F381063
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 276 | 145 | 266 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10000037|Ga0105240_1000003711 |
| Length | 203 |
| Sequence | MFMADMYKYKTIAANATGDFRDRGSKFLAYAYPIQSVQEVKEKIQLLKKEHPKANHHCVAYRIGTDGTQYRASDDGEPAGSAGKPILGQIDSAELTNVLVVVVRYFGGTLLGVPGLINAYRIATQLALDSVEKTEKWIEDSVEINFDYPVMGEVLYLLKQSNATIYQQDLQLFCKIIAGIPHKNSGEYMQRLSEIRGVTVQEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 3 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 4 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 5 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 6 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 7 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 8 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 9 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 10 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 99 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 100 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 101 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 102 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 103 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 104 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 107 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 108 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 109 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 110 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 111 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 112 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 139 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 140 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 141 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 142 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 143 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 144 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 145 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.38 |
| Metatranscriptomes | 0 |
| Isolates | 3.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.61 |
| Nodule | 0 |
| Rhizoplane | 0.36 |
| Rhizosphere | 83.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10005327 | 3300001989 | Bacteria | 4899 |
| 2 | JGI24739J22299_10015573 | 3300001989 | Bacteria | 2763 |
| 3 | JGI24737J22298_10000924 | 3300001990 | Bacteria | 10440 |
| 4 | JGI24737J22298_10029884 | 3300001990 | Unclassified | 1707 |
| 5 | JGI24737J22298_10031223 | 3300001990 | Bacteria | 1664 |
| 6 | JGI24743J22301_10057510 | 3300001991 | Bacteria | 798 |
| 7 | JGI24735J21928_10000269 | 3300002067 | Bacteria | 18209 |
| 8 | JGI24735J21928_10009711 | 3300002067 | Bacteria | 3082 |
| 9 | JGI24744J21845_10013871 | 3300002077 | Bacteria | 1624 |
| 10 | JGI25162J39368_1000012 | 3300002737 | Bacteria | 373191 |
| 11 | rootH1_10055866 | 3300003316 | Bacteria | 4017 |
| 12 | rootH1_10162462 | 3300003316 | Bacteria | 2198 |
| 13 | rootH2_10004581 | 3300003320 | Bacteria | 18930 |
| 14 | rootH2_10130715 | 3300003320 | Bacteria | 3907 |
| 15 | rootH2_10186287 | 3300003320 | Bacteria | 1545 |
| 16 | rootL2_10001334 | 3300003322 | Bacteria | 5032 |
| 17 | rootL2_10116239 | 3300003322 | Bacteria | 6455 |
| 18 | rootH1_10003212 | 3300003323 | Bacteria | 182359 |
| 19 | rootH1_10128263 | 3300003323 | Bacteria | 2765 |
| 20 | rootH1_10206101 | 3300003323 | Bacteria | 6436 |
| 21 | Ga0055529_1012111 | 3300003763 | Bacteria | 1106 |
| 22 | Ga0065714_10097878 | 3300005288 | Bacteria | 1711 |
| 23 | Ga0070658_10000019 | 3300005327 | Bacteria | 194742 |
| 24 | Ga0070658_10170515 | 3300005327 | Bacteria | 1828 |
| 25 | Ga0070658_10190327 | 3300005327 | Unclassified | 1729 |
| 26 | Ga0070683_100037536 | 3300005329 | Bacteria | 4435 |
| 27 | Ga0070680_100068575 | 3300005336 | Bacteria | 2911 |
| 28 | Ga0068868_100059144 | 3300005338 | Bacteria | 3031 |
| 29 | Ga0070660_100044092 | 3300005339 | Bacteria | 3410 |
| 30 | Ga0070660_100096331 | 3300005339 | Unclassified | 2340 |
| 31 | Ga0070660_100219452 | 3300005339 | Bacteria | 1545 |
| 32 | Ga0070673_100141842 | 3300005364 | Bacteria | 2027 |
| 33 | Ga0070659_100622118 | 3300005366 | Bacteria | 929 |
| 34 | Ga0070678_100005020 | 3300005456 | Bacteria | 7587 |
| 35 | Ga0070662_100000102 | 3300005457 | Bacteria | 47055 |
| 36 | Ga0070662_100470843 | 3300005457 | Bacteria | 1045 |
| 37 | Ga0070681_10014039 | 3300005458 | Bacteria | 7971 |
| 38 | Ga0068867_100000116 | 3300005459 | Bacteria | 50447 |
| 39 | Ga0070679_100001606 | 3300005530 | Bacteria | 20303 |
| 40 | Ga0068853_100598065 | 3300005539 | Bacteria | 1047 |
| 41 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 42 | Ga0068855_100000152 | 3300005563 | Bacteria | 87996 |
| 43 | Ga0068855_100001020 | 3300005563 | Bacteria | 34917 |
| 44 | Ga0068855_100014677 | 3300005563 | Bacteria | 9435 |
| 45 | Ga0068855_100044759 | 3300005563 | Bacteria | 5238 |
| 46 | Ga0068855_100048916 | 3300005563 | Bacteria | 4989 |
| 47 | Ga0068857_100316321 | 3300005577 | Unclassified | 1441 |
| 48 | Ga0068856_100000262 | 3300005614 | Bacteria | 57470 |
| 49 | Ga0068856_100001674 | 3300005614 | Bacteria | 23218 |
| 50 | Ga0068856_100048818 | 3300005614 | Bacteria | 4172 |
| 51 | Ga0068856_100195240 | 3300005614 | Bacteria | 2038 |
| 52 | Ga0068852_100000326 | 3300005616 | Bacteria | 32458 |
| 53 | Ga0068870_10174495 | 3300005840 | Bacteria | 1285 |
| 54 | Ga0068858_100070755 | 3300005842 | Bacteria | 3234 |
| 55 | Ga0068858_100605581 | 3300005842 | Bacteria | 1063 |
| 56 | Ga0075366_10027771 | 3300006195 | Bacteria | 3321 |
| 57 | Ga0075366_10037350 | 3300006195 | Unclassified | 2867 |
| 58 | Ga0097621_100000089 | 3300006237 | Bacteria | 49511 |
| 59 | Ga0075370_10214088 | 3300006353 | Bacteria | 1138 |
| 60 | Ga0068871_100000216 | 3300006358 | Bacteria | 40288 |
| 61 | Ga0068865_100000048 | 3300006881 | Bacteria | 67416 |
| 62 | Ga0105240_10000037 | 3300009093 | Bacteria | 270462 |
| 63 | Ga0105240_10000728 | 3300009093 | Bacteria | 60140 |
| 64 | Ga0105240_10017374 | 3300009093 | Bacteria | 9697 |
| 65 | Ga0105240_10023659 | 3300009093 | Bacteria | 8116 |
| 66 | Ga0105240_10052494 | 3300009093 | Bacteria | 5124 |
| 67 | Ga0105240_10076956 | 3300009093 | Bacteria | 4112 |
| 68 | Ga0105240_10154384 | 3300009093 | Bacteria | 2732 |
| 69 | Ga0105240_10237418 | 3300009093 | Unclassified | 2115 |
| 70 | Ga0105240_10254920 | 3300009093 | Bacteria | 2027 |
| 71 | Ga0105240_10266646 | 3300009093 | Bacteria | 1973 |
| 72 | Ga0105240_10325477 | 3300009093 | Bacteria | 1750 |
| 73 | Ga0105240_10399954 | 3300009093 | Bacteria | 1547 |
| 74 | Ga0105240_10445245 | 3300009093 | Bacteria | 1451 |
| 75 | Ga0105240_10523606 | 3300009093 | Bacteria | 1315 |
| 76 | Ga0105240_10989682 | 3300009093 | Bacteria | 900 |
| 77 | Ga0105243_10191316 | 3300009148 | Bacteria | 1787 |
| 78 | Ga0105241_10001034 | 3300009174 | Bacteria | 21202 |
| 79 | Ga0105241_10020526 | 3300009174 | Bacteria | 4882 |
| 80 | Ga0105241_10112205 | 3300009174 | Bacteria | 2184 |
| 81 | Ga0105241_10138963 | 3300009174 | Bacteria | 1976 |
| 82 | Ga0105241_10209077 | 3300009174 | Bacteria | 1634 |
| 83 | Ga0105241_10514671 | 3300009174 | Bacteria | 1069 |
| 84 | Ga0105242_10121115 | 3300009176 | Bacteria | 2245 |
| 85 | Ga0105237_10000574 | 3300009545 | Bacteria | 51427 |
| 86 | Ga0105237_10000622 | 3300009545 | Bacteria | 49566 |
| 87 | Ga0105237_10003791 | 3300009545 | Bacteria | 17772 |
| 88 | Ga0105237_10013220 | 3300009545 | Bacteria | 8658 |
| 89 | Ga0105237_10024669 | 3300009545 | Bacteria | 6150 |
| 90 | Ga0105237_10059216 | 3300009545 | Bacteria | 3832 |
| 91 | Ga0105237_10118051 | 3300009545 | Bacteria | 2646 |
| 92 | Ga0105237_10168986 | 3300009545 | Bacteria | 2186 |
| 93 | Ga0105238_10010541 | 3300009551 | Bacteria | 9281 |
| 94 | Ga0105238_10034085 | 3300009551 | Bacteria | 5181 |
| 95 | Ga0105238_10094327 | 3300009551 | Bacteria | 2980 |
| 96 | Ga0105239_10000010 | 3300010375 | Bacteria | 341545 |
| 97 | Ga0105239_10000117 | 3300010375 | Bacteria | 112291 |
| 98 | Ga0105239_10000139 | 3300010375 | Bacteria | 102090 |
| 99 | Ga0105239_10000260 | 3300010375 | Bacteria | 78701 |
| 100 | Ga0105239_10001617 | 3300010375 | Bacteria | 29762 |
| 101 | Ga0105239_10009794 | 3300010375 | Bacteria | 10768 |
| 102 | Ga0105239_10039457 | 3300010375 | Bacteria | 5173 |
| 103 | Ga0105239_10040855 | 3300010375 | Bacteria | 5083 |
| 104 | Ga0105239_10235130 | 3300010375 | Bacteria | 2056 |
| 105 | Ga0105239_10487505 | 3300010375 | Bacteria | 1401 |
| 106 | Ga0157373_10000208 | 3300013100 | Bacteria | 48082 |
| 107 | Ga0157373_10002412 | 3300013100 | Bacteria | 14211 |
| 108 | Ga0157371_10008599 | 3300013102 | Bacteria | 8109 |
| 109 | Ga0157371_10066369 | 3300013102 | Unclassified | 2555 |
| 110 | Ga0157370_10042634 | 3300013104 | Bacteria | 4372 |
| 111 | Ga0157369_10091161 | 3300013105 | Bacteria | 3254 |
| 112 | Ga0157369_10224263 | 3300013105 | Bacteria | 1966 |
| 113 | Ga0157374_10000306 | 3300013296 | Bacteria | 45513 |
| 114 | Ga0157374_10000807 | 3300013296 | Bacteria | 27462 |
| 115 | Ga0157374_10244690 | 3300013296 | Bacteria | 1764 |
| 116 | Ga0157378_10034699 | 3300013297 | Bacteria | 4461 |
| 117 | Ga0157378_10068680 | 3300013297 | Bacteria | 3178 |
| 118 | Ga0163162_10000058 | 3300013306 | Bacteria | 108298 |
| 119 | Ga0163162_10026133 | 3300013306 | Bacteria | 5769 |
| 120 | Ga0163162_10072753 | 3300013306 | Bacteria | 3493 |
| 121 | Ga0157372_10000181 | 3300013307 | Bacteria | 69472 |
| 122 | Ga0157372_10001960 | 3300013307 | Bacteria | 22372 |
| 123 | Ga0157372_10007623 | 3300013307 | Bacteria | 11510 |
| 124 | Ga0157375_10107611 | 3300013308 | Bacteria | 2882 |
| 125 | Ga0157375_10209805 | 3300013308 | Bacteria | 2105 |
| 126 | Ga0157377_10005315 | 3300014745 | Bacteria | 6040 |
| 127 | Ga0157376_10151796 | 3300014969 | Bacteria | 2090 |
| 128 | Ga0157376_10757225 | 3300014969 | Bacteria | 981 |
| 129 | Ga0163161_10064011 | 3300017792 | Bacteria | 2682 |
| 130 | Ga0209437_100041 | 3300025233 | Bacteria | 444465 |
| 131 | Ga0209026_1000361 | 3300025250 | Bacteria | 42722 |
| 132 | Ga0209026_1001329 | 3300025250 | Bacteria | 11098 |
| 133 | Ga0209026_1003269 | 3300025250 | Bacteria | 5427 |
| 134 | Ga0209129_1020252 | 3300025258 | Bacteria | 1240 |
| 135 | Ga0209233_1001384 | 3300025261 | Bacteria | 9623 |
| 136 | Ga0209233_1008019 | 3300025261 | Bacteria | 3300 |
| 137 | Ga0209455_1001813 | 3300025272 | Bacteria | 8968 |
| 138 | Ga0207647_10000063 | 3300025904 | Bacteria | 83442 |
| 139 | Ga0207647_10000332 | 3300025904 | Bacteria | 38845 |
| 140 | Ga0207647_10067709 | 3300025904 | Bacteria | 2163 |
| 141 | Ga0207647_10171819 | 3300025904 | Bacteria | 1262 |
| 142 | Ga0207645_10000127 | 3300025907 | Bacteria | 58003 |
| 143 | Ga0207643_10122840 | 3300025908 | Bacteria | 1539 |
| 144 | Ga0207705_10000069 | 3300025909 | Bacteria | 133094 |
| 145 | Ga0207705_10118043 | 3300025909 | Bacteria | 1966 |
| 146 | Ga0207654_10005307 | 3300025911 | Bacteria | 6506 |
| 147 | Ga0207654_10091824 | 3300025911 | Bacteria | 1853 |
| 148 | Ga0207654_10120473 | 3300025911 | Bacteria | 1646 |
| 149 | Ga0207707_10009531 | 3300025912 | Bacteria | 8425 |
| 150 | Ga0207695_10000092 | 3300025913 | Bacteria | 270514 |
| 151 | Ga0207695_10000189 | 3300025913 | Bacteria | 177142 |
| 152 | Ga0207695_10001774 | 3300025913 | Bacteria | 34048 |
| 153 | Ga0207695_10033178 | 3300025913 | Bacteria | 5637 |
| 154 | Ga0207695_10039672 | 3300025913 | Bacteria | 5058 |
| 155 | Ga0207695_10273804 | 3300025913 | Bacteria | 1583 |
| 156 | Ga0207671_10002529 | 3300025914 | Bacteria | 19484 |
| 157 | Ga0207671_10005609 | 3300025914 | Bacteria | 11516 |
| 158 | Ga0207671_10011842 | 3300025914 | Bacteria | 7059 |
| 159 | Ga0207671_10023931 | 3300025914 | Bacteria | 4599 |
| 160 | Ga0207671_10028178 | 3300025914 | Bacteria | 4199 |
| 161 | Ga0207671_10034910 | 3300025914 | Bacteria | 3735 |
| 162 | Ga0207671_10099890 | 3300025914 | Bacteria | 2196 |
| 163 | Ga0207657_10055494 | 3300025919 | Bacteria | 3421 |
| 164 | Ga0207652_10124435 | 3300025921 | Bacteria | 2296 |
| 165 | Ga0207694_10071375 | 3300025924 | Bacteria | 2713 |
| 166 | Ga0207694_10094861 | 3300025924 | Bacteria | 2358 |
| 167 | Ga0207690_10016477 | 3300025932 | Bacteria | 4497 |
| 168 | Ga0207706_10000315 | 3300025933 | Bacteria | 52200 |
| 169 | Ga0207706_10449080 | 3300025933 | Bacteria | 1115 |
| 170 | Ga0207709_10118777 | 3300025935 | Bacteria | 1781 |
| 171 | Ga0207704_10000046 | 3300025938 | Bacteria | 86187 |
| 172 | Ga0207661_10007731 | 3300025944 | Bacteria | 7652 |
| 173 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 174 | Ga0207667_10000896 | 3300025949 | Bacteria | 37967 |
| 175 | Ga0207667_10017492 | 3300025949 | Bacteria | 8067 |
| 176 | Ga0207667_10034891 | 3300025949 | Bacteria | 5399 |
| 177 | Ga0207651_10001203 | 3300025960 | Bacteria | 11590 |
| 178 | Ga0207712_10650182 | 3300025961 | Bacteria | 916 |
| 179 | Ga0207677_10109395 | 3300026023 | Bacteria | 2055 |
| 180 | Ga0207703_10049944 | 3300026035 | Bacteria | 3383 |
| 181 | Ga0207639_10035831 | 3300026041 | Bacteria | 3673 |
| 182 | Ga0207639_10217927 | 3300026041 | Bacteria | 1647 |
| 183 | Ga0207639_10617488 | 3300026041 | Bacteria | 1001 |
| 184 | Ga0207702_10000492 | 3300026078 | Bacteria | 44456 |
| 185 | Ga0207702_10063593 | 3300026078 | Bacteria | 3156 |
| 186 | Ga0207702_10066329 | 3300026078 | Bacteria | 3093 |
| 187 | Ga0207702_10338714 | 3300026078 | Unclassified | 1436 |
| 188 | Ga0207648_10000257 | 3300026089 | Bacteria | 57438 |
| 189 | Ga0207683_10010079 | 3300026121 | Bacteria | 8062 |
| 190 | Ga0268266_10000078 | 3300028379 | Bacteria | 213632 |
| 191 | Ga0307517_10001926 | 3300028786 | Bacteria | 33977 |
| 192 | Ga0307517_10188119 | 3300028786 | Bacteria | 1317 |
| 193 | Ga0307515_10000839 | 3300028794 | Bacteria | 70656 |
| 194 | Ga0307515_10004603 | 3300028794 | Bacteria | 28374 |
| 195 | Ga0307515_10199115 | 3300028794 | Bacteria | 1885 |
| 196 | Ga0307509_10140303 | 3300031507 | Bacteria | 2354 |
| 197 | Ga0307412_10066993 | 3300031911 | Bacteria | 2436 |
| 198 | Ga0307507_10007373 | 3300033179 | Bacteria | 16056 |
| 199 | Ga0307510_10000504 | 3300033180 | Bacteria | 38756 |
| 200 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 201 | Ga0395899_0117495 | 3300037312 | Bacteria | 1907 |
| 202 | Ga0395899_0158179 | 3300037312 | Unclassified | 1602 |
| 203 | Ga0395900_0006437 | 3300037418 | Bacteria | 12240 |
| 204 | Ga0395900_0065474 | 3300037418 | Unclassified | 3734 |
| 205 | Ga0395898_0017338 | 3300037466 | Bacteria | 7356 |
| 206 | Ga0395905_0004006 | 3300037471 | Bacteria | 15480 |
| 207 | Ga0395905_0010191 | 3300037471 | Bacteria | 9159 |
| 208 | Ga0395901_0008382 | 3300038443 | Bacteria | 10449 |
| 209 | Ga0395901_0030415 | 3300038443 | Bacteria | 5563 |
| 210 | Ga0436361_1105761 | 3300039447 | Bacteria | 5711 |
| 211 | Ga0439448_0007752 | 3300042005 | Bacteria | 3119 |
| 212 | Ga0466966_0147850 | 3300044684 | Unclassified | 1434 |
| 213 | Ga0495638_0062000 | 3300046460 | Bacteria | 2309 |
| 214 | Ga0495651_0019186 | 3300046462 | Bacteria | 5298 |
| 215 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 216 | Ga0495585_0000652 | 3300046492 | Bacteria | 31861 |
| 217 | Ga0495585_0001978 | 3300046492 | Bacteria | 15240 |
| 218 | Ga0495596_0103591 | 3300046500 | Bacteria | 1105 |
| 219 | Ga0495606_0000143 | 3300046507 | Bacteria | 123231 |
| 220 | Ga0495606_0015974 | 3300046507 | Bacteria | 5750 |
| 221 | Ga0495606_0033492 | 3300046507 | Bacteria | 3543 |
| 222 | Ga0495606_0224186 | 3300046507 | Unclassified | 1057 |
| 223 | Ga0495610_0001797 | 3300046512 | Bacteria | 18695 |
| 224 | Ga0495616_0011673 | 3300046513 | Bacteria | 5023 |
| 225 | Ga0495616_0012269 | 3300046513 | Bacteria | 4870 |
| 226 | Ga0495628_0129111 | 3300046516 | Bacteria | 1935 |
| 227 | Ga0495648_0050822 | 3300046524 | Bacteria | 2530 |
| 228 | Ga0495652_0277183 | 3300046529 | Bacteria | 1230 |
| 229 | Ga0495652_0500675 | 3300046529 | Bacteria | 842 |
| 230 | Ga0495609_0141496 | 3300046538 | Bacteria | 1026 |
| 231 | Ga0495633_0000056 | 3300046558 | Bacteria | 149334 |
| 232 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 233 | Ga0495625_0000005 | 3300046660 | Bacteria | 596135 |
| 234 | Ga0495625_0015928 | 3300046660 | Bacteria | 5932 |
| 235 | Ga0495625_0017846 | 3300046660 | Bacteria | 5546 |
| 236 | Ga0495625_0018958 | 3300046660 | Bacteria | 5354 |
| 237 | Ga0495625_0037770 | 3300046660 | Bacteria | 3538 |
| 238 | Ga0495625_0171488 | 3300046660 | Bacteria | 1448 |
| 239 | Ga0495661_0000244 | 3300046665 | Bacteria | 62633 |
| 240 | Ga0495661_0007899 | 3300046665 | Bacteria | 7391 |
| 241 | Ga0495661_0018092 | 3300046665 | Bacteria | 4641 |
| 242 | Ga0495658_0012145 | 3300046683 | Bacteria | 4351 |
| 243 | Ga0495669_0248076 | 3300046684 | Bacteria | 855 |
| 244 | Ga0495649_0000003 | 3300046694 | Bacteria | 880817 |
| 245 | Ga0495649_0072647 | 3300046694 | Bacteria | 1844 |
| 246 | Ga0495660_0164295 | 3300046810 | Bacteria | 1086 |
| 247 | Ga0495660_0214211 | 3300046810 | Bacteria | 912 |
| 248 | Ga0495687_000833 | 3300047443 | Bacteria | 32923 |
| 249 | Ga0495687_003032 | 3300047443 | Bacteria | 12630 |
| 250 | Ga0495677_0108164 | 3300047445 | Unclassified | 1056 |
| 251 | Ga0495686_0000106 | 3300047472 | Bacteria | 175852 |
| 252 | Ga0495686_0003562 | 3300047472 | Bacteria | 13388 |
| 253 | Ga0495614_0082906 | 3300048089 | Bacteria | 1390 |
| 254 | Ga0495678_004063 | 3300049459 | Bacteria | 8678 |
| 255 | Ga0501044_1381601 | 3300049823 | Unclassified | 570 |
| 256 | nmdc:mga0k408_116_c3 | 3300050493 | Bacteria | 24401 |
| 257 | nmdc:mga0k408_1365_c1 | 3300050493 | Bacteria | 13162 |
| 258 | nmdc:mga0k408_4755_c1 | 3300050493 | Bacteria | 7194 |
| 259 | Ga0500635_0020569 | 3300053080 | Bacteria | 2023 |
| 260 | Ga0500618_000001 | 3300053125 | Bacteria | 538477 |
| 261 | Ga0500642_0039811 | 3300053130 | Unclassified | 2023 |
| 262 | Ga0500564_058441 | 3300053138 | Bacteria | 1753 |
| 263 | Ga0500616_0115639 | 3300053153 | Bacteria | 1289 |
| 264 | Ga0500622_0001459 | 3300053156 | Bacteria | 18875 |
| 265 | Ga0500622_0049283 | 3300053156 | Bacteria | 2172 |
| 266 | Ga0500624_002640 | 3300053157 | Bacteria | 2399 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049823 | Ga0501044_1381601 | Ga0501044_1381601_60_560 | 162 |
| 2 | 3300025913 | Ga0207695_10000092 | Ga0207695_10000092233 | 197 |
| 3 | 3300003320 | rootH2_10186287 | rootH2_101862871 | 199 |
| 4 | 3300009093 | Ga0105240_10000037 | Ga0105240_1000003711 | 199 |
| 5 | 3300009093 | Ga0105240_10989682 | Ga0105240_109896821 | 199 |
| 6 | 3300010375 | Ga0105239_10000260 | Ga0105239_1000026070 | 199 |
| 7 | 3300003323 | rootH1_10206101 | rootH1_102061013 | 200 |
| 8 | 3300009093 | Ga0105240_10000728 | Ga0105240_1000072842 | 200 |
| 9 | 3300009545 | Ga0105237_10000622 | Ga0105237_1000062214 | 200 |
| 10 | 3300009551 | Ga0105238_10094327 | Ga0105238_100943273 | 200 |
| 11 | 3300010375 | Ga0105239_10001617 | Ga0105239_100016177 | 200 |
| 12 | 3300014969 | Ga0157376_10757225 | Ga0157376_107572251 | 200 |
| 13 | 3300025261 | Ga0209233_1008019 | Ga0209233_10080192 | 200 |
| 14 | 3300025911 | Ga0207654_10091824 | Ga0207654_100918242 | 200 |
| 15 | 3300025913 | Ga0207695_10000189 | Ga0207695_10000189123 | 200 |
| 16 | 3300025914 | Ga0207671_10002529 | Ga0207671_100025294 | 200 |
| 17 | 3300037312 | Ga0395899_0000001 | Ga0395899_0000001_1586629_1587237 | 200 |
| 18 | 3300044684 | Ga0466966_0147850 | Ga0466966_0147850_378_986 | 200 |
| 19 | iso_pu_bacteria | 2599185184 | 2599477937 | 200 |
| 20 | iso_pu_bacteria | 2852623160 | 2852623633 | 200 |
| 21 | iso_pu_bacteria | 2884933994 | 2884937463 | 200 |
| 22 | iso_pu_bacteria | 2919437846 | 2919439205 | 200 |
| 23 | iso_pu_bacteria | 2928078545 | 2928079897 | 200 |
| 24 | iso_pu_bacteria | 2928147474 | 2928147649 | 200 |
| 25 | iso_pu_bacteria | 2932082852 | 2932083683 | 200 |
| 26 | iso_pu_bacteria | 2977232053 | 2977232868 | 200 |
| 27 | iso_pu_bacteria | 2896317667 | 2896318342 | 201 |
| 28 | iso_pu_bacteria | 2896344016 | 2896345790 | 201 |
| 29 | 3300005842 | Ga0068858_100070755 | Ga0068858_1000707552 | 203 |
| 30 | 3300026035 | Ga0207703_10049944 | Ga0207703_100499442 | 203 |
| 31 | 3300001989 | JGI24739J22299_10005327 | JGI24739J22299_100053274 | 204 |
| 32 | 3300001989 | JGI24739J22299_10015573 | JGI24739J22299_100155733 | 204 |
| 33 | 3300001990 | JGI24737J22298_10000924 | JGI24737J22298_1000092410 | 204 |
| 34 | 3300001990 | JGI24737J22298_10029884 | JGI24737J22298_100298841 | 204 |
| 35 | 3300001990 | JGI24737J22298_10031223 | JGI24737J22298_100312232 | 204 |
| 36 | 3300001991 | JGI24743J22301_10057510 | JGI24743J22301_100575101 | 204 |
| 37 | 3300002067 | JGI24735J21928_10000269 | JGI24735J21928_1000026911 | 204 |
| 38 | 3300002067 | JGI24735J21928_10009711 | JGI24735J21928_100097112 | 204 |
| 39 | 3300002077 | JGI24744J21845_10013871 | JGI24744J21845_100138712 | 204 |
| 40 | 3300002737 | JGI25162J39368_1000012 | JGI25162J39368_100001287 | 204 |
| 41 | 3300003316 | rootH1_10055866 | rootH1_100558663 | 204 |
| 42 | 3300003316 | rootH1_10162462 | rootH1_101624622 | 204 |
| 43 | 3300003320 | rootH2_10004581 | rootH2_100045819 | 204 |
| 44 | 3300003320 | rootH2_10130715 | rootH2_101307153 | 204 |
| 45 | 3300003322 | rootL2_10001334 | rootL2_100013343 | 204 |
| 46 | 3300003322 | rootL2_10116239 | rootL2_101162398 | 204 |
| 47 | 3300003323 | rootH1_10003212 | rootH1_1000321268 | 204 |
| 48 | 3300003323 | rootH1_10128263 | rootH1_101282632 | 204 |
| 49 | 3300003763 | Ga0055529_1012111 | Ga0055529_10121112 | 204 |
| 50 | 3300005288 | Ga0065714_10097878 | Ga0065714_100978783 | 204 |
| 51 | 3300005327 | Ga0070658_10000019 | Ga0070658_10000019116 | 204 |
| 52 | 3300005327 | Ga0070658_10170515 | Ga0070658_101705153 | 204 |
| 53 | 3300005327 | Ga0070658_10190327 | Ga0070658_101903272 | 204 |
| 54 | 3300005329 | Ga0070683_100037536 | Ga0070683_1000375365 | 204 |
| 55 | 3300005336 | Ga0070680_100068575 | Ga0070680_1000685752 | 204 |
| 56 | 3300005338 | Ga0068868_100059144 | Ga0068868_1000591443 | 204 |
| 57 | 3300005339 | Ga0070660_100044092 | Ga0070660_1000440923 | 204 |
| 58 | 3300005339 | Ga0070660_100096331 | Ga0070660_1000963312 | 204 |
| 59 | 3300005339 | Ga0070660_100219452 | Ga0070660_1002194522 | 204 |
| 60 | 3300005364 | Ga0070673_100141842 | Ga0070673_1001418422 | 204 |
| 61 | 3300005366 | Ga0070659_100622118 | Ga0070659_1006221181 | 204 |
| 62 | 3300005456 | Ga0070678_100005020 | Ga0070678_1000050206 | 204 |
| 63 | 3300005457 | Ga0070662_100000102 | Ga0070662_10000010221 | 204 |
| 64 | 3300005457 | Ga0070662_100470843 | Ga0070662_1004708432 | 204 |
| 65 | 3300005458 | Ga0070681_10014039 | Ga0070681_100140393 | 204 |
| 66 | 3300005459 | Ga0068867_100000116 | Ga0068867_10000011634 | 204 |
| 67 | 3300005530 | Ga0070679_100001606 | Ga0070679_1000016067 | 204 |
| 68 | 3300005539 | Ga0068853_100598065 | Ga0068853_1005980652 | 204 |
| 69 | 3300005548 | Ga0070665_100000003 | Ga0070665_100000003376 | 204 |
| 70 | 3300005563 | Ga0068855_100000152 | Ga0068855_1000001524 | 204 |
| 71 | 3300005563 | Ga0068855_100001020 | Ga0068855_10000102027 | 204 |
| 72 | 3300005563 | Ga0068855_100014677 | Ga0068855_1000146776 | 204 |
| 73 | 3300005563 | Ga0068855_100044759 | Ga0068855_1000447591 | 204 |
| 74 | 3300005563 | Ga0068855_100048916 | Ga0068855_1000489163 | 204 |
| 75 | 3300005577 | Ga0068857_100316321 | Ga0068857_1003163212 | 204 |
| 76 | 3300005614 | Ga0068856_100000262 | Ga0068856_10000026236 | 204 |
| 77 | 3300005614 | Ga0068856_100001674 | Ga0068856_10000167417 | 204 |
| 78 | 3300005614 | Ga0068856_100048818 | Ga0068856_1000488183 | 204 |
| 79 | 3300005614 | Ga0068856_100195240 | Ga0068856_1001952403 | 204 |
| 80 | 3300005616 | Ga0068852_100000326 | Ga0068852_1000003266 | 204 |
| 81 | 3300005840 | Ga0068870_10174495 | Ga0068870_101744952 | 204 |
| 82 | 3300005842 | Ga0068858_100605581 | Ga0068858_1006055812 | 204 |
| 83 | 3300006195 | Ga0075366_10027771 | Ga0075366_100277712 | 204 |
| 84 | 3300006195 | Ga0075366_10037350 | Ga0075366_100373503 | 204 |
| 85 | 3300006237 | Ga0097621_100000089 | Ga0097621_1000000898 | 204 |
| 86 | 3300006353 | Ga0075370_10214088 | Ga0075370_102140882 | 204 |
| 87 | 3300006358 | Ga0068871_100000216 | Ga0068871_10000021633 | 204 |
| 88 | 3300006881 | Ga0068865_100000048 | Ga0068865_10000004857 | 204 |
| 89 | 3300009093 | Ga0105240_10017374 | Ga0105240_100173746 | 204 |
| 90 | 3300009093 | Ga0105240_10023659 | Ga0105240_100236598 | 204 |
| 91 | 3300009093 | Ga0105240_10052494 | Ga0105240_100524944 | 204 |
| 92 | 3300009093 | Ga0105240_10076956 | Ga0105240_100769561 | 204 |
| 93 | 3300009093 | Ga0105240_10154384 | Ga0105240_101543843 | 204 |
| 94 | 3300009093 | Ga0105240_10237418 | Ga0105240_102374183 | 204 |
| 95 | 3300009093 | Ga0105240_10254920 | Ga0105240_102549202 | 204 |
| 96 | 3300009093 | Ga0105240_10266646 | Ga0105240_102666462 | 204 |
| 97 | 3300009093 | Ga0105240_10325477 | Ga0105240_103254772 | 204 |
| 98 | 3300009093 | Ga0105240_10399954 | Ga0105240_103999542 | 204 |
| 99 | 3300009093 | Ga0105240_10445245 | Ga0105240_104452452 | 204 |
| 100 | 3300009093 | Ga0105240_10523606 | Ga0105240_105236062 | 204 |
| 101 | 3300009148 | Ga0105243_10191316 | Ga0105243_101913162 | 204 |
| 102 | 3300009174 | Ga0105241_10001034 | Ga0105241_100010348 | 204 |
| 103 | 3300009174 | Ga0105241_10020526 | Ga0105241_100205261 | 204 |
| 104 | 3300009174 | Ga0105241_10112205 | Ga0105241_101122052 | 204 |
| 105 | 3300009174 | Ga0105241_10138963 | Ga0105241_101389633 | 204 |
| 106 | 3300009174 | Ga0105241_10209077 | Ga0105241_102090772 | 204 |
| 107 | 3300009174 | Ga0105241_10514671 | Ga0105241_105146711 | 204 |
| 108 | 3300009176 | Ga0105242_10121115 | Ga0105242_101211153 | 204 |
| 109 | 3300009545 | Ga0105237_10000574 | Ga0105237_1000057411 | 204 |
| 110 | 3300009545 | Ga0105237_10003791 | Ga0105237_1000379118 | 204 |
| 111 | 3300009545 | Ga0105237_10013220 | Ga0105237_100132206 | 204 |
| 112 | 3300009545 | Ga0105237_10024669 | Ga0105237_100246692 | 204 |
| 113 | 3300009545 | Ga0105237_10059216 | Ga0105237_100592162 | 204 |
| 114 | 3300009545 | Ga0105237_10118051 | Ga0105237_101180513 | 204 |
| 115 | 3300009545 | Ga0105237_10168986 | Ga0105237_101689863 | 204 |
| 116 | 3300009551 | Ga0105238_10010541 | Ga0105238_100105416 | 204 |
| 117 | 3300009551 | Ga0105238_10034085 | Ga0105238_100340857 | 204 |
| 118 | 3300010375 | Ga0105239_10000010 | Ga0105239_10000010117 | 204 |
| 119 | 3300010375 | Ga0105239_10000117 | Ga0105239_1000011751 | 204 |
| 120 | 3300010375 | Ga0105239_10000139 | Ga0105239_1000013946 | 204 |
| 121 | 3300010375 | Ga0105239_10009794 | Ga0105239_100097946 | 204 |
| 122 | 3300010375 | Ga0105239_10039457 | Ga0105239_100394572 | 204 |
| 123 | 3300010375 | Ga0105239_10040855 | Ga0105239_100408556 | 204 |
| 124 | 3300010375 | Ga0105239_10235130 | Ga0105239_102351301 | 204 |
| 125 | 3300010375 | Ga0105239_10487505 | Ga0105239_104875052 | 204 |
| 126 | 3300013100 | Ga0157373_10000208 | Ga0157373_1000020853 | 204 |
| 127 | 3300013100 | Ga0157373_10002412 | Ga0157373_100024123 | 204 |
| 128 | 3300013102 | Ga0157371_10008599 | Ga0157371_100085995 | 204 |
| 129 | 3300013102 | Ga0157371_10066369 | Ga0157371_100663693 | 204 |
| 130 | 3300013104 | Ga0157370_10042634 | Ga0157370_100426342 | 204 |
| 131 | 3300013105 | Ga0157369_10091161 | Ga0157369_100911613 | 204 |
| 132 | 3300013105 | Ga0157369_10224263 | Ga0157369_102242632 | 204 |
| 133 | 3300013296 | Ga0157374_10000306 | Ga0157374_1000030625 | 204 |
| 134 | 3300013296 | Ga0157374_10000807 | Ga0157374_100008074 | 204 |
| 135 | 3300013296 | Ga0157374_10244690 | Ga0157374_102446902 | 204 |
| 136 | 3300013297 | Ga0157378_10034699 | Ga0157378_100346992 | 204 |
| 137 | 3300013297 | Ga0157378_10068680 | Ga0157378_100686802 | 204 |
| 138 | 3300013306 | Ga0163162_10000058 | Ga0163162_1000005870 | 204 |
| 139 | 3300013306 | Ga0163162_10026133 | Ga0163162_100261335 | 204 |
| 140 | 3300013306 | Ga0163162_10072753 | Ga0163162_100727533 | 204 |
| 141 | 3300013307 | Ga0157372_10000181 | Ga0157372_1000018147 | 204 |
| 142 | 3300013307 | Ga0157372_10001960 | Ga0157372_1000196017 | 204 |
| 143 | 3300013307 | Ga0157372_10007623 | Ga0157372_100076237 | 204 |
| 144 | 3300013308 | Ga0157375_10107611 | Ga0157375_101076112 | 204 |
| 145 | 3300013308 | Ga0157375_10209805 | Ga0157375_102098052 | 204 |
| 146 | 3300014745 | Ga0157377_10005315 | Ga0157377_100053155 | 204 |
| 147 | 3300014969 | Ga0157376_10151796 | Ga0157376_101517962 | 204 |
| 148 | 3300017792 | Ga0163161_10064011 | Ga0163161_100640114 | 204 |
| 149 | 3300025233 | Ga0209437_100041 | Ga0209437_100041132 | 204 |
| 150 | 3300025250 | Ga0209026_1000361 | Ga0209026_10003614 | 204 |
| 151 | 3300025250 | Ga0209026_1001329 | Ga0209026_10013292 | 204 |
| 152 | 3300025250 | Ga0209026_1003269 | Ga0209026_10032694 | 204 |
| 153 | 3300025258 | Ga0209129_1020252 | Ga0209129_10202522 | 204 |
| 154 | 3300025261 | Ga0209233_1001384 | Ga0209233_10013843 | 204 |
| 155 | 3300025272 | Ga0209455_1001813 | Ga0209455_10018134 | 204 |
| 156 | 3300025904 | Ga0207647_10000063 | Ga0207647_1000006347 | 204 |
| 157 | 3300025904 | Ga0207647_10000332 | Ga0207647_1000033211 | 204 |
| 158 | 3300025904 | Ga0207647_10067709 | Ga0207647_100677093 | 204 |
| 159 | 3300025904 | Ga0207647_10171819 | Ga0207647_101718192 | 204 |
| 160 | 3300025907 | Ga0207645_10000127 | Ga0207645_1000012735 | 204 |
| 161 | 3300025908 | Ga0207643_10122840 | Ga0207643_101228402 | 204 |
| 162 | 3300025909 | Ga0207705_10000069 | Ga0207705_10000069118 | 204 |
| 163 | 3300025909 | Ga0207705_10118043 | Ga0207705_101180432 | 204 |
| 164 | 3300025911 | Ga0207654_10005307 | Ga0207654_100053075 | 204 |
| 165 | 3300025911 | Ga0207654_10120473 | Ga0207654_101204732 | 204 |
| 166 | 3300025912 | Ga0207707_10009531 | Ga0207707_100095317 | 204 |
| 167 | 3300025913 | Ga0207695_10001774 | Ga0207695_100017748 | 204 |
| 168 | 3300025913 | Ga0207695_10033178 | Ga0207695_100331781 | 204 |
| 169 | 3300025913 | Ga0207695_10039672 | Ga0207695_100396724 | 204 |
| 170 | 3300025913 | Ga0207695_10273804 | Ga0207695_102738042 | 204 |
| 171 | 3300025914 | Ga0207671_10005609 | Ga0207671_100056093 | 204 |
| 172 | 3300025914 | Ga0207671_10011842 | Ga0207671_100118425 | 204 |
| 173 | 3300025914 | Ga0207671_10023931 | Ga0207671_100239313 | 204 |
| 174 | 3300025914 | Ga0207671_10028178 | Ga0207671_100281782 | 204 |
| 175 | 3300025914 | Ga0207671_10034910 | Ga0207671_100349102 | 204 |
| 176 | 3300025914 | Ga0207671_10099890 | Ga0207671_100998902 | 204 |
| 177 | 3300025919 | Ga0207657_10055494 | Ga0207657_100554943 | 204 |
| 178 | 3300025921 | Ga0207652_10124435 | Ga0207652_101244352 | 204 |
| 179 | 3300025924 | Ga0207694_10071375 | Ga0207694_100713752 | 204 |
| 180 | 3300025924 | Ga0207694_10094861 | Ga0207694_100948612 | 204 |
| 181 | 3300025932 | Ga0207690_10016477 | Ga0207690_100164772 | 204 |
| 182 | 3300025933 | Ga0207706_10000315 | Ga0207706_1000031519 | 204 |
| 183 | 3300025933 | Ga0207706_10449080 | Ga0207706_104490802 | 204 |
| 184 | 3300025935 | Ga0207709_10118777 | Ga0207709_101187772 | 204 |
| 185 | 3300025938 | Ga0207704_10000046 | Ga0207704_1000004660 | 204 |
| 186 | 3300025944 | Ga0207661_10007731 | Ga0207661_100077317 | 204 |
| 187 | 3300025949 | Ga0207667_10000009 | Ga0207667_1000000963 | 204 |
| 188 | 3300025949 | Ga0207667_10000896 | Ga0207667_1000089623 | 204 |
| 189 | 3300025949 | Ga0207667_10017492 | Ga0207667_100174922 | 204 |
| 190 | 3300025949 | Ga0207667_10034891 | Ga0207667_100348914 | 204 |
| 191 | 3300025960 | Ga0207651_10001203 | Ga0207651_100012036 | 204 |
| 192 | 3300025961 | Ga0207712_10650182 | Ga0207712_106501822 | 204 |
| 193 | 3300026023 | Ga0207677_10109395 | Ga0207677_101093952 | 204 |
| 194 | 3300026041 | Ga0207639_10035831 | Ga0207639_100358312 | 204 |
| 195 | 3300026041 | Ga0207639_10217927 | Ga0207639_102179272 | 204 |
| 196 | 3300026041 | Ga0207639_10617488 | Ga0207639_106174882 | 204 |
| 197 | 3300026078 | Ga0207702_10000492 | Ga0207702_1000049219 | 204 |
| 198 | 3300026078 | Ga0207702_10063593 | Ga0207702_100635933 | 204 |
| 199 | 3300026078 | Ga0207702_10066329 | Ga0207702_100663292 | 204 |
| 200 | 3300026078 | Ga0207702_10338714 | Ga0207702_103387142 | 204 |
| 201 | 3300026089 | Ga0207648_10000257 | Ga0207648_1000025716 | 204 |
| 202 | 3300026121 | Ga0207683_10010079 | Ga0207683_100100797 | 204 |
| 203 | 3300028379 | Ga0268266_10000078 | Ga0268266_10000078166 | 204 |
| 204 | 3300028786 | Ga0307517_10001926 | Ga0307517_100019268 | 204 |
| 205 | 3300028786 | Ga0307517_10188119 | Ga0307517_101881192 | 204 |
| 206 | 3300028794 | Ga0307515_10000839 | Ga0307515_100008394 | 204 |
| 207 | 3300028794 | Ga0307515_10004603 | Ga0307515_100046034 | 204 |
| 208 | 3300028794 | Ga0307515_10199115 | Ga0307515_101991151 | 204 |
| 209 | 3300031507 | Ga0307509_10140303 | Ga0307509_101403032 | 204 |
| 210 | 3300031911 | Ga0307412_10066993 | Ga0307412_100669932 | 204 |
| 211 | 3300033179 | Ga0307507_10007373 | Ga0307507_100073735 | 204 |
| 212 | 3300033180 | Ga0307510_10000504 | Ga0307510_1000050431 | 204 |
| 213 | 3300037312 | Ga0395899_0117495 | Ga0395899_0117495_877_1491 | 204 |
| 214 | 3300037312 | Ga0395899_0158179 | Ga0395899_0158179_813_1427 | 204 |
| 215 | 3300037418 | Ga0395900_0006437 | Ga0395900_0006437_1981_2595 | 204 |
| 216 | 3300037418 | Ga0395900_0065474 | Ga0395900_0065474_625_1239 | 204 |
| 217 | 3300037466 | Ga0395898_0017338 | Ga0395898_0017338_679_1293 | 204 |
| 218 | 3300037471 | Ga0395905_0004006 | Ga0395905_0004006_8963_9577 | 204 |
| 219 | 3300037471 | Ga0395905_0010191 | Ga0395905_0010191_6119_6733 | 204 |
| 220 | 3300038443 | Ga0395901_0008382 | Ga0395901_0008382_1843_2457 | 204 |
| 221 | 3300038443 | Ga0395901_0030415 | Ga0395901_0030415_3503_4117 | 204 |
| 222 | 3300039447 | Ga0436361_1105761 | Ga0436361_1105761_3514_4128 | 204 |
| 223 | 3300042005 | Ga0439448_0007752 | Ga0439448_0007752_1083_1697 | 204 |
| 224 | 3300046460 | Ga0495638_0062000 | Ga0495638_0062000_58_672 | 204 |
| 225 | 3300046462 | Ga0495651_0019186 | Ga0495651_0019186_872_1486 | 204 |
| 226 | 3300046471 | Ga0495650_0000003 | Ga0495650_0000003_38537_39151 | 204 |
| 227 | 3300046492 | Ga0495585_0000652 | Ga0495585_0000652_24564_25178 | 204 |
| 228 | 3300046492 | Ga0495585_0001978 | Ga0495585_0001978_11555_12169 | 204 |
| 229 | 3300046500 | Ga0495596_0103591 | Ga0495596_0103591_440_1054 | 204 |
| 230 | 3300046507 | Ga0495606_0000143 | Ga0495606_0000143_108435_109049 | 204 |
| 231 | 3300046507 | Ga0495606_0015974 | Ga0495606_0015974_3824_4438 | 204 |
| 232 | 3300046507 | Ga0495606_0033492 | Ga0495606_0033492_848_1462 | 204 |
| 233 | 3300046507 | Ga0495606_0224186 | Ga0495606_0224186_390_1004 | 204 |
| 234 | 3300046512 | Ga0495610_0001797 | Ga0495610_0001797_11501_12115 | 204 |
| 235 | 3300046513 | Ga0495616_0011673 | Ga0495616_0011673_1081_1695 | 204 |
| 236 | 3300046513 | Ga0495616_0012269 | Ga0495616_0012269_2793_3407 | 204 |
| 237 | 3300046516 | Ga0495628_0129111 | Ga0495628_0129111_18_632 | 204 |
| 238 | 3300046524 | Ga0495648_0050822 | Ga0495648_0050822_654_1268 | 204 |
| 239 | 3300046529 | Ga0495652_0277183 | Ga0495652_0277183_188_802 | 204 |
| 240 | 3300046529 | Ga0495652_0500675 | Ga0495652_0500675_91_705 | 204 |
| 241 | 3300046538 | Ga0495609_0141496 | Ga0495609_0141496_123_737 | 204 |
| 242 | 3300046558 | Ga0495633_0000056 | Ga0495633_0000056_138277_138891 | 204 |
| 243 | 3300046616 | Ga0495668_0000003 | Ga0495668_0000003_171706_172320 | 204 |
| 244 | 3300046660 | Ga0495625_0000005 | Ga0495625_0000005_155737_156351 | 204 |
| 245 | 3300046660 | Ga0495625_0015928 | Ga0495625_0015928_2267_2881 | 204 |
| 246 | 3300046660 | Ga0495625_0017846 | Ga0495625_0017846_1841_2455 | 204 |
| 247 | 3300046660 | Ga0495625_0018958 | Ga0495625_0018958_182_862 | 204 |
| 248 | 3300046660 | Ga0495625_0037770 | Ga0495625_0037770_454_1068 | 204 |
| 249 | 3300046660 | Ga0495625_0171488 | Ga0495625_0171488_773_1387 | 204 |
| 250 | 3300046665 | Ga0495661_0000244 | Ga0495661_0000244_19782_20396 | 204 |
| 251 | 3300046665 | Ga0495661_0007899 | Ga0495661_0007899_5434_6048 | 204 |
| 252 | 3300046665 | Ga0495661_0018092 | Ga0495661_0018092_970_1584 | 204 |
| 253 | 3300046683 | Ga0495658_0012145 | Ga0495658_0012145_2438_3052 | 204 |
| 254 | 3300046684 | Ga0495669_0248076 | Ga0495669_0248076_175_789 | 204 |
| 255 | 3300046694 | Ga0495649_0000003 | Ga0495649_0000003_155758_156372 | 204 |
| 256 | 3300046694 | Ga0495649_0072647 | Ga0495649_0072647_997_1611 | 204 |
| 257 | 3300046810 | Ga0495660_0164295 | Ga0495660_0164295_296_910 | 204 |
| 258 | 3300046810 | Ga0495660_0214211 | Ga0495660_0214211_23_637 | 204 |
| 259 | 3300047443 | Ga0495687_000833 | Ga0495687_000833_10630_11244 | 204 |
| 260 | 3300047443 | Ga0495687_003032 | Ga0495687_003032_3597_4211 | 204 |
| 261 | 3300047445 | Ga0495677_0108164 | Ga0495677_0108164_245_859 | 204 |
| 262 | 3300047472 | Ga0495686_0000106 | Ga0495686_0000106_159568_160182 | 204 |
| 263 | 3300047472 | Ga0495686_0003562 | Ga0495686_0003562_1711_2325 | 204 |
| 264 | 3300048089 | Ga0495614_0082906 | Ga0495614_0082906_434_1048 | 204 |
| 265 | 3300049459 | Ga0495678_004063 | Ga0495678_004063_7447_8061 | 204 |
| 266 | 3300050493 | nmdc:mga0k408_116_c3 | nmdc:mga0k408_116_c3_22677_23291 | 204 |
| 267 | 3300050493 | nmdc:mga0k408_1365_c1 | nmdc:mga0k408_1365_c1_5529_6143 | 204 |
| 268 | 3300050493 | nmdc:mga0k408_4755_c1 | nmdc:mga0k408_4755_c1_5524_6138 | 204 |
| 269 | 3300053080 | Ga0500635_0020569 | Ga0500635_0020569_769_1383 | 204 |
| 270 | 3300053125 | Ga0500618_000001 | Ga0500618_000001_152551_153165 | 204 |
| 271 | 3300053130 | Ga0500642_0039811 | Ga0500642_0039811_722_1336 | 204 |
| 272 | 3300053138 | Ga0500564_058441 | Ga0500564_058441_834_1448 | 204 |
| 273 | 3300053153 | Ga0500616_0115639 | Ga0500616_0115639_249_863 | 204 |
| 274 | 3300053156 | Ga0500622_0001459 | Ga0500622_0001459_2137_2751 | 204 |
| 275 | 3300053156 | Ga0500622_0049283 | Ga0500622_0049283_1025_1639 | 204 |
| 276 | 3300053157 | Ga0500624_002640 | Ga0500624_002640_541_1155 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7oya-assembly1.cif.gz_v2 | cryo-em structure of the 1 hpf zebrafish embryo 80s ribosome | 0.8588 | 139 | 199 |
| 4rwx-assembly1.cif.gz_C | crystal structure of l. monocytogenes psta | 0.8477 | 138 | 200 |
| 4rww-assembly1.cif.gz_C | crystal structure of l. monocytogenes psta in complex with cyclic-di-amp | 0.8356 | 138 | 200 |
| 1hwu-assembly3.cif.gz_E-2 | structure of pii protein from herbaspirillum seropedicae | 0.8303 | 138 | 202 |
| 6wue-assembly1.cif.gz_A-2 | tetragonal crystal form of sbtb from synechocystis pcc6803 | 0.828 | 137 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G059_1_130_3.30.230.30 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain | 0.9642 | 7 | 132 | 3.30.230.30 |
| af_Q6ZJC5_65_187_3.30.230.30 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain | 0.9625 | 7 | 132 | 3.30.230.30 |
| af_P27862_1_132_3.30.230.30 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain | 0.9521 | 7 | 132 | 3.30.230.30 |
| af_Q6ZJC5_65_187_3.30.230.30 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain | 0.9399 | 7 | 132 | 3.30.230.30 |
| af_Q2G059_1_130_3.30.230.30 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain | 0.9284 | 7 | 132 | 3.30.230.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C6L6S6-F1-model_v4 | YigZ family protein | 0.988 | 5 | 135 |
GO:0005737
GO:0006446 |
| AF-R6AAA1-F1-model_v4 | deleted | 0.9846 | 137 | 199 |
|
| AF-A0A2N5Z835-F1-model_v4 | YigZ family protein | 0.9827 | 1 | 135 |
GO:0005737
GO:0006446 |
| AF-A0A7V4GVI3-F1-model_v4 | YigZ family protein | 0.9779 | 4 | 117 |
GO:0005737
GO:0006446 |
| AF-A0A642C4B1-F1-model_v4 | YigZ family protein | 0.9718 | 46 | 202 |
GO:0005737
GO:0006446 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar