F381017

General Info

Members Datasets Scaffolds Average Seq Length
276 126 276 194

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10028125|Ga0081539_100281253
Length 198
Sequence MTLVERLTAALEAGNRMTPELLTGDLRGLELDQAPGRAEAAVLIAVTDRPEPGVILTQRTETLRRHAGQVAFPGGRIDPGDDGPVAAALREAKEEIALSPEAVTVIGPVDRYRTVTGYEVTPVLGVVMPDLPLVPAEAEVADVFEVPLAFLLDPANQHETSQVWQGRERHYYQIDWNGRRIWGATAAMLVNLSRRLAW

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
98 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 3.26
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10026213 3300001979 Bacteria 1955
2 JGI24739J22299_10014560 3300001989 Bacteria 2860
3 JGI24739J22299_10056011 3300001989 Bacteria 1259
4 JGI24737J22298_10009051 3300001990 Bacteria 3320
5 JGI24743J22301_10001710 3300001991 Bacteria 3132
6 JGI24738J21930_10002211 3300002075 Bacteria 5173
7 JGI24738J21930_10012516 3300002075 Bacteria 1853
8 rootL2_10148223 3300003322 Bacteria 1928
9 Ga0070658_10001347 3300005327 Bacteria 20977
10 Ga0070658_10002229 3300005327 Bacteria 16261
11 Ga0070658_10005428 3300005327 Bacteria 10342
12 Ga0070658_10026800 3300005327 Bacteria 4627
13 Ga0070658_10044229 3300005327 Bacteria 3598
14 Ga0070658_10260850 3300005327 Bacteria 1472
15 Ga0070658_10655932 3300005327 Unclassified 910
16 Ga0070658_10861661 3300005327 Unclassified 787
17 Ga0070683_100005771 3300005329 Bacteria 10347
18 Ga0070683_100005789 3300005329 Bacteria 10336
19 Ga0070683_100027852 3300005329 Bacteria 5100
20 Ga0070683_100148311 3300005329 Bacteria 2223
21 Ga0070670_100001836 3300005331 Bacteria 17303
22 Ga0070670_100154754 3300005331 Bacteria 1985
23 Ga0070670_100200582 3300005331 Bacteria 1733
24 Ga0070670_101032895 3300005331 Bacteria 748
25 Ga0070666_10000168 3300005335 Bacteria 45111
26 Ga0070666_10001192 3300005335 Bacteria 15739
27 Ga0070680_100152234 3300005336 Bacteria 1942
28 Ga0070682_100053537 3300005337 Bacteria 2530
29 Ga0070660_100000009 3300005339 Bacteria 145691
30 Ga0070660_100001805 3300005339 Bacteria 14689
31 Ga0070660_100002256 3300005339 Bacteria 13238
32 Ga0070660_100020692 3300005339 Bacteria 4840
33 Ga0070660_100024573 3300005339 Bacteria 4470
34 Ga0070660_100063009 3300005339 Bacteria 2882
35 Ga0070660_100248025 3300005339 Unclassified 1451
36 Ga0070660_100637814 3300005339 Bacteria 892
37 Ga0070687_100486043 3300005343 Bacteria 828
38 Ga0070661_100000100 3300005344 Bacteria 70585
39 Ga0070661_100017615 3300005344 Bacteria 5070
40 Ga0070661_100025335 3300005344 Bacteria 4262
41 Ga0070661_100061183 3300005344 Bacteria 2763
42 Ga0070692_10001202 3300005345 Bacteria 9173
43 Ga0070692_10024308 3300005345 Bacteria 2977
44 Ga0070692_10425451 3300005345 Bacteria 844
45 Ga0070669_100736663 3300005353 Bacteria 834
46 Ga0070671_100006764 3300005355 Bacteria 9174
47 Ga0070671_100013821 3300005355 Bacteria 6514
48 Ga0070671_100014474 3300005355 Bacteria 6376
49 Ga0070671_100169665 3300005355 Bacteria 1845
50 Ga0070673_100012668 3300005364 Bacteria 5799
51 Ga0070673_100355443 3300005364 Bacteria 1301
52 Ga0070659_100000981 3300005366 Bacteria 20980
53 Ga0070659_100032534 3300005366 Bacteria 4046
54 Ga0070659_100039463 3300005366 Bacteria 3686
55 Ga0070659_100410846 3300005366 Unclassified 1144
56 Ga0070659_100418723 3300005366 Bacteria 1133
57 Ga0070667_100006655 3300005367 Bacteria 9606
58 Ga0070667_100006939 3300005367 Bacteria 9410
59 Ga0070667_100338303 3300005367 Bacteria 1361
60 Ga0070663_100004141 3300005455 Bacteria 8476
61 Ga0070663_100023044 3300005455 Bacteria 4169
62 Ga0070663_100327046 3300005455 Bacteria 1234
63 Ga0070678_100647826 3300005456 Bacteria 947
64 Ga0070662_100000035 3300005457 Bacteria 77342
65 Ga0070662_100007775 3300005457 Bacteria 6965
66 Ga0070681_11086622 3300005458 Bacteria 721
67 Ga0070679_100050311 3300005530 Bacteria 4151
68 Ga0070684_100003789 3300005535 Bacteria 11418
69 Ga0068853_100000409 3300005539 Bacteria 29517
70 Ga0068853_100044251 3300005539 Bacteria 3811
71 Ga0068853_100114482 3300005539 Bacteria 2399
72 Ga0068853_100289254 3300005539 Bacteria 1512
73 Ga0070686_100303707 3300005544 Bacteria 1184
74 Ga0070696_100780209 3300005546 Bacteria 785
75 Ga0070693_100000322 3300005547 Bacteria 22033
76 Ga0070665_100004889 3300005548 Bacteria 13908
77 Ga0070665_100012573 3300005548 Bacteria 8524
78 Ga0068855_100005577 3300005563 Bacteria 15359
79 Ga0068855_100053180 3300005563 Bacteria 4765
80 Ga0068855_100540329 3300005563 Bacteria 1263
81 Ga0070664_100000025 3300005564 Bacteria 93173
82 Ga0070664_100018627 3300005564 Bacteria 5707
83 Ga0070664_100220541 3300005564 Bacteria 1697
84 Ga0070664_100667642 3300005564 Bacteria 967
85 Ga0068857_100005346 3300005577 Bacteria 10943
86 Ga0068857_100579990 3300005577 Unclassified 1058
87 Ga0068854_100017451 3300005578 Bacteria 4802
88 Ga0068854_100033498 3300005578 Bacteria 3582
89 Ga0068856_100000219 3300005614 Bacteria 61699
90 Ga0068856_101596268 3300005614 Bacteria 665
91 Ga0068852_100001450 3300005616 Bacteria 16008
92 Ga0068852_100018838 3300005616 Bacteria 5447
93 Ga0068852_100024324 3300005616 Bacteria 4893
94 Ga0068852_100281832 3300005616 Bacteria 1602
95 Ga0068852_100596944 3300005616 Bacteria 1108
96 Ga0068864_100024144 3300005618 Bacteria 5112
97 Ga0068851_10022655 3300005834 Bacteria 3063
98 Ga0068863_100420415 3300005841 Bacteria 1309
99 Ga0068858_100023548 3300005842 Bacteria 5736
100 Ga0068862_100018140 3300005844 Bacteria 5860
101 Ga0081539_10028125 3300005985 Bacteria 3542
102 Ga0097621_100282092 3300006237 Bacteria 1462
103 Ga0105241_10148719 3300009174 Bacteria 1914
104 Ga0105248_10000163 3300009177 Bacteria 77658
105 Ga0105249_10209511 3300009553 Bacteria 1912
106 Ga0157373_10156459 3300013100 Bacteria 1603
107 Ga0157373_10724600 3300013100 Bacteria 730
108 Ga0157373_10865984 3300013100 Bacteria 669
109 Ga0157371_10007968 3300013102 Bacteria 8502
110 Ga0157371_10019838 3300013102 Bacteria 4953
111 Ga0157371_10021836 3300013102 Bacteria 4696
112 Ga0157371_10042433 3300013102 Bacteria 3242
113 Ga0157371_10182431 3300013102 Bacteria 1501
114 Ga0157371_10221000 3300013102 Bacteria 1360
115 Ga0157371_10697257 3300013102 Bacteria 760
116 Ga0157370_10062015 3300013104 Bacteria 3547
117 Ga0157370_10176003 3300013104 Bacteria 1989
118 Ga0157370_10335550 3300013104 Bacteria 1394
119 Ga0157369_10441424 3300013105 Bacteria 1348
120 Ga0157369_10715313 3300013105 Unclassified 1031
121 Ga0157374_10064082 3300013296 Bacteria 3448
122 Ga0157372_10046002 3300013307 Bacteria 4843
123 Ga0157372_10063812 3300013307 Bacteria 4132
124 Ga0163163_10000173 3300014325 Bacteria 67717
125 Ga0157379_10182581 3300014968 Bacteria 1895
126 Ga0207680_10003609 3300025903 Bacteria 7269
127 Ga0207680_10005228 3300025903 Bacteria 6191
128 Ga0207647_10012877 3300025904 Bacteria 5812
129 Ga0207647_10039113 3300025904 Bacteria 2995
130 Ga0207647_10047954 3300025904 Bacteria 2654
131 Ga0207647_10131617 3300025904 Bacteria 1470
132 Ga0207705_10000169 3300025909 Bacteria 69941
133 Ga0207705_10001635 3300025909 Bacteria 17788
134 Ga0207705_10003017 3300025909 Bacteria 12834
135 Ga0207705_10007800 3300025909 Bacteria 7858
136 Ga0207705_10014192 3300025909 Bacteria 5738
137 Ga0207705_10085354 3300025909 Bacteria 2306
138 Ga0207705_10103957 3300025909 Bacteria 2092
139 Ga0207660_10496156 3300025917 Bacteria 990
140 Ga0207662_10514704 3300025918 Bacteria 825
141 Ga0207657_10000071 3300025919 Bacteria 93725
142 Ga0207657_10000919 3300025919 Bacteria 31133
143 Ga0207657_10001234 3300025919 Bacteria 27316
144 Ga0207657_10001913 3300025919 Bacteria 22483
145 Ga0207657_10004148 3300025919 Bacteria 15361
146 Ga0207657_10010698 3300025919 Bacteria 9137
147 Ga0207657_10037666 3300025919 Bacteria 4315
148 Ga0207657_10095130 3300025919 Bacteria 2479
149 Ga0207657_10346195 3300025919 Bacteria 1173
150 Ga0207649_10000436 3300025920 Bacteria 30088
151 Ga0207649_10021063 3300025920 Bacteria 3747
152 Ga0207649_10116032 3300025920 Bacteria 1797
153 Ga0207649_10482430 3300025920 Unclassified 940
154 Ga0207652_10470290 3300025921 Bacteria 1133
155 Ga0207650_10014144 3300025925 Bacteria 5543
156 Ga0207650_10040582 3300025925 Bacteria 3406
157 Ga0207650_10317755 3300025925 Bacteria 1275
158 Ga0207664_10007118 3300025929 Bacteria 7755
159 Ga0207644_10011048 3300025931 Bacteria 5965
160 Ga0207644_10021738 3300025931 Bacteria 4374
161 Ga0207690_10000045 3300025932 Bacteria 116965
162 Ga0207690_10003369 3300025932 Bacteria 9555
163 Ga0207690_10004995 3300025932 Bacteria 7834
164 Ga0207690_10686391 3300025932 Bacteria 841
165 Ga0207706_10000086 3300025933 Bacteria 95284
166 Ga0207706_10008878 3300025933 Bacteria 9253
167 Ga0207711_10002330 3300025941 Bacteria 17013
168 Ga0207661_10008191 3300025944 Bacteria 7461
169 Ga0207661_10053988 3300025944 Bacteria 3218
170 Ga0207661_10191739 3300025944 Unclassified 1792
171 Ga0207679_10008987 3300025945 Bacteria 6385
172 Ga0207679_10016086 3300025945 Bacteria 4961
173 Ga0207679_10202885 3300025945 Bacteria 1658
174 Ga0207667_10002712 3300025949 Bacteria 21894
175 Ga0207667_10009701 3300025949 Bacteria 11322
176 Ga0207667_10196778 3300025949 Bacteria 2068
177 Ga0207651_10050619 3300025960 Bacteria 2821
178 Ga0207651_10379556 3300025960 Bacteria 1197
179 Ga0207658_10004488 3300025986 Bacteria 9699
180 Ga0207658_10007069 3300025986 Bacteria 7644
181 Ga0207658_10267233 3300025986 Bacteria 1460
182 Ga0207677_10079437 3300026023 Bacteria 2346
183 Ga0207639_10030652 3300026041 Bacteria 3946
184 Ga0207639_10395850 3300026041 Bacteria 1243
185 Ga0207678_10005970 3300026067 Bacteria 10843
186 Ga0207678_10025460 3300026067 Bacteria 5164
187 Ga0207678_10039883 3300026067 Bacteria 4074
188 Ga0207678_10041993 3300026067 Bacteria 3964
189 Ga0207678_10135720 3300026067 Bacteria 2099
190 Ga0207678_10513689 3300026067 Bacteria 1045
191 Ga0207702_10016856 3300026078 Bacteria 6048
192 Ga0207702_10671233 3300026078 Bacteria 1020
193 Ga0207641_10550392 3300026088 Bacteria 1125
194 Ga0207674_10009776 3300026116 Bacteria 10924
195 Ga0207674_10045555 3300026116 Bacteria 4510
196 Ga0207683_10462481 3300026121 Bacteria 1170
197 Ga0207698_10007632 3300026142 Bacteria 6782
198 Ga0207698_10076682 3300026142 Bacteria 2677
199 Ga0207698_10431323 3300026142 Bacteria 1267
200 Ga0207698_10749754 3300026142 Bacteria 975
201 Ga0268266_10009528 3300028379 Bacteria 8547
202 Ga0268266_10012094 3300028379 Bacteria 7469
203 Ga0268264_10032089 3300028381 Bacteria 4310
204 Ga0307408_100096395 3300031548 Bacteria 2244
205 Ga0307405_10037034 3300031731 Bacteria 2929
206 Ga0307413_10073511 3300031824 Bacteria 2161
207 Ga0307410_10023808 3300031852 Bacteria 3815
208 Ga0307406_10037846 3300031901 Bacteria 2983
209 Ga0307407_10289754 3300031903 Bacteria 1137
210 Ga0307412_10029467 3300031911 Bacteria 3445
211 Ga0307409_100188303 3300031995 Bacteria 1834
212 Ga0307416_100018031 3300032002 Bacteria 4960
213 Ga0307416_100209245 3300032002 Bacteria 1859
214 Ga0307411_10161368 3300032005 Bacteria 1679
215 Ga0307415_100018400 3300032126 Bacteria 4219
216 Ga0307415_100105980 3300032126 Bacteria 2074
217 Ga0373938_0017242 3300034957 Bacteria 1420
218 Ga0373928_0012003 3300035084 Bacteria 1723
219 Ga0373943_0021494 3300035170 Bacteria 2981
220 Ga0373935_0012210 3300035692 Bacteria 5165
221 Ga0373947_0064803 3300035725 Bacteria 2228
222 Ga0373925_0010720 3300037068 Bacteria 6647
223 Ga0395899_0000627 3300037312 Bacteria 36773
224 Ga0395899_0040751 3300037312 Bacteria 3473
225 Ga0395899_0105971 3300037312 Bacteria 2024
226 Ga0395899_0587546 3300037312 Bacteria 711
227 Ga0395900_0000031 3300037418 Bacteria 262393
228 Ga0395900_0033911 3300037418 Bacteria 5254
229 Ga0395900_0047925 3300037418 Bacteria 4401
230 Ga0395900_0112144 3300037418 Bacteria 2800
231 Ga0395900_0192629 3300037418 Bacteria 2067
232 Ga0395900_0292400 3300037418 Bacteria 1617
233 Ga0395898_0009515 3300037466 Bacteria 10203
234 Ga0395898_0645501 3300037466 Bacteria 1001
235 Ga0395905_0018079 3300037471 Bacteria 6691
236 Ga0395905_0045714 3300037471 Bacteria 4106
237 Ga0395905_0063882 3300037471 Bacteria 3445
238 Ga0395905_0098590 3300037471 Bacteria 2744
239 Ga0395905_0103037 3300037471 Unclassified 2679
240 Ga0395905_0126569 3300037471 Bacteria 2402
241 Ga0395905_0128844 3300037471 Bacteria 2380
242 Ga0395905_0196956 3300037471 Bacteria 1889
243 Ga0395905_0296894 3300037471 Bacteria 1503
244 Ga0395901_0000035 3300038443 Bacteria 223888
245 Ga0395901_0011748 3300038443 Bacteria 8875
246 Ga0395901_0031783 3300038443 Bacteria 5443
247 Ga0395901_0307801 3300038443 Bacteria 1641
248 Ga0395901_0497644 3300038443 Bacteria 1241
249 Ga0439437_036681 3300042000 Unclassified 628
250 Ga0439448_0084377 3300042005 Unclassified 1069
251 Ga0466961_0016099 3300044693 Bacteria 4802
252 Ga0466963_0137749 3300044694 Bacteria 1689
253 Ga0466963_0262197 3300044694 Bacteria 1213
254 Ga0466971_0021153 3300044719 Bacteria 2894
255 Ga0466957_0125842 3300044842 Bacteria 1637
256 Ga0466958_0003329 3300045836 Bacteria 8323
257 Ga0466958_0264609 3300045836 Bacteria 1101
258 Ga0466967_0008506 3300045976 Bacteria 7531
259 Ga0466967_0019084 3300045976 Bacteria 5504
260 Ga0466967_0070799 3300045976 Bacteria 3120
261 Ga0466967_0138656 3300045976 Bacteria 2264
262 Ga0466967_0561849 3300045976 Bacteria 1124
263 Ga0466967_0991306 3300045976 Bacteria 836
264 Ga0495669_0019333 3300046684 Bacteria 2939
265 Ga0496100_0102718 3300048903 Bacteria 1973
266 Ga0496101_0174112 3300048904 Bacteria 1655
267 Ga0496107_0402182 3300048910 Bacteria 1018
268 Ga0496108_0023676 3300048911 Bacteria 5053
269 Ga0496110_0025257 3300048913 Bacteria 5075
270 Ga0496112_0028626 3300048915 Bacteria 5379
271 Ga0496112_0251081 3300048915 Bacteria 1720
272 Ga0496112_0257061 3300048915 Bacteria 1697
273 Ga0496113_0199183 3300048916 Bacteria 1591
274 Ga0501268_020144 3300049765 Bacteria 1134
275 nmdc:mga07m45_226625_c1 3300050496 Bacteria 1087
276 Ga0500595_001552 3300053119 Bacteria 12160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0128844 Ga0395905_0128844_478_1029 183
2 3300025920 Ga0207649_10021063 Ga0207649_100210634 186
3 3300031901 Ga0307406_10037846 Ga0307406_100378464 189
4 3300032002 Ga0307416_100209245 Ga0307416_1002092451 189
5 3300032126 Ga0307415_100105980 Ga0307415_1001059804 189
6 3300053119 Ga0500595_001552 Ga0500595_001552_6318_6923 191
7 3300005985 Ga0081539_10028125 Ga0081539_100281253 192
8 3300001979 JGI24740J21852_10026213 JGI24740J21852_100262133 193
9 3300001989 JGI24739J22299_10014560 JGI24739J22299_100145602 193
10 3300001989 JGI24739J22299_10056011 JGI24739J22299_100560112 193
11 3300001990 JGI24737J22298_10009051 JGI24737J22298_100090512 193
12 3300001991 JGI24743J22301_10001710 JGI24743J22301_100017102 193
13 3300002075 JGI24738J21930_10002211 JGI24738J21930_100022112 193
14 3300002075 JGI24738J21930_10012516 JGI24738J21930_100125162 193
15 3300003322 rootL2_10148223 rootL2_101482233 193
16 3300005327 Ga0070658_10001347 Ga0070658_1000134713 193
17 3300005327 Ga0070658_10002229 Ga0070658_100022299 193
18 3300005327 Ga0070658_10005428 Ga0070658_100054286 193
19 3300005327 Ga0070658_10026800 Ga0070658_100268003 193
20 3300005327 Ga0070658_10044229 Ga0070658_100442293 193
21 3300005327 Ga0070658_10260850 Ga0070658_102608502 193
22 3300005327 Ga0070658_10655932 Ga0070658_106559322 193
23 3300005327 Ga0070658_10861661 Ga0070658_108616611 193
24 3300005329 Ga0070683_100005771 Ga0070683_1000057715 193
25 3300005329 Ga0070683_100005789 Ga0070683_1000057899 193
26 3300005329 Ga0070683_100027852 Ga0070683_1000278526 193
27 3300005329 Ga0070683_100148311 Ga0070683_1001483113 193
28 3300005331 Ga0070670_100001836 Ga0070670_1000018368 193
29 3300005331 Ga0070670_100154754 Ga0070670_1001547543 193
30 3300005331 Ga0070670_100200582 Ga0070670_1002005822 193
31 3300005331 Ga0070670_101032895 Ga0070670_1010328951 193
32 3300005335 Ga0070666_10000168 Ga0070666_1000016836 193
33 3300005335 Ga0070666_10001192 Ga0070666_100011928 193
34 3300005336 Ga0070680_100152234 Ga0070680_1001522342 193
35 3300005337 Ga0070682_100053537 Ga0070682_1000535372 193
36 3300005339 Ga0070660_100000009 Ga0070660_10000000912 193
37 3300005339 Ga0070660_100001805 Ga0070660_1000018055 193
38 3300005339 Ga0070660_100002256 Ga0070660_1000022569 193
39 3300005339 Ga0070660_100020692 Ga0070660_1000206924 193
40 3300005339 Ga0070660_100024573 Ga0070660_1000245736 193
41 3300005339 Ga0070660_100063009 Ga0070660_1000630092 193
42 3300005339 Ga0070660_100248025 Ga0070660_1002480252 193
43 3300005339 Ga0070660_100637814 Ga0070660_1006378142 193
44 3300005343 Ga0070687_100486043 Ga0070687_1004860431 193
45 3300005344 Ga0070661_100000100 Ga0070661_10000010012 193
46 3300005344 Ga0070661_100017615 Ga0070661_1000176155 193
47 3300005344 Ga0070661_100025335 Ga0070661_1000253352 193
48 3300005344 Ga0070661_100061183 Ga0070661_1000611832 193
49 3300005345 Ga0070692_10001202 Ga0070692_100012026 193
50 3300005345 Ga0070692_10024308 Ga0070692_100243084 193
51 3300005345 Ga0070692_10425451 Ga0070692_104254512 193
52 3300005353 Ga0070669_100736663 Ga0070669_1007366631 193
53 3300005355 Ga0070671_100006764 Ga0070671_1000067643 193
54 3300005355 Ga0070671_100013821 Ga0070671_1000138214 193
55 3300005355 Ga0070671_100014474 Ga0070671_1000144742 193
56 3300005355 Ga0070671_100169665 Ga0070671_1001696652 193
57 3300005364 Ga0070673_100012668 Ga0070673_1000126684 193
58 3300005364 Ga0070673_100355443 Ga0070673_1003554432 193
59 3300005366 Ga0070659_100000981 Ga0070659_10000098110 193
60 3300005366 Ga0070659_100032534 Ga0070659_1000325345 193
61 3300005366 Ga0070659_100039463 Ga0070659_1000394636 193
62 3300005366 Ga0070659_100410846 Ga0070659_1004108462 193
63 3300005366 Ga0070659_100418723 Ga0070659_1004187232 193
64 3300005367 Ga0070667_100006655 Ga0070667_10000665510 193
65 3300005367 Ga0070667_100006939 Ga0070667_1000069399 193
66 3300005367 Ga0070667_100338303 Ga0070667_1003383032 193
67 3300005455 Ga0070663_100004141 Ga0070663_1000041414 193
68 3300005455 Ga0070663_100023044 Ga0070663_1000230444 193
69 3300005455 Ga0070663_100327046 Ga0070663_1003270462 193
70 3300005456 Ga0070678_100647826 Ga0070678_1006478261 193
71 3300005457 Ga0070662_100000035 Ga0070662_1000000353 193
72 3300005457 Ga0070662_100007775 Ga0070662_1000077759 193
73 3300005458 Ga0070681_11086622 Ga0070681_110866221 193
74 3300005530 Ga0070679_100050311 Ga0070679_1000503114 193
75 3300005535 Ga0070684_100003789 Ga0070684_1000037896 193
76 3300005539 Ga0068853_100000409 Ga0068853_10000040919 193
77 3300005539 Ga0068853_100044251 Ga0068853_1000442512 193
78 3300005539 Ga0068853_100114482 Ga0068853_1001144822 193
79 3300005539 Ga0068853_100289254 Ga0068853_1002892542 193
80 3300005544 Ga0070686_100303707 Ga0070686_1003037072 193
81 3300005546 Ga0070696_100780209 Ga0070696_1007802092 193
82 3300005547 Ga0070693_100000322 Ga0070693_10000032217 193
83 3300005548 Ga0070665_100004889 Ga0070665_1000048892 193
84 3300005548 Ga0070665_100012573 Ga0070665_10001257310 193
85 3300005563 Ga0068855_100005577 Ga0068855_10000557712 193
86 3300005563 Ga0068855_100053180 Ga0068855_1000531804 193
87 3300005563 Ga0068855_100540329 Ga0068855_1005403292 193
88 3300005564 Ga0070664_100000025 Ga0070664_10000002591 193
89 3300005564 Ga0070664_100018627 Ga0070664_1000186279 193
90 3300005564 Ga0070664_100220541 Ga0070664_1002205413 193
91 3300005564 Ga0070664_100667642 Ga0070664_1006676422 193
92 3300005577 Ga0068857_100005346 Ga0068857_10000534610 193
93 3300005577 Ga0068857_100579990 Ga0068857_1005799902 193
94 3300005578 Ga0068854_100017451 Ga0068854_1000174514 193
95 3300005578 Ga0068854_100033498 Ga0068854_1000334984 193
96 3300005614 Ga0068856_100000219 Ga0068856_10000021919 193
97 3300005614 Ga0068856_101596268 Ga0068856_1015962681 193
98 3300005616 Ga0068852_100001450 Ga0068852_1000014505 193
99 3300005616 Ga0068852_100018838 Ga0068852_1000188383 193
100 3300005616 Ga0068852_100024324 Ga0068852_1000243246 193
101 3300005616 Ga0068852_100281832 Ga0068852_1002818322 193
102 3300005616 Ga0068852_100596944 Ga0068852_1005969442 193
103 3300005618 Ga0068864_100024144 Ga0068864_1000241445 193
104 3300005834 Ga0068851_10022655 Ga0068851_100226553 193
105 3300005841 Ga0068863_100420415 Ga0068863_1004204152 193
106 3300005842 Ga0068858_100023548 Ga0068858_1000235486 193
107 3300005844 Ga0068862_100018140 Ga0068862_1000181403 193
108 3300006237 Ga0097621_100282092 Ga0097621_1002820922 193
109 3300009174 Ga0105241_10148719 Ga0105241_101487192 193
110 3300009177 Ga0105248_10000163 Ga0105248_1000016312 193
111 3300009553 Ga0105249_10209511 Ga0105249_102095112 193
112 3300013100 Ga0157373_10156459 Ga0157373_101564591 193
113 3300013100 Ga0157373_10724600 Ga0157373_107246001 193
114 3300013100 Ga0157373_10865984 Ga0157373_108659842 193
115 3300013102 Ga0157371_10007968 Ga0157371_100079686 193
116 3300013102 Ga0157371_10019838 Ga0157371_100198383 193
117 3300013102 Ga0157371_10021836 Ga0157371_100218362 193
118 3300013102 Ga0157371_10042433 Ga0157371_100424333 193
119 3300013102 Ga0157371_10182431 Ga0157371_101824312 193
120 3300013102 Ga0157371_10221000 Ga0157371_102210003 193
121 3300013102 Ga0157371_10697257 Ga0157371_106972571 193
122 3300013104 Ga0157370_10062015 Ga0157370_100620154 193
123 3300013104 Ga0157370_10176003 Ga0157370_101760032 193
124 3300013104 Ga0157370_10335550 Ga0157370_103355501 193
125 3300013105 Ga0157369_10441424 Ga0157369_104414242 193
126 3300013105 Ga0157369_10715313 Ga0157369_107153132 193
127 3300013296 Ga0157374_10064082 Ga0157374_100640822 193
128 3300013307 Ga0157372_10046002 Ga0157372_100460026 193
129 3300013307 Ga0157372_10063812 Ga0157372_100638123 193
130 3300014325 Ga0163163_10000173 Ga0163163_1000017370 193
131 3300014968 Ga0157379_10182581 Ga0157379_101825812 193
132 3300025903 Ga0207680_10003609 Ga0207680_100036095 193
133 3300025903 Ga0207680_10005228 Ga0207680_100052283 193
134 3300025904 Ga0207647_10012877 Ga0207647_100128776 193
135 3300025904 Ga0207647_10039113 Ga0207647_100391133 193
136 3300025904 Ga0207647_10047954 Ga0207647_100479541 193
137 3300025904 Ga0207647_10131617 Ga0207647_101316173 193
138 3300025909 Ga0207705_10000169 Ga0207705_1000016973 193
139 3300025909 Ga0207705_10001635 Ga0207705_1000163513 193
140 3300025909 Ga0207705_10003017 Ga0207705_1000301717 193
141 3300025909 Ga0207705_10007800 Ga0207705_1000780010 193
142 3300025909 Ga0207705_10014192 Ga0207705_100141924 193
143 3300025909 Ga0207705_10085354 Ga0207705_100853542 193
144 3300025909 Ga0207705_10103957 Ga0207705_101039572 193
145 3300025917 Ga0207660_10496156 Ga0207660_104961562 193
146 3300025918 Ga0207662_10514704 Ga0207662_105147041 193
147 3300025919 Ga0207657_10000071 Ga0207657_1000007190 193
148 3300025919 Ga0207657_10000919 Ga0207657_1000091927 193
149 3300025919 Ga0207657_10001234 Ga0207657_100012344 193
150 3300025919 Ga0207657_10001913 Ga0207657_100019137 193
151 3300025919 Ga0207657_10004148 Ga0207657_100041487 193
152 3300025919 Ga0207657_10010698 Ga0207657_100106983 193
153 3300025919 Ga0207657_10037666 Ga0207657_100376663 193
154 3300025919 Ga0207657_10095130 Ga0207657_100951303 193
155 3300025919 Ga0207657_10346195 Ga0207657_103461952 193
156 3300025920 Ga0207649_10000436 Ga0207649_1000043619 193
157 3300025920 Ga0207649_10116032 Ga0207649_101160321 193
158 3300025920 Ga0207649_10482430 Ga0207649_104824301 193
159 3300025921 Ga0207652_10470290 Ga0207652_104702902 193
160 3300025925 Ga0207650_10014144 Ga0207650_100141443 193
161 3300025925 Ga0207650_10040582 Ga0207650_100405822 193
162 3300025925 Ga0207650_10317755 Ga0207650_103177552 193
163 3300025929 Ga0207664_10007118 Ga0207664_100071183 193
164 3300025931 Ga0207644_10011048 Ga0207644_100110483 193
165 3300025931 Ga0207644_10021738 Ga0207644_100217385 193
166 3300025932 Ga0207690_10000045 Ga0207690_1000004541 193
167 3300025932 Ga0207690_10003369 Ga0207690_1000336911 193
168 3300025932 Ga0207690_10004995 Ga0207690_100049958 193
169 3300025932 Ga0207690_10686391 Ga0207690_106863912 193
170 3300025933 Ga0207706_10000086 Ga0207706_1000008612 193
171 3300025933 Ga0207706_10008878 Ga0207706_100088786 193
172 3300025941 Ga0207711_10002330 Ga0207711_1000233019 193
173 3300025944 Ga0207661_10008191 Ga0207661_100081919 193
174 3300025944 Ga0207661_10053988 Ga0207661_100539882 193
175 3300025944 Ga0207661_10191739 Ga0207661_101917392 193
176 3300025945 Ga0207679_10008987 Ga0207679_100089874 193
177 3300025945 Ga0207679_10016086 Ga0207679_100160867 193
178 3300025945 Ga0207679_10202885 Ga0207679_102028852 193
179 3300025949 Ga0207667_10002712 Ga0207667_100027128 193
180 3300025949 Ga0207667_10009701 Ga0207667_100097019 193
181 3300025949 Ga0207667_10196778 Ga0207667_101967782 193
182 3300025960 Ga0207651_10050619 Ga0207651_100506194 193
183 3300025960 Ga0207651_10379556 Ga0207651_103795561 193
184 3300025986 Ga0207658_10004488 Ga0207658_1000448810 193
185 3300025986 Ga0207658_10007069 Ga0207658_100070699 193
186 3300025986 Ga0207658_10267233 Ga0207658_102672332 193
187 3300026023 Ga0207677_10079437 Ga0207677_100794373 193
188 3300026041 Ga0207639_10030652 Ga0207639_100306522 193
189 3300026041 Ga0207639_10395850 Ga0207639_103958502 193
190 3300026067 Ga0207678_10005970 Ga0207678_100059704 193
191 3300026067 Ga0207678_10025460 Ga0207678_100254602 193
192 3300026067 Ga0207678_10039883 Ga0207678_100398834 193
193 3300026067 Ga0207678_10041993 Ga0207678_100419933 193
194 3300026067 Ga0207678_10135720 Ga0207678_101357202 193
195 3300026067 Ga0207678_10513689 Ga0207678_105136892 193
196 3300026078 Ga0207702_10016856 Ga0207702_100168566 193
197 3300026078 Ga0207702_10671233 Ga0207702_106712332 193
198 3300026088 Ga0207641_10550392 Ga0207641_105503922 193
199 3300026116 Ga0207674_10009776 Ga0207674_100097767 193
200 3300026116 Ga0207674_10045555 Ga0207674_100455552 193
201 3300026121 Ga0207683_10462481 Ga0207683_104624812 193
202 3300026142 Ga0207698_10007632 Ga0207698_100076323 193
203 3300026142 Ga0207698_10076682 Ga0207698_100766823 193
204 3300026142 Ga0207698_10431323 Ga0207698_104313232 193
205 3300026142 Ga0207698_10749754 Ga0207698_107497542 193
206 3300028379 Ga0268266_10009528 Ga0268266_100095288 193
207 3300028379 Ga0268266_10012094 Ga0268266_100120943 193
208 3300028381 Ga0268264_10032089 Ga0268264_100320894 193
209 3300031548 Ga0307408_100096395 Ga0307408_1000963952 193
210 3300031731 Ga0307405_10037034 Ga0307405_100370343 193
211 3300031824 Ga0307413_10073511 Ga0307413_100735112 193
212 3300031852 Ga0307410_10023808 Ga0307410_100238082 193
213 3300031903 Ga0307407_10289754 Ga0307407_102897542 193
214 3300031911 Ga0307412_10029467 Ga0307412_100294672 193
215 3300031995 Ga0307409_100188303 Ga0307409_1001883032 193
216 3300032002 Ga0307416_100018031 Ga0307416_1000180313 193
217 3300032005 Ga0307411_10161368 Ga0307411_101613682 193
218 3300032126 Ga0307415_100018400 Ga0307415_1000184002 193
219 3300034957 Ga0373938_0017242 Ga0373938_0017242_619_1203 193
220 3300035084 Ga0373928_0012003 Ga0373928_0012003_976_1560 193
221 3300035170 Ga0373943_0021494 Ga0373943_0021494_1187_1777 193
222 3300035692 Ga0373935_0012210 Ga0373935_0012210_1358_1948 193
223 3300035725 Ga0373947_0064803 Ga0373947_0064803_880_1470 193
224 3300037068 Ga0373925_0010720 Ga0373925_0010720_5719_6309 193
225 3300037312 Ga0395899_0000627 Ga0395899_0000627_6746_7327 193
226 3300037312 Ga0395899_0040751 Ga0395899_0040751_582_1163 193
227 3300037312 Ga0395899_0105971 Ga0395899_0105971_100_723 193
228 3300037312 Ga0395899_0587546 Ga0395899_0587546_103_684 193
229 3300037418 Ga0395900_0000031 Ga0395900_0000031_62894_63475 193
230 3300037418 Ga0395900_0033911 Ga0395900_0033911_4591_5172 193
231 3300037418 Ga0395900_0047925 Ga0395900_0047925_884_1465 193
232 3300037418 Ga0395900_0112144 Ga0395900_0112144_1298_1882 193
233 3300037418 Ga0395900_0192629 Ga0395900_0192629_1223_1804 193
234 3300037418 Ga0395900_0292400 Ga0395900_0292400_371_955 193
235 3300037466 Ga0395898_0009515 Ga0395898_0009515_2245_2826 193
236 3300037466 Ga0395898_0645501 Ga0395898_0645501_166_747 193
237 3300037471 Ga0395905_0018079 Ga0395905_0018079_5855_6436 193
238 3300037471 Ga0395905_0045714 Ga0395905_0045714_2631_3212 193
239 3300037471 Ga0395905_0063882 Ga0395905_0063882_2812_3396 193
240 3300037471 Ga0395905_0098590 Ga0395905_0098590_256_837 193
241 3300037471 Ga0395905_0103037 Ga0395905_0103037_208_789 193
242 3300037471 Ga0395905_0126569 Ga0395905_0126569_1298_1882 193
243 3300037471 Ga0395905_0196956 Ga0395905_0196956_1178_1759 193
244 3300037471 Ga0395905_0296894 Ga0395905_0296894_859_1440 193
245 3300038443 Ga0395901_0000035 Ga0395901_0000035_222437_223018 193
246 3300038443 Ga0395901_0011748 Ga0395901_0011748_1141_1725 193
247 3300038443 Ga0395901_0031783 Ga0395901_0031783_2819_3400 193
248 3300038443 Ga0395901_0307801 Ga0395901_0307801_537_1121 193
249 3300038443 Ga0395901_0497644 Ga0395901_0497644_369_950 193
250 3300042000 Ga0439437_036681 Ga0439437_036681_31_612 193
251 3300042005 Ga0439448_0084377 Ga0439448_0084377_225_809 193
252 3300044693 Ga0466961_0016099 Ga0466961_0016099_4050_4631 193
253 3300044694 Ga0466963_0137749 Ga0466963_0137749_511_1095 193
254 3300044694 Ga0466963_0262197 Ga0466963_0262197_363_947 193
255 3300044719 Ga0466971_0021153 Ga0466971_0021153_540_1124 193
256 3300044842 Ga0466957_0125842 Ga0466957_0125842_959_1543 193
257 3300045836 Ga0466958_0003329 Ga0466958_0003329_7089_7673 193
258 3300045836 Ga0466958_0264609 Ga0466958_0264609_453_1034 193
259 3300045976 Ga0466967_0008506 Ga0466967_0008506_4087_4668 193
260 3300045976 Ga0466967_0019084 Ga0466967_0019084_848_1432 193
261 3300045976 Ga0466967_0070799 Ga0466967_0070799_2017_2598 193
262 3300045976 Ga0466967_0138656 Ga0466967_0138656_748_1332 193
263 3300045976 Ga0466967_0561849 Ga0466967_0561849_219_803 193
264 3300045976 Ga0466967_0991306 Ga0466967_0991306_136_720 193
265 3300046684 Ga0495669_0019333 Ga0495669_0019333_878_1459 193
266 3300048903 Ga0496100_0102718 Ga0496100_0102718_252_833 193
267 3300048904 Ga0496101_0174112 Ga0496101_0174112_414_995 193
268 3300048910 Ga0496107_0402182 Ga0496107_0402182_246_830 193
269 3300048911 Ga0496108_0023676 Ga0496108_0023676_1614_2195 193
270 3300048913 Ga0496110_0025257 Ga0496110_0025257_1127_1708 193
271 3300048915 Ga0496112_0028626 Ga0496112_0028626_3040_3621 193
272 3300048915 Ga0496112_0251081 Ga0496112_0251081_649_1230 193
273 3300048915 Ga0496112_0257061 Ga0496112_0257061_333_917 193
274 3300048916 Ga0496113_0199183 Ga0496113_0199183_829_1410 193
275 3300049765 Ga0501268_020144 Ga0501268_020144_96_677 193
276 3300050496 nmdc:mga07m45_226625_c1 nmdc:mga07m45_226625_c1_408_1004 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

37

180

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ktg-assembly2.cif.gz_B crystal structure of a c. elegans ap4a hydrolase binary complex 0.8731 35 143
6uuf-assembly1.cif.gz_A crystal structure of a nudix hydrolase from m. smegmatis, renu 0.8492 33 143
5cfi-assembly4.cif.gz_D structural and functional attributes of malaria parasite ap4a hydrolase 0.8431 32 143
6ypb-assembly1.cif.gz_A nudix1 hydrolase from rosa x hybrida 0.843 33 141
5cfi-assembly3.cif.gz_C structural and functional attributes of malaria parasite ap4a hydrolase 0.8378 33 143
ID Description Score Start End Superfamily
af_A0A1D8PU14_38_158_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8909 36 124 3.90.79.10
af_P43337_8_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8793 7 187 3.90.79.10
af_P43337_8_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8654 7 187 3.90.79.10
af_E7FAS2_11_192_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8549 30 187 3.90.79.10
af_P9WIX9_43_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8477 45 143 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A2W5PFC4-F1-model_v4 CoA pyrophosphatase 0.9718 1 193 GO:0010945
AF-A0A1H7HE65-F1-model_v4 ADP-ribose pyrophosphatase YjhB, NUDIX family 0.9673 1 193 GO:0010945
AF-A0A2W5PFC4-F1-model_v4 CoA pyrophosphatase 0.9668 1 193 GO:0010945
AF-A0A0H3G8J8-F1-model_v4 MutT/nudix family protein 0.9667 33 191 GO:0010945
AF-A0A537RS48-F1-model_v4 CoA pyrophosphatase 0.9625 33 190 GO:0010945

Feature Viewer

pLDDT pTM Quality
91.8 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map