225 Bacteria 4834
103 Ga0207656_10088699 3300025321 Bacteria 1401
104 Ga0207692_10040498 3300025898 Bacteria 2299
105 Ga0207642_10098669 3300025899 Bacteria 1461
106 Ga0207688_10024340 3300025901 Bacteria 3320
107 Ga0207688_10142730 3300025901 Bacteria 1410
108 Ga0207699_10098384 3300025906 Unclassified 1851
109 Ga0207684_10185317 3300025910 Bacteria 1795
110 Ga0207707_10280800 3300025912 Bacteria 1442
111 Ga0207693_10014195 3300025915 Bacteria 6412
112 Ga0207663_10456239 3300025916 Bacteria 986
113 Ga0207662_10014628 3300025918 Bacteria 4406
114 Ga0207657_10245353 3300025919 Bacteria 1429
115 Ga0207657_10600056 3300025919 Bacteria 859
116 Ga0207646_10101715 3300025922 Bacteria 2576
117 Ga0207681_10661394 3300025923 Bacteria 867
118 Ga0207700_10015733 3300025928 Bacteria 5002
119 Ga0207700_10377953 3300025928 Bacteria 1238
120 Ga0207700_10410814 3300025928 Unclassified 1187
121 Ga0207664_10164861 3300025929 Bacteria 1892
122 Ga0207690_10165691 3300025932 Bacteria 1651
123 Ga0207690_10203737 3300025932 Bacteria 1504
124 Ga0207706_10278439 3300025933 Bacteria 1459
125 Ga0207669_10382875 3300025937 Bacteria 1097
126 Ga0207704_10036142 3300025938 Bacteria 2839
127 Ga0207665_10070015 3300025939 Bacteria 2393
128 Ga0207691_10151721 3300025940 Bacteria 2037
129 Ga0207689_10487143 3300025942 Bacteria 1033
130 Ga0207661_10013277 3300025944 Bacteria 6014
131 Ga0207661_10187536 3300025944 Bacteria 1811
132 Ga0207661_10223490 3300025944 Bacteria 1665
133 Ga0207679_10340788 3300025945 Bacteria 1304
134 Ga0207668_10052409 3300025972 Bacteria 2823
135 Ga0207668_10252641 3300025972 Bacteria 1433
136 Ga0207640_10090792 3300025981 Bacteria 2114
137 Ga0207640_10342212 3300025981 Bacteria 1198
138 Ga0207677_10304371 3300026023 Bacteria 1318
139 Ga0207677_10570252 3300026023 Bacteria 989
140 Ga0207678_10109782 3300026067 Bacteria 2353
141 Ga0207678_10288679 3300026067 Bacteria 1409
142 Ga0207708_10003757 3300026075 Bacteria 11188
143 Ga0207708_10052877 3300026075 Bacteria 3094
144 Ga0207708_10074723 3300026075 Bacteria 2598
145 Ga0207702_10003631 3300026078 Bacteria 14001
146 Ga0207702_10138255 3300026078 Bacteria 2201
147 Ga0207641_10457281 3300026088 Unclassified 1235
148 Ga0207648_10061813 3300026089 Bacteria 3265
149 Ga0207648_10082801 3300026089 Bacteria 2798
150 Ga0207648_10257430 3300026089 Bacteria 1557
151 Ga0207674_10000011 3300026116 Bacteria 193487
152 Ga0207675_100087770 3300026118 Bacteria 2921
153 Ga0207675_100250697 3300026118 Bacteria 1713
154 Ga0207675_100276371 3300026118 Bacteria 1631
155 Ga0207675_100276856 3300026118 Bacteria 1629
156 Ga0207698_10280677 3300026142 Bacteria 1540
157 Ga0207428_10247876 3300027907 Bacteria 1329
158 Ga0268266_10002671 3300028379 Bacteria 18763
159 Ga0307405_10225605 3300031731 Bacteria 1378
160 Ga0307413_10416716 3300031824 Bacteria 1057
161 Ga0307409_100094174 3300031995 Bacteria 2464
162 Ga0307409_100274397 3300031995 Bacteria 1555
163 Ga0307416_100064323 3300032002 Bacteria 3009
164 Ga0307416_100250003 3300032002 Bacteria 1725
165 Ga0307416_100331853 3300032002 Bacteria 1529
166 Ga0307416_100585559 3300032002 Bacteria 1194
167 Ga0307415_100121569 3300032126 Bacteria 1959
168 Ga0373953_0050828 3300035117 Bacteria 1675
169 Ga0373956_0103084 3300035119 Bacteria 1325
170 Ga0373933_0122531 3300035724 Bacteria 1629
171 Ga0373937_0055874 3300036401 Bacteria 3625
172 Ga0373937_0069135 3300036401 Bacteria 3255
173 Ga0395898_0109168 3300037466 Bacteria 2653
174 Ga0436364_1093687 3300037853 Bacteria 2294
175 Ga0395901_0385854 3300038443 Bacteria 1441
176 Ga0395901_0864380 3300038443 Bacteria 889
177 Ga0466960_0323358 3300044901 Bacteria 874
178 Ga0451576_0006352 3300045051 Bacteria 14512
179 Ga0466967_0036236 3300045976 Bacteria 4209
180 Ga0495653_0061233 3300046463 Unclassified 2848
181 Ga0495664_0200219 3300046477 Bacteria 1210
182 Ga0495608_0007984 3300046511 Bacteria 7438
183 Ga0495618_0306593 3300046514 Bacteria 986
184 Ga0495628_0065158 3300046516 Unclassified 2851
185 Ga0495640_0067201 3300046533 Bacteria 2415
186 Ga0495587_0083372 3300046536 Bacteria 1852
187 Ga0495667_0120567 3300046559 Bacteria 1693
188 Ga0495656_0020588 3300046615 Bacteria 2560
189 Ga0495635_0150285 3300046663 Bacteria 1585
190 Ga0495657_0274760 3300046675 Bacteria 1009
191 Ga0495599_0237107 3300046678 Unclassified 1113
192 Ga0495613_0229224 3300046689 Bacteria 1302
193 Ga0495670_0100285 3300046691 Bacteria 1491
194 Ga0495581_0276575 3300047315 Bacteria 982
195 Ga0495674_0109302 3300047319 Bacteria 2346
196 Ga0495674_0278294 3300047319 Bacteria 1371
197 Ga0495680_0163575 3300047322 Unclassified 1614
198 Ga0495602_0124994 3300048088 Unclassified 2062
199 Ga0496102_0044728 3300048905 Bacteria 4019
200 Ga0496102_0482030 3300048905 Bacteria 1162
201 Ga0496104_0003357 3300048907 Bacteria 13829
202 Ga0496104_0044327 3300048907 Bacteria 4180
203 Ga0496104_0126629 3300048907 Unclassified 2453
204 Ga0496105_0029836 3300048908 Bacteria 4465
205 Ga0496105_0357353 3300048908 Bacteria 1166
206 Ga0496106_0208788 3300048909 Bacteria 1555
207 Ga0496108_0004338 3300048911 Bacteria 11403
208 Ga0496108_0119193 3300048911 Bacteria 2263
209 Ga0496108_0433972 3300048911 Bacteria 1147
210 Ga0496108_0515783 3300048911 Bacteria 1044
211 Ga0496109_0002702 3300048912 Bacteria 14874
212 Ga0496109_0060844 3300048912 Bacteria 3452
213 Ga0496109_0200917 3300048912 Bacteria 1874
214 Ga0496109_0246860 3300048912 Bacteria 1681
215 Ga0496109_0302958 3300048912 Unclassified 1507
216 Ga0496110_0073411 3300048913 Bacteria 3036
217 Ga0496110_0108758 3300048913 Bacteria 2489
218 Ga0496110_0286525 3300048913 Bacteria 1500
219 Ga0496111_0154508 3300048914 Bacteria 1703
220 Ga0496112_0009504 3300048915 Bacteria 8767
221 Ga0496112_0019151 3300048915 Bacteria 6454
222 Ga0496113_0004510 3300048916 Bacteria 8575
223 Ga0496113_0011867 3300048916 Bacteria 5838
224 Ga0496113_0057228 3300048916 Bacteria 2930
225 Ga0496114_0767833 3300048917 Unclassified 842
226 Ga0496115_0190146 3300048918 Bacteria 1696
227 Ga0501031_0047352 3300049568 Bacteria 2803
228 Ga0501032_0152942 3300049569 Bacteria 1517
229 Ga0501036_0225632 3300049572 Bacteria 1572
230 Ga0501037_0211697 3300049573 Bacteria 1367
231 Ga0501037_0409033 3300049573 Bacteria 930
232 Ga0501038_0250831 3300049574 Bacteria 1402
233 Ga0501038_0399050 3300049574 Bacteria 1064
234 Ga0501039_0081759 3300049575 Bacteria 2515
235 Ga0501039_0142894 3300049575 Bacteria 1880
236 Ga0501039_0443697 3300049575 Bacteria 1019
237 Ga0501040_0016160 3300049576 Bacteria 4936
238 Ga0501040_0360088 3300049576 Bacteria 1042
239 Ga0501041_0096247 3300049577 Bacteria 1830
240 Ga0501041_0267139 3300049577 Bacteria 1076
241 Ga0501042_0025151 3300049578 Bacteria 4181
242 Ga0501042_0069226 3300049578 Bacteria 2524
243 Ga0501042_0369845 3300049578 Bacteria 1037
244 Ga0501042_0452199 3300049578 Bacteria 931
245 Ga0501048_0053333 3300049582 Bacteria 2876
246 Ga0501071_0041864 3300049587 Bacteria 3280
247 Ga0501072_0053436 3300049588 Bacteria 3181
248 Ga0501074_0224842 3300049590 Bacteria 1336
249 Ga0501075_0122578 3300049591 Bacteria 1978
250 Ga0501076_0032738 3300049592 Bacteria 4058
251 Ga0501076_0076335 3300049592 Bacteria 2687
252 Ga0501077_0099643 3300049593 Bacteria 1842
253 Ga0501077_0132962 3300049593 Bacteria 1578
254 Ga0501079_0056592 3300049741 Bacteria 3026
255 Ga0501081_0311231 3300049743 Bacteria 1156
256 Ga0501035_0402822 3300049822 Bacteria 1138
257 Ga0501035_0759918 3300049822 Bacteria 777
258 Ga0501045_0125943 3300049824 Bacteria 1903
259 nmdc:mga00v17_19820_c1 3300050491 Bacteria 3846
260 nmdc:mga0yw44_140990_c1 3300050492 Bacteria 1567
261 nmdc:mga0yw44_199132_c1 3300050492 Bacteria 1322
262 nmdc:mga06z11_64298_c1 3300050494 Bacteria 1922
263 nmdc:mga05p37_1018380_c1 3300050507 Bacteria 877
264 nmdc:mga0qj67_645650_c1 3300050509 Bacteria 844
265 nmdc:mga06r32_700884_c1 3300050510 Bacteria 978
266 nmdc:mga08y16_338246_c1 3300050511 Bacteria 1547
267 nmdc:mga08y16_35394_c1 3300050511 Bacteria 5243
268 nmdc:mga08y16_421564_c1 3300050511 Bacteria 1364
269 Ga0495601_0184231 3300053077 Bacteria 1365
270 Ga0495601_0272851 3300053077 Bacteria 1103
271 Ga0495619_0086086 3300053085 Bacteria 2124
272 Ga0495619_0358435 3300053085 Bacteria 1008
273 Ga0501082_0149788 3300060353 Bacteria 2026
274 Ga0501082_0185627 3300060353 Bacteria 1809
275 Ga0501082_0344431 3300060353 Bacteria 1299
276 Ga0466962_0276190 3300061719 Bacteria 829
277 Ga0495641_0032933
278 Ga0070683_100001251
279 Ga0070683_100040379
280 Ga0070683_100083790
281 Ga0070683_100091755
282 Ga0070683_100292734
283 Ga0070682_100164192
284 Ga0070682_100190377
285 Ga0068868_100132781
286 Ga0070660_100275501
287 Ga0070691_10022499
288 Ga0070691_10178189
289 Ga0070687_100030942
290 Ga0070668_100078652
291 Ga0070671_100332768
292 Ga0070674_100043499
293 Ga0070659_100021937
294 Ga0070709_10110508
295 Ga0070714_100246791
296 Ga0070713_100003261
297 Ga0070713_100072534
298 Ga0070713_100083326
299 Ga0070710_10089587
300 Ga0070701_10098261
301 Ga0070711_100127482
302 Ga0070700_100037038
303 Ga0070700_100037730
304 Ga0070708_100013713
305 Ga0070678_100109405
306 Ga0070681_10130374
307 Ga0070681_10335853
308 Ga0068867_100143310
309 Ga0070707_100069506
310 Ga0070707_100142654
311 Ga0070698_100008142
312 Ga0070699_100119735
313 Ga0070684_100005862
314 Ga0070684_100182126
315 Ga0070684_100336216
316 Ga0070697_100042030
317 Ga0070672_100163536
318 Ga0070686_100232870
319 Ga0070665_100000627
320 Ga0070664_100047476
321 Ga0070664_100398355
322 Ga0070664_100427620
323 Ga0068857_100000813
324 Ga0068854_100107102
325 Ga0068856_100003377
326 Ga0068856_100826245
327 Ga0070702_100155852
328 Ga0068859_100338492
329 Ga0068864_100277254
330 Ga0068866_10155446
331 Ga0068866_10330550
332 Ga0068861_100256017
333 Ga0068851_10144789
334 Ga0068851_10234148
335 Ga0068870_10154111
336 Ga0068863_100494637
337 Ga0068858_100141733
338 Ga0081538_10001958
339 Ga0081538_10030609
340 Ga0081540_1002040
341 Ga0081540_1127410
342 Ga0081539_10002920
343 Ga0070717_10089630
344 Ga0070717_10203327
345 Ga0075365_10185296
346 Ga0075365_10263751
347 Ga0075364_10023052
348 Ga0075364_10192504
349 Ga0075432_10084798
350 Ga0070712_100014784
351 Ga0075367_10032465
352 Ga0075428_100056737
353 Ga0075431_100578173
354 Ga0068865_100113520
355 Ga0068865_100647243
356 Ga0097620_100338495
357 Ga0111539_10212765
358 Ga0111539_10463249
359 Ga0111539_10713591
360 Ga0105245_10040609
361 Ga0105245_10076944
362 Ga0105245_10084759
363 Ga0105245_10424951
364 Ga0114129_10535664
365 Ga0105243_10137983
366 Ga0105243_10149418
367 Ga0105243_10289997
368 Ga0105243_10471907
369 Ga0105237_10331100
370 Ga0105246_10424255
371 Ga0157369_10002862
372 Ga0157372_10163614
373 Ga0157380_10333207
374 Ga0157380_10362716
375 Ga0157380_10625591
376 Ga0157377_10223183
377 Ga0224712_10007461
378 Ga0224572_1000441
379 Ga0207656_10088699
380 Ga0207692_10040498
381 Ga0207642_10098669
382 Ga0207688_10024340
383 Ga0207688_10142730
384 Ga0207699_10098384
385 Ga0207684_10185317
386 Ga0207707_10280800
387 Ga0207693_10014195
388 Ga0207663_10456239
389 Ga0207662_10014628
390 Ga0207657_10245353
391 Ga0207657_10600056
392 Ga0207646_10101715
393 Ga0207681_10661394
394 Ga0207700_10015733
395 Ga0207700_10377953
396 Ga0207700_10410814
397 Ga0207664_10164861
398 Ga0207690_10165691
399 Ga0207690_10203737
400 Ga0207706_10278439
401 Ga0207669_10382875
402 Ga0207704_10036142
403 Ga0207665_10070015
404 Ga0207691_10151721
405 Ga0207689_10487143
406 Ga0207661_10013277
407 Ga0207661_10187536
408 Ga0207661_10223490
409 Ga0207679_10340788
410 Ga0207668_10052409
411 Ga0207668_10252641
412 Ga0207640_10090792
413 Ga0207640_10342212
414 Ga0207677_10304371
415 Ga0207677_10570252
416 Ga0207678_10109782
417 Ga0207678_10288679
418 Ga0207708_10003757
419 Ga0207708_10052877
420 Ga0207708_10074723
421 Ga0207702_10003631
422 Ga0207702_10138255
423 Ga0207641_10457281
424 Ga0207648_10061813
425 Ga0207648_10082801
426 Ga0207648_10257430
427 Ga0207674_10000011
428 Ga0207675_100087770
429 Ga0207675_100250697
430 Ga0207675_100276371
431 Ga0207675_100276856
432 Ga0207698_10280677
433 Ga0207428_10247876
434 Ga0268266_10002671
435 Ga0307405_10225605
436 Ga0307413_10416716
437 Ga0307409_100094174
438 Ga0307409_100274397
439 Ga0307416_100064323
440 Ga0307416_100250003
441 Ga0307416_100331853
442 Ga0307416_100585559
443 Ga0307415_100121569
444 Ga0373953_0050828
445 Ga0373956_0103084
446 Ga0373933_0122531
447 Ga0373937_0055874
448 Ga0373937_0069135
449 Ga0395898_0109168
450 Ga0436364_1093687
451 Ga0395901_0385854
452 Ga0395901_0864380
453 Ga0466960_0323358
454 Ga0451576_0006352
455 Ga0466967_0036236
456 Ga0495653_0061233
457 Ga0495664_0200219
458 Ga0495608_0007984
459 Ga0495618_0306593
460 Ga0495628_0065158
461 Ga0495640_0067201
462 Ga0495587_0083372
463 Ga0495667_0120567
464 Ga0495656_0020588
465 Ga0495635_0150285
466 Ga0495657_0274760
467 Ga0495599_0237107
468 Ga0495613_0229224
469 Ga0495670_0100285
470 Ga0495581_0276575
471 Ga0495674_0109302
472 Ga0495674_0278294
473 Ga0495680_0163575
474 Ga0495602_0124994
475 Ga0496102_0044728
476 Ga0496102_0482030
477 Ga0496104_0003357
478 Ga0496104_0044327
479 Ga0496104_0126629
480 Ga0496105_0029836
481 Ga0496105_0357353
482 Ga0496106_0208788
483 Ga0496108_0004338
484 Ga0496108_0119193
485 Ga0496108_0433972
486 Ga0496108_0515783
487 Ga0496109_0002702
488 Ga0496109_0060844
489 Ga0496109_0200917
490 Ga0496109_0246860
491 Ga0496109_0302958
492 Ga0496110_0073411
493 Ga0496110_0108758
494 Ga0496110_0286525
495 Ga0496111_0154508
496 Ga0496112_0009504
497 Ga0496112_0019151
498 Ga0496113_0004510
499 Ga0496113_0011867
500 Ga0496113_0057228
501 Ga0496114_0767833
502 Ga0496115_0190146
503 Ga0501031_0047352
504 Ga0501032_0152942
505 Ga0501036_0225632
506 Ga0501037_0211697
507 Ga0501037_0409033
508 Ga0501038_0250831
509 Ga0501038_0399050
510 Ga0501039_0081759
511 Ga0501039_0142894
512 Ga0501039_0443697
513 Ga0501040_0016160
514 Ga0501040_0360088
515 Ga0501041_0096247
516 Ga0501041_0267139
517 Ga0501042_0025151
518 Ga0501042_0069226
519 Ga0501042_0369845
520 Ga0501042_0452199
521 Ga0501048_0053333
522 Ga0501071_0041864
523 Ga0501072_0053436
524 Ga0501074_0224842
525 Ga0501075_0122578
526 Ga0501076_0032738
527 Ga0501076_0076335
528 Ga0501077_0099643
529 Ga0501077_0132962
530 Ga0501079_0056592
531 Ga0501081_0311231
532 Ga0501035_0402822
533 Ga0501035_0759918
534 Ga0501045_0125943
535 nmdc:mga00v17_19820_c1
536 nmdc:mga0yw44_140990_c1
537 nmdc:mga0yw44_199132_c1
538 nmdc:mga06z11_64298_c1
539 nmdc:mga05p37_1018380_c1
540 nmdc:mga0qj67_645650_c1
541 nmdc:mga06r32_700884_c1
542 nmdc:mga08y16_338246_c1
543 nmdc:mga08y16_35394_c1
544 nmdc:mga08y16_421564_c1
545 Ga0495601_0184231
546 Ga0495601_0272851
547 Ga0495619_0086086
548 Ga0495619_0358435
549 Ga0501082_0149788
550 Ga0501082_0185627
551 Ga0501082_0344431
552 Ga0466962_0276190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07722

Peptidase_C26

Peptidase C26

26

247

0.89

PF00117

GATase

Glutamine amidotransferase class-I

60

265

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fij-assembly1.cif.gz_B crystal structure of a uncharacterized protein lin1909 0.9522 1 243
3fij-assembly1.cif.gz_G crystal structure of a uncharacterized protein lin1909 0.9506 1 242
3fij-assembly1.cif.gz_B crystal structure of a uncharacterized protein lin1909 0.9438 1 243
3fij-assembly1.cif.gz_G crystal structure of a uncharacterized protein lin1909 0.9423 1 242
3fij-assembly1.cif.gz_F crystal structure of a uncharacterized protein lin1909 0.9399 1 243
ID Description Score Start End Superfamily
af_Q9HDV0_3_233_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9493 3 246 3.40.50.880
3fijG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9401 1 242 3.40.50.880
3fijG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9318 1 242 3.40.50.880
af_Q9HDV0_3_233_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9174 3 246 3.40.50.880
af_P76038_5_253_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.901 2 246 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7C6ING7-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.9765 34 245 GO:0005829
GO:0006541
GO:0006598
GO:0033969
AF-A0A1Q7UNQ3-F1-model_v4 Uncharacterized protein 0.9705 13 246 GO:0005829
GO:0006541
GO:0006598
GO:0033969
AF-A0A430FB05-F1-model_v4 Amidotransferase 0.9704 30 242 GO:0005829
GO:0006541
GO:0006598
GO:0016740
GO:0033969
AF-A0A380F1S2-F1-model_v4 deleted 0.969 47 243
AF-A0A0F2N8F7-F1-model_v4 Uncharacterized protein 0.9684 26 247 GO:0005829
GO:0006541
GO:0006598
GO:0033969

Map