F381063

General Info

Members Datasets Scaffolds Average Seq Length
276 145 266 204

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000037|Ga0105240_1000003711
Length 203
Sequence MFMADMYKYKTIAANATGDFRDRGSKFLAYAYPIQSVQEVKEKIQLLKKEHPKANHHCVAYRIGTDGTQYRASDDGEPAGSAGKPILGQIDSAELTNVLVVVVRYFGGTLLGVPGLINAYRIATQLALDSVEKTEKWIEDSVEINFDYPVMGEVLYLLKQSNATIYQQDLQLFCKIIAGIPHKNSGEYMQRLSEIRGVTVQEK

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
5 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
10 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
140 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
141 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
142 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
143 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
145 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.38
Metatranscriptomes 0
Isolates 3.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.61
Nodule 0
Rhizoplane 0.36
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 8.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005327 3300001989 Bacteria 4899
2 JGI24739J22299_10015573 3300001989 Bacteria 2763
3 JGI24737J22298_10000924 3300001990 Bacteria 10440
4 JGI24737J22298_10029884 3300001990 Unclassified 1707
5 JGI24737J22298_10031223 3300001990 Bacteria 1664
6 JGI24743J22301_10057510 3300001991 Bacteria 798
7 JGI24735J21928_10000269 3300002067 Bacteria 18209
8 JGI24735J21928_10009711 3300002067 Bacteria 3082
9 JGI24744J21845_10013871 3300002077 Bacteria 1624
10 JGI25162J39368_1000012 3300002737 Bacteria 373191
11 rootH1_10055866 3300003316 Bacteria 4017
12 rootH1_10162462 3300003316 Bacteria 2198
13 rootH2_10004581 3300003320 Bacteria 18930
14 rootH2_10130715 3300003320 Bacteria 3907
15 rootH2_10186287 3300003320 Bacteria 1545
16 rootL2_10001334 3300003322 Bacteria 5032
17 rootL2_10116239 3300003322 Bacteria 6455
18 rootH1_10003212 3300003323 Bacteria 182359
19 rootH1_10128263 3300003323 Bacteria 2765
20 rootH1_10206101 3300003323 Bacteria 6436
21 Ga0055529_1012111 3300003763 Bacteria 1106
22 Ga0065714_10097878 3300005288 Bacteria 1711
23 Ga0070658_10000019 3300005327 Bacteria 194742
24 Ga0070658_10170515 3300005327 Bacteria 1828
25 Ga0070658_10190327 3300005327 Unclassified 1729
26 Ga0070683_100037536 3300005329 Bacteria 4435
27 Ga0070680_100068575 3300005336 Bacteria 2911
28 Ga0068868_100059144 3300005338 Bacteria 3031
29 Ga0070660_100044092 3300005339 Bacteria 3410
30 Ga0070660_100096331 3300005339 Unclassified 2340
31 Ga0070660_100219452 3300005339 Bacteria 1545
32 Ga0070673_100141842 3300005364 Bacteria 2027
33 Ga0070659_100622118 3300005366 Bacteria 929
34 Ga0070678_100005020 3300005456 Bacteria 7587
35 Ga0070662_100000102 3300005457 Bacteria 47055
36 Ga0070662_100470843 3300005457 Bacteria 1045
37 Ga0070681_10014039 3300005458 Bacteria 7971
38 Ga0068867_100000116 3300005459 Bacteria 50447
39 Ga0070679_100001606 3300005530 Bacteria 20303
40 Ga0068853_100598065 3300005539 Bacteria 1047
41 Ga0070665_100000003 3300005548 Bacteria 811857
42 Ga0068855_100000152 3300005563 Bacteria 87996
43 Ga0068855_100001020 3300005563 Bacteria 34917
44 Ga0068855_100014677 3300005563 Bacteria 9435
45 Ga0068855_100044759 3300005563 Bacteria 5238
46 Ga0068855_100048916 3300005563 Bacteria 4989
47 Ga0068857_100316321 3300005577 Unclassified 1441
48 Ga0068856_100000262 3300005614 Bacteria 57470
49 Ga0068856_100001674 3300005614 Bacteria 23218
50 Ga0068856_100048818 3300005614 Bacteria 4172
51 Ga0068856_100195240 3300005614 Bacteria 2038
52 Ga0068852_100000326 3300005616 Bacteria 32458
53 Ga0068870_10174495 3300005840 Bacteria 1285
54 Ga0068858_100070755 3300005842 Bacteria 3234
55 Ga0068858_100605581 3300005842 Bacteria 1063
56 Ga0075366_10027771 3300006195 Bacteria 3321
57 Ga0075366_10037350 3300006195 Unclassified 2867
58 Ga0097621_100000089 3300006237 Bacteria 49511
59 Ga0075370_10214088 3300006353 Bacteria 1138
60 Ga0068871_100000216 3300006358 Bacteria 40288
61 Ga0068865_100000048 3300006881 Bacteria 67416
62 Ga0105240_10000037 3300009093 Bacteria 270462
63 Ga0105240_10000728 3300009093 Bacteria 60140
64 Ga0105240_10017374 3300009093 Bacteria 9697
65 Ga0105240_10023659 3300009093 Bacteria 8116
66 Ga0105240_10052494 3300009093 Bacteria 5124
67 Ga0105240_10076956 3300009093 Bacteria 4112
68 Ga0105240_10154384 3300009093 Bacteria 2732
69 Ga0105240_10237418 3300009093 Unclassified 2115
70 Ga0105240_10254920 3300009093 Bacteria 2027
71 Ga0105240_10266646 3300009093 Bacteria 1973
72 Ga0105240_10325477 3300009093 Bacteria 1750
73 Ga0105240_10399954 3300009093 Bacteria 1547
74 Ga0105240_10445245 3300009093 Bacteria 1451
75 Ga0105240_10523606 3300009093 Bacteria 1315
76 Ga0105240_10989682 3300009093 Bacteria 900
77 Ga0105243_10191316 3300009148 Bacteria 1787
78 Ga0105241_10001034 3300009174 Bacteria 21202
79 Ga0105241_10020526 3300009174 Bacteria 4882
80 Ga0105241_10112205 3300009174 Bacteria 2184
81 Ga0105241_10138963 3300009174 Bacteria 1976
82 Ga0105241_10209077 3300009174 Bacteria 1634
83 Ga0105241_10514671 3300009174 Bacteria 1069
84 Ga0105242_10121115 3300009176 Bacteria 2245
85 Ga0105237_10000574 3300009545 Bacteria 51427
86 Ga0105237_10000622 3300009545 Bacteria 49566
87 Ga0105237_10003791 3300009545 Bacteria 17772
88 Ga0105237_10013220 3300009545 Bacteria 8658
89 Ga0105237_10024669 3300009545 Bacteria 6150
90 Ga0105237_10059216 3300009545 Bacteria 3832
91 Ga0105237_10118051 3300009545 Bacteria 2646
92 Ga0105237_10168986 3300009545 Bacteria 2186
93 Ga0105238_10010541 3300009551 Bacteria 9281
94 Ga0105238_10034085 3300009551 Bacteria 5181
95 Ga0105238_10094327 3300009551 Bacteria 2980
96 Ga0105239_10000010 3300010375 Bacteria 341545
97 Ga0105239_10000117 3300010375 Bacteria 112291
98 Ga0105239_10000139 3300010375 Bacteria 102090
99 Ga0105239_10000260 3300010375 Bacteria 78701
100 Ga0105239_10001617 3300010375 Bacteria 29762
101 Ga0105239_10009794 3300010375 Bacteria 10768
102 Ga0105239_10039457 3300010375 Bacteria 5173
103 Ga0105239_10040855 3300010375 Bacteria 5083
104 Ga0105239_10235130 3300010375 Bacteria 2056
105 Ga0105239_10487505 3300010375 Bacteria 1401
106 Ga0157373_10000208 3300013100 Bacteria 48082
107 Ga0157373_10002412 3300013100 Bacteria 14211
108 Ga0157371_10008599 3300013102 Bacteria 8109
109 Ga0157371_10066369 3300013102 Unclassified 2555
110 Ga0157370_10042634 3300013104 Bacteria 4372
111 Ga0157369_10091161 3300013105 Bacteria 3254
112 Ga0157369_10224263 3300013105 Bacteria 1966
113 Ga0157374_10000306 3300013296 Bacteria 45513
114 Ga0157374_10000807 3300013296 Bacteria 27462
115 Ga0157374_10244690 3300013296 Bacteria 1764
116 Ga0157378_10034699 3300013297 Bacteria 4461
117 Ga0157378_10068680 3300013297 Bacteria 3178
118 Ga0163162_10000058 3300013306 Bacteria 108298
119 Ga0163162_10026133 3300013306 Bacteria 5769
120 Ga0163162_10072753 3300013306 Bacteria 3493
121 Ga0157372_10000181 3300013307 Bacteria 69472
122 Ga0157372_10001960 3300013307 Bacteria 22372
123 Ga0157372_10007623 3300013307 Bacteria 11510
124 Ga0157375_10107611 3300013308 Bacteria 2882
125 Ga0157375_10209805 3300013308 Bacteria 2105
126 Ga0157377_10005315 3300014745 Bacteria 6040
127 Ga0157376_10151796 3300014969 Bacteria 2090
128 Ga0157376_10757225 3300014969 Bacteria 981
129 Ga0163161_10064011 3300017792 Bacteria 2682
130 Ga0209437_100041 3300025233 Bacteria 444465
131 Ga0209026_1000361 3300025250 Bacteria 42722
132 Ga0209026_1001329 3300025250 Bacteria 11098
133 Ga0209026_1003269 3300025250 Bacteria 5427
134 Ga0209129_1020252 3300025258 Bacteria 1240
135 Ga0209233_1001384 3300025261 Bacteria 9623
136 Ga0209233_1008019 3300025261 Bacteria 3300
137 Ga0209455_1001813 3300025272 Bacteria 8968
138 Ga0207647_10000063 3300025904 Bacteria 83442
139 Ga0207647_10000332 3300025904 Bacteria 38845
140 Ga0207647_10067709 3300025904 Bacteria 2163
141 Ga0207647_10171819 3300025904 Bacteria 1262
142 Ga0207645_10000127 3300025907 Bacteria 58003
143 Ga0207643_10122840 3300025908 Bacteria 1539
144 Ga0207705_10000069 3300025909 Bacteria 133094
145 Ga0207705_10118043 3300025909 Bacteria 1966
146 Ga0207654_10005307 3300025911 Bacteria 6506
147 Ga0207654_10091824 3300025911 Bacteria 1853
148 Ga0207654_10120473 3300025911 Bacteria 1646
149 Ga0207707_10009531 3300025912 Bacteria 8425
150 Ga0207695_10000092 3300025913 Bacteria 270514
151 Ga0207695_10000189 3300025913 Bacteria 177142
152 Ga0207695_10001774 3300025913 Bacteria 34048
153 Ga0207695_10033178 3300025913 Bacteria 5637
154 Ga0207695_10039672 3300025913 Bacteria 5058
155 Ga0207695_10273804 3300025913 Bacteria 1583
156 Ga0207671_10002529 3300025914 Bacteria 19484
157 Ga0207671_10005609 3300025914 Bacteria 11516
158 Ga0207671_10011842 3300025914 Bacteria 7059
159 Ga0207671_10023931 3300025914 Bacteria 4599
160 Ga0207671_10028178 3300025914 Bacteria 4199
161 Ga0207671_10034910 3300025914 Bacteria 3735
162 Ga0207671_10099890 3300025914 Bacteria 2196
163 Ga0207657_10055494 3300025919 Bacteria 3421
164 Ga0207652_10124435 3300025921 Bacteria 2296
165 Ga0207694_10071375 3300025924 Bacteria 2713
166 Ga0207694_10094861 3300025924 Bacteria 2358
167 Ga0207690_10016477 3300025932 Bacteria 4497
168 Ga0207706_10000315 3300025933 Bacteria 52200
169 Ga0207706_10449080 3300025933 Bacteria 1115
170 Ga0207709_10118777 3300025935 Bacteria 1781
171 Ga0207704_10000046 3300025938 Bacteria 86187
172 Ga0207661_10007731 3300025944 Bacteria 7652
173 Ga0207667_10000009 3300025949 Bacteria 603135
174 Ga0207667_10000896 3300025949 Bacteria 37967
175 Ga0207667_10017492 3300025949 Bacteria 8067
176 Ga0207667_10034891 3300025949 Bacteria 5399
177 Ga0207651_10001203 3300025960 Bacteria 11590
178 Ga0207712_10650182 3300025961 Bacteria 916
179 Ga0207677_10109395 3300026023 Bacteria 2055
180 Ga0207703_10049944 3300026035 Bacteria 3383
181 Ga0207639_10035831 3300026041 Bacteria 3673
182 Ga0207639_10217927 3300026041 Bacteria 1647
183 Ga0207639_10617488 3300026041 Bacteria 1001
184 Ga0207702_10000492 3300026078 Bacteria 44456
185 Ga0207702_10063593 3300026078 Bacteria 3156
186 Ga0207702_10066329 3300026078 Bacteria 3093
187 Ga0207702_10338714 3300026078 Unclassified 1436
188 Ga0207648_10000257 3300026089 Bacteria 57438
189 Ga0207683_10010079 3300026121 Bacteria 8062
190 Ga0268266_10000078 3300028379 Bacteria 213632
191 Ga0307517_10001926 3300028786 Bacteria 33977
192 Ga0307517_10188119 3300028786 Bacteria 1317
193 Ga0307515_10000839 3300028794 Bacteria 70656
194 Ga0307515_10004603 3300028794 Bacteria 28374
195 Ga0307515_10199115 3300028794 Bacteria 1885
196 Ga0307509_10140303 3300031507 Bacteria 2354
197 Ga0307412_10066993 3300031911 Bacteria 2436
198 Ga0307507_10007373 3300033179 Bacteria 16056
199 Ga0307510_10000504 3300033180 Bacteria 38756
200 Ga0395899_0000001 3300037312 Bacteria 1750322
201 Ga0395899_0117495 3300037312 Bacteria 1907
202 Ga0395899_0158179 3300037312 Unclassified 1602
203 Ga0395900_0006437 3300037418 Bacteria 12240
204 Ga0395900_0065474 3300037418 Unclassified 3734
205 Ga0395898_0017338 3300037466 Bacteria 7356
206 Ga0395905_0004006 3300037471 Bacteria 15480
207 Ga0395905_0010191 3300037471 Bacteria 9159
208 Ga0395901_0008382 3300038443 Bacteria 10449
209 Ga0395901_0030415 3300038443 Bacteria 5563
210 Ga0436361_1105761 3300039447 Bacteria 5711
211 Ga0439448_0007752 3300042005 Bacteria 3119
212 Ga0466966_0147850 3300044684 Unclassified 1434
213 Ga0495638_0062000 3300046460 Bacteria 2309
214 Ga0495651_0019186 3300046462 Bacteria 5298
215 Ga0495650_0000003 3300046471 Bacteria 900730
216 Ga0495585_0000652 3300046492 Bacteria 31861
217 Ga0495585_0001978 3300046492 Bacteria 15240
218 Ga0495596_0103591 3300046500 Bacteria 1105
219 Ga0495606_0000143 3300046507 Bacteria 123231
220 Ga0495606_0015974 3300046507 Bacteria 5750
221 Ga0495606_0033492 3300046507 Bacteria 3543
222 Ga0495606_0224186 3300046507 Unclassified 1057
223 Ga0495610_0001797 3300046512 Bacteria 18695
224 Ga0495616_0011673 3300046513 Bacteria 5023
225 Ga0495616_0012269 3300046513 Bacteria 4870
226 Ga0495628_0129111 3300046516 Bacteria 1935
227 Ga0495648_0050822 3300046524 Bacteria 2530
228 Ga0495652_0277183 3300046529 Bacteria 1230
229 Ga0495652_0500675 3300046529 Bacteria 842
230 Ga0495609_0141496 3300046538 Bacteria 1026
231 Ga0495633_0000056 3300046558 Bacteria 149334
232 Ga0495668_0000003 3300046616 Bacteria 695023
233 Ga0495625_0000005 3300046660 Bacteria 596135
234 Ga0495625_0015928 3300046660 Bacteria 5932
235 Ga0495625_0017846 3300046660 Bacteria 5546
236 Ga0495625_0018958 3300046660 Bacteria 5354
237 Ga0495625_0037770 3300046660 Bacteria 3538
238 Ga0495625_0171488 3300046660 Bacteria 1448
239 Ga0495661_0000244 3300046665 Bacteria 62633
240 Ga0495661_0007899 3300046665 Bacteria 7391
241 Ga0495661_0018092 3300046665 Bacteria 4641
242 Ga0495658_0012145 3300046683 Bacteria 4351
243 Ga0495669_0248076 3300046684 Bacteria 855
244 Ga0495649_0000003 3300046694 Bacteria 880817
245 Ga0495649_0072647 3300046694 Bacteria 1844
246 Ga0495660_0164295 3300046810 Bacteria 1086
247 Ga0495660_0214211 3300046810 Bacteria 912
248 Ga0495687_000833 3300047443 Bacteria 32923
249 Ga0495687_003032 3300047443 Bacteria 12630
250 Ga0495677_0108164 3300047445 Unclassified 1056
251 Ga0495686_0000106 3300047472 Bacteria 175852
252 Ga0495686_0003562 3300047472 Bacteria 13388
253 Ga0495614_0082906 3300048089 Bacteria 1390
254 Ga0495678_004063 3300049459 Bacteria 8678
255 Ga0501044_1381601 3300049823 Unclassified 570
256 nmdc:mga0k408_116_c3 3300050493 Bacteria 24401
257 nmdc:mga0k408_1365_c1 3300050493 Bacteria 13162
258 nmdc:mga0k408_4755_c1 3300050493 Bacteria 7194
259 Ga0500635_0020569 3300053080 Bacteria 2023
260 Ga0500618_000001 3300053125 Bacteria 538477
261 Ga0500642_0039811 3300053130 Unclassified 2023
262 Ga0500564_058441 3300053138 Bacteria 1753
263 Ga0500616_0115639 3300053153 Bacteria 1289
264 Ga0500622_0001459 3300053156 Bacteria 18875
265 Ga0500622_0049283 3300053156 Bacteria 2172
266 Ga0500624_002640 3300053157 Bacteria 2399

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_1381601 Ga0501044_1381601_60_560 162
2 3300025913 Ga0207695_10000092 Ga0207695_10000092233 197
3 3300003320 rootH2_10186287 rootH2_101862871 199
4 3300009093 Ga0105240_10000037 Ga0105240_1000003711 199
5 3300009093 Ga0105240_10989682 Ga0105240_109896821 199
6 3300010375 Ga0105239_10000260 Ga0105239_1000026070 199
7 3300003323 rootH1_10206101 rootH1_102061013 200
8 3300009093 Ga0105240_10000728 Ga0105240_1000072842 200
9 3300009545 Ga0105237_10000622 Ga0105237_1000062214 200
10 3300009551 Ga0105238_10094327 Ga0105238_100943273 200
11 3300010375 Ga0105239_10001617 Ga0105239_100016177 200
12 3300014969 Ga0157376_10757225 Ga0157376_107572251 200
13 3300025261 Ga0209233_1008019 Ga0209233_10080192 200
14 3300025911 Ga0207654_10091824 Ga0207654_100918242 200
15 3300025913 Ga0207695_10000189 Ga0207695_10000189123 200
16 3300025914 Ga0207671_10002529 Ga0207671_100025294 200
17 3300037312 Ga0395899_0000001 Ga0395899_0000001_1586629_1587237 200
18 3300044684 Ga0466966_0147850 Ga0466966_0147850_378_986 200
19 iso_pu_bacteria 2599185184 2599477937 200
20 iso_pu_bacteria 2852623160 2852623633 200
21 iso_pu_bacteria 2884933994 2884937463 200
22 iso_pu_bacteria 2919437846 2919439205 200
23 iso_pu_bacteria 2928078545 2928079897 200
24 iso_pu_bacteria 2928147474 2928147649 200
25 iso_pu_bacteria 2932082852 2932083683 200
26 iso_pu_bacteria 2977232053 2977232868 200
27 iso_pu_bacteria 2896317667 2896318342 201
28 iso_pu_bacteria 2896344016 2896345790 201
29 3300005842 Ga0068858_100070755 Ga0068858_1000707552 203
30 3300026035 Ga0207703_10049944 Ga0207703_100499442 203
31 3300001989 JGI24739J22299_10005327 JGI24739J22299_100053274 204
32 3300001989 JGI24739J22299_10015573 JGI24739J22299_100155733 204
33 3300001990 JGI24737J22298_10000924 JGI24737J22298_1000092410 204
34 3300001990 JGI24737J22298_10029884 JGI24737J22298_100298841 204
35 3300001990 JGI24737J22298_10031223 JGI24737J22298_100312232 204
36 3300001991 JGI24743J22301_10057510 JGI24743J22301_100575101 204
37 3300002067 JGI24735J21928_10000269 JGI24735J21928_1000026911 204
38 3300002067 JGI24735J21928_10009711 JGI24735J21928_100097112 204
39 3300002077 JGI24744J21845_10013871 JGI24744J21845_100138712 204
40 3300002737 JGI25162J39368_1000012 JGI25162J39368_100001287 204
41 3300003316 rootH1_10055866 rootH1_100558663 204
42 3300003316 rootH1_10162462 rootH1_101624622 204
43 3300003320 rootH2_10004581 rootH2_100045819 204
44 3300003320 rootH2_10130715 rootH2_101307153 204
45 3300003322 rootL2_10001334 rootL2_100013343 204
46 3300003322 rootL2_10116239 rootL2_101162398 204
47 3300003323 rootH1_10003212 rootH1_1000321268 204
48 3300003323 rootH1_10128263 rootH1_101282632 204
49 3300003763 Ga0055529_1012111 Ga0055529_10121112 204
50 3300005288 Ga0065714_10097878 Ga0065714_100978783 204
51 3300005327 Ga0070658_10000019 Ga0070658_10000019116 204
52 3300005327 Ga0070658_10170515 Ga0070658_101705153 204
53 3300005327 Ga0070658_10190327 Ga0070658_101903272 204
54 3300005329 Ga0070683_100037536 Ga0070683_1000375365 204
55 3300005336 Ga0070680_100068575 Ga0070680_1000685752 204
56 3300005338 Ga0068868_100059144 Ga0068868_1000591443 204
57 3300005339 Ga0070660_100044092 Ga0070660_1000440923 204
58 3300005339 Ga0070660_100096331 Ga0070660_1000963312 204
59 3300005339 Ga0070660_100219452 Ga0070660_1002194522 204
60 3300005364 Ga0070673_100141842 Ga0070673_1001418422 204
61 3300005366 Ga0070659_100622118 Ga0070659_1006221181 204
62 3300005456 Ga0070678_100005020 Ga0070678_1000050206 204
63 3300005457 Ga0070662_100000102 Ga0070662_10000010221 204
64 3300005457 Ga0070662_100470843 Ga0070662_1004708432 204
65 3300005458 Ga0070681_10014039 Ga0070681_100140393 204
66 3300005459 Ga0068867_100000116 Ga0068867_10000011634 204
67 3300005530 Ga0070679_100001606 Ga0070679_1000016067 204
68 3300005539 Ga0068853_100598065 Ga0068853_1005980652 204
69 3300005548 Ga0070665_100000003 Ga0070665_100000003376 204
70 3300005563 Ga0068855_100000152 Ga0068855_1000001524 204
71 3300005563 Ga0068855_100001020 Ga0068855_10000102027 204
72 3300005563 Ga0068855_100014677 Ga0068855_1000146776 204
73 3300005563 Ga0068855_100044759 Ga0068855_1000447591 204
74 3300005563 Ga0068855_100048916 Ga0068855_1000489163 204
75 3300005577 Ga0068857_100316321 Ga0068857_1003163212 204
76 3300005614 Ga0068856_100000262 Ga0068856_10000026236 204
77 3300005614 Ga0068856_100001674 Ga0068856_10000167417 204
78 3300005614 Ga0068856_100048818 Ga0068856_1000488183 204
79 3300005614 Ga0068856_100195240 Ga0068856_1001952403 204
80 3300005616 Ga0068852_100000326 Ga0068852_1000003266 204
81 3300005840 Ga0068870_10174495 Ga0068870_101744952 204
82 3300005842 Ga0068858_100605581 Ga0068858_1006055812 204
83 3300006195 Ga0075366_10027771 Ga0075366_100277712 204
84 3300006195 Ga0075366_10037350 Ga0075366_100373503 204
85 3300006237 Ga0097621_100000089 Ga0097621_1000000898 204
86 3300006353 Ga0075370_10214088 Ga0075370_102140882 204
87 3300006358 Ga0068871_100000216 Ga0068871_10000021633 204
88 3300006881 Ga0068865_100000048 Ga0068865_10000004857 204
89 3300009093 Ga0105240_10017374 Ga0105240_100173746 204
90 3300009093 Ga0105240_10023659 Ga0105240_100236598 204
91 3300009093 Ga0105240_10052494 Ga0105240_100524944 204
92 3300009093 Ga0105240_10076956 Ga0105240_100769561 204
93 3300009093 Ga0105240_10154384 Ga0105240_101543843 204
94 3300009093 Ga0105240_10237418 Ga0105240_102374183 204
95 3300009093 Ga0105240_10254920 Ga0105240_102549202 204
96 3300009093 Ga0105240_10266646 Ga0105240_102666462 204
97 3300009093 Ga0105240_10325477 Ga0105240_103254772 204
98 3300009093 Ga0105240_10399954 Ga0105240_103999542 204
99 3300009093 Ga0105240_10445245 Ga0105240_104452452 204
100 3300009093 Ga0105240_10523606 Ga0105240_105236062 204
101 3300009148 Ga0105243_10191316 Ga0105243_101913162 204
102 3300009174 Ga0105241_10001034 Ga0105241_100010348 204
103 3300009174 Ga0105241_10020526 Ga0105241_100205261 204
104 3300009174 Ga0105241_10112205 Ga0105241_101122052 204
105 3300009174 Ga0105241_10138963 Ga0105241_101389633 204
106 3300009174 Ga0105241_10209077 Ga0105241_102090772 204
107 3300009174 Ga0105241_10514671 Ga0105241_105146711 204
108 3300009176 Ga0105242_10121115 Ga0105242_101211153 204
109 3300009545 Ga0105237_10000574 Ga0105237_1000057411 204
110 3300009545 Ga0105237_10003791 Ga0105237_1000379118 204
111 3300009545 Ga0105237_10013220 Ga0105237_100132206 204
112 3300009545 Ga0105237_10024669 Ga0105237_100246692 204
113 3300009545 Ga0105237_10059216 Ga0105237_100592162 204
114 3300009545 Ga0105237_10118051 Ga0105237_101180513 204
115 3300009545 Ga0105237_10168986 Ga0105237_101689863 204
116 3300009551 Ga0105238_10010541 Ga0105238_100105416 204
117 3300009551 Ga0105238_10034085 Ga0105238_100340857 204
118 3300010375 Ga0105239_10000010 Ga0105239_10000010117 204
119 3300010375 Ga0105239_10000117 Ga0105239_1000011751 204
120 3300010375 Ga0105239_10000139 Ga0105239_1000013946 204
121 3300010375 Ga0105239_10009794 Ga0105239_100097946 204
122 3300010375 Ga0105239_10039457 Ga0105239_100394572 204
123 3300010375 Ga0105239_10040855 Ga0105239_100408556 204
124 3300010375 Ga0105239_10235130 Ga0105239_102351301 204
125 3300010375 Ga0105239_10487505 Ga0105239_104875052 204
126 3300013100 Ga0157373_10000208 Ga0157373_1000020853 204
127 3300013100 Ga0157373_10002412 Ga0157373_100024123 204
128 3300013102 Ga0157371_10008599 Ga0157371_100085995 204
129 3300013102 Ga0157371_10066369 Ga0157371_100663693 204
130 3300013104 Ga0157370_10042634 Ga0157370_100426342 204
131 3300013105 Ga0157369_10091161 Ga0157369_100911613 204
132 3300013105 Ga0157369_10224263 Ga0157369_102242632 204
133 3300013296 Ga0157374_10000306 Ga0157374_1000030625 204
134 3300013296 Ga0157374_10000807 Ga0157374_100008074 204
135 3300013296 Ga0157374_10244690 Ga0157374_102446902 204
136 3300013297 Ga0157378_10034699 Ga0157378_100346992 204
137 3300013297 Ga0157378_10068680 Ga0157378_100686802 204
138 3300013306 Ga0163162_10000058 Ga0163162_1000005870 204
139 3300013306 Ga0163162_10026133 Ga0163162_100261335 204
140 3300013306 Ga0163162_10072753 Ga0163162_100727533 204
141 3300013307 Ga0157372_10000181 Ga0157372_1000018147 204
142 3300013307 Ga0157372_10001960 Ga0157372_1000196017 204
143 3300013307 Ga0157372_10007623 Ga0157372_100076237 204
144 3300013308 Ga0157375_10107611 Ga0157375_101076112 204
145 3300013308 Ga0157375_10209805 Ga0157375_102098052 204
146 3300014745 Ga0157377_10005315 Ga0157377_100053155 204
147 3300014969 Ga0157376_10151796 Ga0157376_101517962 204
148 3300017792 Ga0163161_10064011 Ga0163161_100640114 204
149 3300025233 Ga0209437_100041 Ga0209437_100041132 204
150 3300025250 Ga0209026_1000361 Ga0209026_10003614 204
151 3300025250 Ga0209026_1001329 Ga0209026_10013292 204
152 3300025250 Ga0209026_1003269 Ga0209026_10032694 204
153 3300025258 Ga0209129_1020252 Ga0209129_10202522 204
154 3300025261 Ga0209233_1001384 Ga0209233_10013843 204
155 3300025272 Ga0209455_1001813 Ga0209455_10018134 204
156 3300025904 Ga0207647_10000063 Ga0207647_1000006347 204
157 3300025904 Ga0207647_10000332 Ga0207647_1000033211 204
158 3300025904 Ga0207647_10067709 Ga0207647_100677093 204
159 3300025904 Ga0207647_10171819 Ga0207647_101718192 204
160 3300025907 Ga0207645_10000127 Ga0207645_1000012735 204
161 3300025908 Ga0207643_10122840 Ga0207643_101228402 204
162 3300025909 Ga0207705_10000069 Ga0207705_10000069118 204
163 3300025909 Ga0207705_10118043 Ga0207705_101180432 204
164 3300025911 Ga0207654_10005307 Ga0207654_100053075 204
165 3300025911 Ga0207654_10120473 Ga0207654_101204732 204
166 3300025912 Ga0207707_10009531 Ga0207707_100095317 204
167 3300025913 Ga0207695_10001774 Ga0207695_100017748 204
168 3300025913 Ga0207695_10033178 Ga0207695_100331781 204
169 3300025913 Ga0207695_10039672 Ga0207695_100396724 204
170 3300025913 Ga0207695_10273804 Ga0207695_102738042 204
171 3300025914 Ga0207671_10005609 Ga0207671_100056093 204
172 3300025914 Ga0207671_10011842 Ga0207671_100118425 204
173 3300025914 Ga0207671_10023931 Ga0207671_100239313 204
174 3300025914 Ga0207671_10028178 Ga0207671_100281782 204
175 3300025914 Ga0207671_10034910 Ga0207671_100349102 204
176 3300025914 Ga0207671_10099890 Ga0207671_100998902 204
177 3300025919 Ga0207657_10055494 Ga0207657_100554943 204
178 3300025921 Ga0207652_10124435 Ga0207652_101244352 204
179 3300025924 Ga0207694_10071375 Ga0207694_100713752 204
180 3300025924 Ga0207694_10094861 Ga0207694_100948612 204
181 3300025932 Ga0207690_10016477 Ga0207690_100164772 204
182 3300025933 Ga0207706_10000315 Ga0207706_1000031519 204
183 3300025933 Ga0207706_10449080 Ga0207706_104490802 204
184 3300025935 Ga0207709_10118777 Ga0207709_101187772 204
185 3300025938 Ga0207704_10000046 Ga0207704_1000004660 204
186 3300025944 Ga0207661_10007731 Ga0207661_100077317 204
187 3300025949 Ga0207667_10000009 Ga0207667_1000000963 204
188 3300025949 Ga0207667_10000896 Ga0207667_1000089623 204
189 3300025949 Ga0207667_10017492 Ga0207667_100174922 204
190 3300025949 Ga0207667_10034891 Ga0207667_100348914 204
191 3300025960 Ga0207651_10001203 Ga0207651_100012036 204
192 3300025961 Ga0207712_10650182 Ga0207712_106501822 204
193 3300026023 Ga0207677_10109395 Ga0207677_101093952 204
194 3300026041 Ga0207639_10035831 Ga0207639_100358312 204
195 3300026041 Ga0207639_10217927 Ga0207639_102179272 204
196 3300026041 Ga0207639_10617488 Ga0207639_106174882 204
197 3300026078 Ga0207702_10000492 Ga0207702_1000049219 204
198 3300026078 Ga0207702_10063593 Ga0207702_100635933 204
199 3300026078 Ga0207702_10066329 Ga0207702_100663292 204
200 3300026078 Ga0207702_10338714 Ga0207702_103387142 204
201 3300026089 Ga0207648_10000257 Ga0207648_1000025716 204
202 3300026121 Ga0207683_10010079 Ga0207683_100100797 204
203 3300028379 Ga0268266_10000078 Ga0268266_10000078166 204
204 3300028786 Ga0307517_10001926 Ga0307517_100019268 204
205 3300028786 Ga0307517_10188119 Ga0307517_101881192 204
206 3300028794 Ga0307515_10000839 Ga0307515_100008394 204
207 3300028794 Ga0307515_10004603 Ga0307515_100046034 204
208 3300028794 Ga0307515_10199115 Ga0307515_101991151 204
209 3300031507 Ga0307509_10140303 Ga0307509_101403032 204
210 3300031911 Ga0307412_10066993 Ga0307412_100669932 204
211 3300033179 Ga0307507_10007373 Ga0307507_100073735 204
212 3300033180 Ga0307510_10000504 Ga0307510_1000050431 204
213 3300037312 Ga0395899_0117495 Ga0395899_0117495_877_1491 204
214 3300037312 Ga0395899_0158179 Ga0395899_0158179_813_1427 204
215 3300037418 Ga0395900_0006437 Ga0395900_0006437_1981_2595 204
216 3300037418 Ga0395900_0065474 Ga0395900_0065474_625_1239 204
217 3300037466 Ga0395898_0017338 Ga0395898_0017338_679_1293 204
218 3300037471 Ga0395905_0004006 Ga0395905_0004006_8963_9577 204
219 3300037471 Ga0395905_0010191 Ga0395905_0010191_6119_6733 204
220 3300038443 Ga0395901_0008382 Ga0395901_0008382_1843_2457 204
221 3300038443 Ga0395901_0030415 Ga0395901_0030415_3503_4117 204
222 3300039447 Ga0436361_1105761 Ga0436361_1105761_3514_4128 204
223 3300042005 Ga0439448_0007752 Ga0439448_0007752_1083_1697 204
224 3300046460 Ga0495638_0062000 Ga0495638_0062000_58_672 204
225 3300046462 Ga0495651_0019186 Ga0495651_0019186_872_1486 204
226 3300046471 Ga0495650_0000003 Ga0495650_0000003_38537_39151 204
227 3300046492 Ga0495585_0000652 Ga0495585_0000652_24564_25178 204
228 3300046492 Ga0495585_0001978 Ga0495585_0001978_11555_12169 204
229 3300046500 Ga0495596_0103591 Ga0495596_0103591_440_1054 204
230 3300046507 Ga0495606_0000143 Ga0495606_0000143_108435_109049 204
231 3300046507 Ga0495606_0015974 Ga0495606_0015974_3824_4438 204
232 3300046507 Ga0495606_0033492 Ga0495606_0033492_848_1462 204
233 3300046507 Ga0495606_0224186 Ga0495606_0224186_390_1004 204
234 3300046512 Ga0495610_0001797 Ga0495610_0001797_11501_12115 204
235 3300046513 Ga0495616_0011673 Ga0495616_0011673_1081_1695 204
236 3300046513 Ga0495616_0012269 Ga0495616_0012269_2793_3407 204
237 3300046516 Ga0495628_0129111 Ga0495628_0129111_18_632 204
238 3300046524 Ga0495648_0050822 Ga0495648_0050822_654_1268 204
239 3300046529 Ga0495652_0277183 Ga0495652_0277183_188_802 204
240 3300046529 Ga0495652_0500675 Ga0495652_0500675_91_705 204
241 3300046538 Ga0495609_0141496 Ga0495609_0141496_123_737 204
242 3300046558 Ga0495633_0000056 Ga0495633_0000056_138277_138891 204
243 3300046616 Ga0495668_0000003 Ga0495668_0000003_171706_172320 204
244 3300046660 Ga0495625_0000005 Ga0495625_0000005_155737_156351 204
245 3300046660 Ga0495625_0015928 Ga0495625_0015928_2267_2881 204
246 3300046660 Ga0495625_0017846 Ga0495625_0017846_1841_2455 204
247 3300046660 Ga0495625_0018958 Ga0495625_0018958_182_862 204
248 3300046660 Ga0495625_0037770 Ga0495625_0037770_454_1068 204
249 3300046660 Ga0495625_0171488 Ga0495625_0171488_773_1387 204
250 3300046665 Ga0495661_0000244 Ga0495661_0000244_19782_20396 204
251 3300046665 Ga0495661_0007899 Ga0495661_0007899_5434_6048 204
252 3300046665 Ga0495661_0018092 Ga0495661_0018092_970_1584 204
253 3300046683 Ga0495658_0012145 Ga0495658_0012145_2438_3052 204
254 3300046684 Ga0495669_0248076 Ga0495669_0248076_175_789 204
255 3300046694 Ga0495649_0000003 Ga0495649_0000003_155758_156372 204
256 3300046694 Ga0495649_0072647 Ga0495649_0072647_997_1611 204
257 3300046810 Ga0495660_0164295 Ga0495660_0164295_296_910 204
258 3300046810 Ga0495660_0214211 Ga0495660_0214211_23_637 204
259 3300047443 Ga0495687_000833 Ga0495687_000833_10630_11244 204
260 3300047443 Ga0495687_003032 Ga0495687_003032_3597_4211 204
261 3300047445 Ga0495677_0108164 Ga0495677_0108164_245_859 204
262 3300047472 Ga0495686_0000106 Ga0495686_0000106_159568_160182 204
263 3300047472 Ga0495686_0003562 Ga0495686_0003562_1711_2325 204
264 3300048089 Ga0495614_0082906 Ga0495614_0082906_434_1048 204
265 3300049459 Ga0495678_004063 Ga0495678_004063_7447_8061 204
266 3300050493 nmdc:mga0k408_116_c3 nmdc:mga0k408_116_c3_22677_23291 204
267 3300050493 nmdc:mga0k408_1365_c1 nmdc:mga0k408_1365_c1_5529_6143 204
268 3300050493 nmdc:mga0k408_4755_c1 nmdc:mga0k408_4755_c1_5524_6138 204
269 3300053080 Ga0500635_0020569 Ga0500635_0020569_769_1383 204
270 3300053125 Ga0500618_000001 Ga0500618_000001_152551_153165 204
271 3300053130 Ga0500642_0039811 Ga0500642_0039811_722_1336 204
272 3300053138 Ga0500564_058441 Ga0500564_058441_834_1448 204
273 3300053153 Ga0500616_0115639 Ga0500616_0115639_249_863 204
274 3300053156 Ga0500622_0001459 Ga0500622_0001459_2137_2751 204
275 3300053156 Ga0500622_0049283 Ga0500622_0049283_1025_1639 204
276 3300053157 Ga0500624_002640 Ga0500624_002640_541_1155 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01205

UPF0029

Uncharacterized protein family UPF0029

23

128

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oya-assembly1.cif.gz_v2 cryo-em structure of the 1 hpf zebrafish embryo 80s ribosome 0.8588 139 199
4rwx-assembly1.cif.gz_C crystal structure of l. monocytogenes psta 0.8477 138 200
4rww-assembly1.cif.gz_C crystal structure of l. monocytogenes psta in complex with cyclic-di-amp 0.8356 138 200
1hwu-assembly3.cif.gz_E-2 structure of pii protein from herbaspirillum seropedicae 0.8303 138 202
6wue-assembly1.cif.gz_A-2 tetragonal crystal form of sbtb from synechocystis pcc6803 0.828 137 202
ID Description Score Start End Superfamily
af_Q2G059_1_130_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9642 7 132 3.30.230.30
af_Q6ZJC5_65_187_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9625 7 132 3.30.230.30
af_P27862_1_132_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9521 7 132 3.30.230.30
af_Q6ZJC5_65_187_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9399 7 132 3.30.230.30
af_Q2G059_1_130_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9284 7 132 3.30.230.30
ID Description Score Start End GO Terms
AF-A0A7C6L6S6-F1-model_v4 YigZ family protein 0.988 5 135 GO:0005737
GO:0006446
AF-R6AAA1-F1-model_v4 deleted 0.9846 137 199
AF-A0A2N5Z835-F1-model_v4 YigZ family protein 0.9827 1 135 GO:0005737
GO:0006446
AF-A0A7V4GVI3-F1-model_v4 YigZ family protein 0.9779 4 117 GO:0005737
GO:0006446
AF-A0A642C4B1-F1-model_v4 YigZ family protein 0.9718 46 202 GO:0005737
GO:0006446

Feature Viewer

pLDDT pTM Quality
92.6 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map