F380839

General Info

Members Datasets Scaffolds Average Seq Length
276 213 552 262

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10015308|JGI25406J46586_100153082
Length 285
Sequence VSERGGAEAAPDGGERATNGGSVTEPLLVERDGAVATVTLNRPDSLNSLDVALKVALRDALGELEQDRSVRAVVLAGAGRAFCVGQDLREHVETLDTGTTDPLGTVRAHYNPIAARLAGMPKPVIAAVRGTAAGAGASLALLADFRVGGPKTTFLMAFANVGLAGDTGVSWSLPRLVGHAKAIELLMLAEPLSATDAQRLGLLXRLVDDDEAVLPAAQELAARLAAGPTVAYGAIKRQLSVGDAGTLSEALAAEAQAQAICGVTADHRNATAAFVAKEKPLFEGR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
163 2501939600 Micromonospora sp. L5 Isolate Unclassified
164 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
165 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
166 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
167 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
168 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
169 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
170 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
171 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
172 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
173 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
174 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
175 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
176 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
177 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
178 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
179 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
180 2855683550 Micromonospora sp. RP3T Isolate Unclassified
181 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
182 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
183 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
184 2858868258 Micromonospora sp. MH33 Isolate Unclassified
185 2858882152 Micromonospora noduli MED15 Isolate Nodule
186 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
187 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
188 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
189 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
190 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
191 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
192 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
193 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
194 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
195 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
196 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
197 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
198 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
199 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
200 2902582711 Micromonospora sp. AP08 Isolate Unclassified
201 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
202 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
203 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
204 649633069 Micromonospora sp. L5 Isolate Unclassified
205 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
206 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
207 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
208 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
209 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
210 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
211 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
212 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
213 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.71
Metatranscriptomes 1.81
Isolates 18.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 2.17
Rhizoplane 4.71
Rhizosphere 79.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10015308 3300003203 Bacteria 3240
2 JGI24751J29686_10002833 3300002459 Bacteria 3495
3 Ga0070658_10012962 3300005327 Bacteria 6692
4 Ga0070658_10198654 3300005327 Bacteria 1691
5 Ga0070683_100051175 3300005329 Bacteria 3824
6 Ga0070670_100034107 3300005331 Bacteria 4381
7 Ga0070666_10157121 3300005335 Bacteria 1588
8 Ga0070680_100012273 3300005336 Bacteria 6653
9 Ga0070680_100315293 3300005336 Bacteria 1327
10 Ga0070682_100006187 3300005337 Bacteria 6707
11 Ga0068868_100036989 3300005338 Bacteria 3782
12 Ga0070660_100026923 3300005339 Bacteria 4285
13 Ga0070689_100308013 3300005340 Bacteria 1320
14 Ga0070691_10008804 3300005341 Bacteria 4619
15 Ga0070661_100018754 3300005344 Bacteria 4923
16 Ga0070661_100063944 3300005344 Bacteria 2703
17 Ga0070692_10033068 3300005345 Bacteria 2605
18 Ga0070668_100041273 3300005347 Bacteria 3535
19 Ga0070675_100008437 3300005354 Bacteria 7997
20 Ga0070671_100138410 3300005355 Bacteria 2053
21 Ga0070688_100048377 3300005365 Bacteria 2642
22 Ga0070659_100004650 3300005366 Bacteria 9804
23 Ga0070659_100095763 3300005366 Bacteria 2384
24 Ga0070667_100083869 3300005367 Bacteria 2730
25 Ga0070709_10006644 3300005434 Bacteria 6312
26 Ga0070709_10007003 3300005434 Bacteria 6162
27 Ga0070714_100053252 3300005435 Bacteria 3453
28 Ga0070714_100113112 3300005435 Bacteria 2406
29 Ga0070713_100056430 3300005436 Bacteria 3267
30 Ga0070710_10005004 3300005437 Bacteria 6272
31 Ga0070701_10158016 3300005438 Bacteria 1311
32 Ga0070711_100012301 3300005439 Bacteria 5339
33 Ga0070700_100024016 3300005441 Bacteria 3574
34 Ga0070678_100007413 3300005456 Bacteria 6505
35 Ga0070681_10053687 3300005458 Bacteria 4016
36 Ga0070685_10043509 3300005466 Bacteria 2568
37 Ga0070706_100346924 3300005467 Bacteria 1384
38 Ga0070679_100029382 3300005530 Bacteria 5423
39 Ga0070679_100268599 3300005530 Bacteria 1660
40 Ga0070672_100075720 3300005543 Bacteria 2687
41 Ga0070686_100522946 3300005544 Bacteria 924
42 Ga0070693_100008547 3300005547 Bacteria 5056
43 Ga0068855_100118656 3300005563 Bacteria 3030
44 Ga0068855_100123297 3300005563 Bacteria 2965
45 Ga0070664_100182707 3300005564 Bacteria 1865
46 Ga0068854_100046912 3300005578 Bacteria 3078
47 Ga0068856_100042035 3300005614 Bacteria 4495
48 Ga0068856_100170277 3300005614 Bacteria 2190
49 Ga0068856_100199155 3300005614 Bacteria 2017
50 Ga0070702_100012505 3300005615 Bacteria 4255
51 Ga0068852_100009067 3300005616 Bacteria 7366
52 Ga0068859_100057473 3300005617 Bacteria 3919
53 Ga0068859_100090604 3300005617 Bacteria 3109
54 Ga0068864_100018929 3300005618 Bacteria 5757
55 Ga0068851_10015246 3300005834 Bacteria 3660
56 Ga0068870_10003104 3300005840 Bacteria 7008
57 Ga0068863_100005394 3300005841 Bacteria 12610
58 Ga0068863_100050336 3300005841 Bacteria 3949
59 Ga0068858_100048665 3300005842 Bacteria 3926
60 Ga0068858_100060520 3300005842 Bacteria 3500
61 Ga0068860_100230786 3300005843 Bacteria 1799
62 Ga0081455_10020292 3300005937 Bacteria 6263
63 Ga0081540_1001478 3300005983 Bacteria 20288
64 Ga0081540_1058991 3300005983 Bacteria 1845
65 Ga0081539_10000094 3300005985 Bacteria 206102
66 Ga0070717_10194271 3300006028 Bacteria 1775
67 Ga0075364_10110031 3300006051 Bacteria 1838
68 Ga0075432_10045813 3300006058 Bacteria 1535
69 Ga0070716_100005203 3300006173 Bacteria 6287
70 Ga0070712_100000316 3300006175 Bacteria 27315
71 Ga0097621_100039853 3300006237 Bacteria 3775
72 Ga0068871_100031569 3300006358 Bacteria 4179
73 Ga0075428_100000285 3300006844 Bacteria 49638
74 Ga0075428_100048432 3300006844 Bacteria 4665
75 Ga0075428_100154186 3300006844 Bacteria 2495
76 Ga0075428_100262345 3300006844 Bacteria 1860
77 Ga0075428_100444411 3300006844 Bacteria 1389
78 Ga0075428_100645912 3300006844 Bacteria 1129
79 Ga0075430_100001700 3300006846 Bacteria 17972
80 Ga0075430_100046257 3300006846 Bacteria 3676
81 Ga0075431_100024128 3300006847 Bacteria 6227
82 Ga0075431_100514648 3300006847 Bacteria 1187
83 Ga0075433_10019058 3300006852 Bacteria 5708
84 Ga0075434_100023900 3300006871 Bacteria 5965
85 Ga0075429_100004655 3300006880 Bacteria 11804
86 Ga0075429_100019292 3300006880 Bacteria 5905
87 Ga0075429_100057868 3300006880 Bacteria 3375
88 Ga0075436_100007073 3300006914 Bacteria 7681
89 Ga0097620_100057473 3300006931 Bacteria 3919
90 Ga0097620_100090602 3300006931 Bacteria 3109
91 Ga0105251_10130476 3300009011 Bacteria 1139
92 Ga0105240_10341880 3300009093 Bacteria 1700
93 Ga0105245_10405557 3300009098 Bacteria 1363
94 Ga0105247_10011597 3300009101 Bacteria 5309
95 Ga0114129_10005110 3300009147 Bacteria 18465
96 Ga0114129_10014049 3300009147 Bacteria 11407
97 Ga0114129_10483294 3300009147 Bacteria 1620
98 Ga0114129_10511853 3300009147 Bacteria 1566
99 Ga0114129_10636542 3300009147 Bacteria 1378
100 Ga0105238_10040458 3300009551 Bacteria 4724
101 Ga0105239_10062923 3300010375 Bacteria 4073
102 Ga0105246_10001918 3300011119 Bacteria 12529
103 Ga0157370_10061772 3300013104 Bacteria 3555
104 Ga0157369_10035750 3300013105 Bacteria 5446
105 Ga0157374_10173381 3300013296 Bacteria 2105
106 Ga0157372_10518345 3300013307 Bacteria 1390
107 Ga0157375_10814929 3300013308 Bacteria 1082
108 Ga0163163_10421637 3300014325 Bacteria 1393
109 Ga0163163_10779716 3300014325 Bacteria 1019
110 Ga0182008_10029493 3300014497 Bacteria 2772
111 Ga0157376_10141104 3300014969 Bacteria 2162
112 Ga0197907_11294301 3300020069 Bacteria 2765
113 Ga0206353_11095838 3300020082 Bacteria 8780
114 Ga0206353_11619828 3300020082 Bacteria 1665
115 Ga0224712_10010516 3300022467 Bacteria 2833
116 Ga0224712_10017046 3300022467 Bacteria 2400
117 Ga0207656_10063525 3300025321 Bacteria 1625
118 Ga0207692_10000834 3300025898 Bacteria 11039
119 Ga0207688_10001356 3300025901 Bacteria 12725
120 Ga0207699_10000431 3300025906 Bacteria 21434
121 Ga0207699_10108687 3300025906 Bacteria 1773
122 Ga0207643_10000252 3300025908 Bacteria 37454
123 Ga0207705_10023393 3300025909 Bacteria 4408
124 Ga0207705_10030568 3300025909 Bacteria 3843
125 Ga0207695_10179200 3300025913 Bacteria 2040
126 Ga0207693_10029794 3300025915 Bacteria 4308
127 Ga0207660_10278316 3300025917 Bacteria 1327
128 Ga0207662_10101798 3300025918 Bacteria 1781
129 Ga0207657_10012261 3300025919 Bacteria 8468
130 Ga0207649_10002137 3300025920 Bacteria 11192
131 Ga0207649_10030112 3300025920 Bacteria 3211
132 Ga0207650_10009635 3300025925 Bacteria 6604
133 Ga0207687_10016338 3300025927 Bacteria 4874
134 Ga0207700_10000150 3300025928 Bacteria 41536
135 Ga0207700_10145917 3300025928 Bacteria 1950
136 Ga0207700_10704921 3300025928 Bacteria 901
137 Ga0207664_10011375 3300025929 Bacteria 6321
138 Ga0207664_10141997 3300025929 Bacteria 2032
139 Ga0207644_10099578 3300025931 Bacteria 2181
140 Ga0207644_10416088 3300025931 Bacteria 1101
141 Ga0207690_10140249 3300025932 Bacteria 1780
142 Ga0207709_10481710 3300025935 Bacteria 965
143 Ga0207670_10053959 3300025936 Bacteria 2710
144 Ga0207665_10013076 3300025939 Bacteria 5454
145 Ga0207691_10022185 3300025940 Bacteria 5988
146 Ga0207711_10549055 3300025941 Bacteria 1078
147 Ga0207689_10014949 3300025942 Bacteria 6586
148 Ga0207689_10265810 3300025942 Bacteria 1420
149 Ga0207667_10245441 3300025949 Bacteria 1832
150 Ga0207703_10067299 3300026035 Bacteria 2948
151 Ga0207639_10120102 3300026041 Bacteria 2158
152 Ga0207678_10001822 3300026067 Bacteria 19525
153 Ga0207678_10158491 3300026067 Bacteria 1933
154 Ga0207708_10200777 3300026075 Bacteria 1591
155 Ga0207702_10010930 3300026078 Bacteria 7572
156 Ga0207702_10035915 3300026078 Bacteria 4144
157 Ga0207641_10053736 3300026088 Bacteria 3415
158 Ga0207641_10245447 3300026088 Bacteria 1670
159 Ga0207641_10280156 3300026088 Bacteria 1568
160 Ga0207641_10303952 3300026088 Bacteria 1508
161 Ga0207676_10006835 3300026095 Bacteria 8078
162 Ga0207676_10299797 3300026095 Bacteria 1467
163 Ga0207674_10250656 3300026116 Bacteria 1717
164 Ga0207683_10000558 3300026121 Bacteria 34428
165 Ga0207698_10004323 3300026142 Bacteria 8645
166 Ga0268264_10088368 3300028381 Bacteria 2667
167 Ga0268264_10184078 3300028381 Bacteria 1899
168 Ga0307515_10076997 3300028794 Bacteria 4412
169 Ga0307513_10021101 3300031456 Bacteria 7696
170 Ga0307408_100015421 3300031548 Bacteria 5087
171 Ga0307408_100502305 3300031548 Bacteria 1062
172 Ga0307516_10028964 3300031730 Bacteria 5600
173 Ga0307405_10110819 3300031731 Bacteria 1859
174 Ga0307413_10083364 3300031824 Bacteria 2057
175 Ga0307413_10474610 3300031824 Bacteria 998
176 Ga0307410_10022462 3300031852 Bacteria 3901
177 Ga0307410_10033849 3300031852 Bacteria 3303
178 Ga0307406_10050642 3300031901 Bacteria 2634
179 Ga0307406_10226010 3300031901 Bacteria 1394
180 Ga0307409_100101464 3300031995 Bacteria 2388
181 Ga0307409_100232666 3300031995 Bacteria 1672
182 Ga0307416_100929328 3300032002 Bacteria 971
183 Ga0307411_10377941 3300032005 Bacteria 1164
184 Ga0307415_100181635 3300032126 Bacteria 1651
185 Ga0307415_100274756 3300032126 Bacteria 1382
186 Ga0307415_100487134 3300032126 Bacteria 1075
187 Ga0373925_0175227 3300037068 Bacteria 1695
188 Ga0439448_0050179 3300042005 Bacteria 1365
189 Ga0439463_072975 3300042016 Bacteria 880
190 Ga0495594_0044674 3300046499 Bacteria 2431
191 Ga0495594_0160714 3300046499 Bacteria 1277
192 Ga0495593_0048418 3300047673 Bacteria 2259
193 Ga0496102_0010950 3300048905 Bacteria 7813
194 Ga0496104_0005657 3300048907 Bacteria 10946
195 Ga0496105_0015166 3300048908 Bacteria 6134
196 Ga0496106_0005516 3300048909 Bacteria 9360
197 Ga0496107_0009898 3300048910 Bacteria 6615
198 Ga0496109_0037231 3300048912 Bacteria 4395
199 Ga0496109_0137023 3300048912 Bacteria 2288
200 Ga0496110_0013247 3300048913 Bacteria 6809
201 Ga0496111_0008718 3300048914 Bacteria 6729
202 Ga0496112_0005211 3300048915 Bacteria 11186
203 Ga0496112_0172684 3300048915 Bacteria 2127
204 Ga0496112_0422092 3300048915 Bacteria 1272
205 Ga0496113_0011663 3300048916 Bacteria 5877
206 Ga0496126_0072597 3300048929 Bacteria 3061
207 Ga0501046_0134080 3300049580 Bacteria 1877
208 Ga0501047_0059434 3300049581 Bacteria 3690
209 Ga0501068_0189211 3300049584 Bacteria 1303
210 Ga0501044_0525180 3300049823 Bacteria 1083
211 nmdc:mga05p37_169469_c1 3300050507 Bacteria 2664
212 nmdc:mga05p37_40880_c1 3300050507 Bacteria 5693
213 nmdc:mga05p37_480522_c1 3300050507 Bacteria 1431
214 nmdc:mga05p37_497988_c1 3300050507 Bacteria 1399
215 nmdc:mga05p37_79778_c1 3300050507 Bacteria 4030
216 nmdc:mga09592_133775_c1 3300050508 Bacteria 2135
217 nmdc:mga09592_231356_c1 3300050508 Bacteria 1602
218 nmdc:mga0qj67_1655_c1 3300050509 Bacteria 15707
219 nmdc:mga0qj67_18101_c1 3300050509 Bacteria 5367
220 nmdc:mga06r32_16515_c1 3300050510 Bacteria 6060
221 nmdc:mga0n895_14278_c1 3300050512 Bacteria 7207
222 nmdc:mga0rr50_8525_c1 3300050513 Bacteria 6385
223 nmdc:mga0a205_9224_c1 3300050515 Bacteria 9008
224 Ga0495619_0102006 3300053085 Bacteria 1954
225 Ga0500579_053068 3300053143 Bacteria 2464
226 2501941821 2501939600 Bacteria 6907073
227 2515493942 2515154088 Bacteria 5526283
228 2515720598 2515154129 Bacteria 5584369
229 2515755318 2515154137 Bacteria 5711575
230 2516086779 2515154202 Bacteria 5471270
231 2516092364 2515154203 Bacteria 5458536
232 2623586410 2622736626 Bacteria 7181580
233 2644017493 2643221601 Bacteria 7493239
234 2644173545 2643221631 Bacteria 8168043
235 2676484891 2675903059 Bacteria 8644972
236 2753272213 2751185782 Bacteria 11227053
237 2772641652 2772190715 Bacteria 6959372
238 2819740831 2818991472 Bacteria 10089953
239 2831939885 2831935698 Bacteria 5963223
240 2832007995 2832004796 Bacteria 6538017
241 2855672206 2855670206 Bacteria 7120389
242 2855678845 2855676851 Bacteria 7063653
243 2855685271 2855683550 Bacteria 7134265
244 2856860330 2856858025 Bacteria 7255264
245 2857295182 2857288857 Bacteria 7189066
246 2858854513 2858848962 Bacteria 6963058
247 2858874097 2858868258 Bacteria 7683772
248 2858888515 2858882152 Bacteria 7230291
249 2858890779 2858888857 Bacteria 7060307
250 2858898532 2858895516 Bacteria 7378898
251 2858905621 2858902515 Bacteria 7086037
252 2866070499 2866065130 Bacteria 6518152
253 2866553062 2866552031 Bacteria 5824618
254 2867303785 2867302475 Bacteria 7087181
255 2867313384 2867312974 Bacteria 7058875
256 2867322797 2867319477 Bacteria 7069771
257 2867509294 2867507094 Bacteria 6506033
258 2869051726 2869048445 Bacteria 6875584
259 2869065802 2869061728 Bacteria 7112407
260 2869070646 2869068681 Bacteria 7205615
261 2880493769 2880489317 Bacteria 7096270
262 2880498554 2880495981 Bacteria 7340502
263 2902586418 2902582711 Bacteria 6187705
264 2929220544 2929219909 Bacteria 6984360
265 2929227133 2929226422 Bacteria 7248583
266 2996224772 2996221748 Bacteria 6799777
267 649811069 649633069 Bacteria 6962533
268 8001785254 8001781756 Bacteria 9586736
269 8003835356 8003830390 Bacteria 6541657
270 8003859281 8003856774 Bacteria 7675274
271 8003873543 8003870546 Bacteria 7396674
272 8054710250 8054704163 Bacteria 7247792
273 8054731010 8054727385 Bacteria 7558670
274 8054735141 8054734606 Bacteria 6947278
275 8055415251 8055412473 Bacteria 6257500
276 8056061277 8056060235 Bacteria 7259403
277 JGI25406J46586_10015308
278 JGI24751J29686_10002833
279 Ga0070658_10012962
280 Ga0070658_10198654
281 Ga0070683_100051175
282 Ga0070670_100034107
283 Ga0070666_10157121
284 Ga0070680_100012273
285 Ga0070680_100315293
286 Ga0070682_100006187
287 Ga0068868_100036989
288 Ga0070660_100026923
289 Ga0070689_100308013
290 Ga0070691_10008804
291 Ga0070661_100018754
292 Ga0070661_100063944
293 Ga0070692_10033068
294 Ga0070668_100041273
295 Ga0070675_100008437
296 Ga0070671_100138410
297 Ga0070688_100048377
298 Ga0070659_100004650
299 Ga0070659_100095763
300 Ga0070667_100083869
301 Ga0070709_10006644
302 Ga0070709_10007003
303 Ga0070714_100053252
304 Ga0070714_100113112
305 Ga0070713_100056430
306 Ga0070710_10005004
307 Ga0070701_10158016
308 Ga0070711_100012301
309 Ga0070700_100024016
310 Ga0070678_100007413
311 Ga0070681_10053687
312 Ga0070685_10043509
313 Ga0070706_100346924
314 Ga0070679_100029382
315 Ga0070679_100268599
316 Ga0070672_100075720
317 Ga0070686_100522946
318 Ga0070693_100008547
319 Ga0068855_100118656
320 Ga0068855_100123297
321 Ga0070664_100182707
322 Ga0068854_100046912
323 Ga0068856_100042035
324 Ga0068856_100170277
325 Ga0068856_100199155
326 Ga0070702_100012505
327 Ga0068852_100009067
328 Ga0068859_100057473
329 Ga0068859_100090604
330 Ga0068864_100018929
331 Ga0068851_10015246
332 Ga0068870_10003104
333 Ga0068863_100005394
334 Ga0068863_100050336
335 Ga0068858_100048665
336 Ga0068858_100060520
337 Ga0068860_100230786
338 Ga0081455_10020292
339 Ga0081540_1001478
340 Ga0081540_1058991
341 Ga0081539_10000094
342 Ga0070717_10194271
343 Ga0075364_10110031
344 Ga0075432_10045813
345 Ga0070716_100005203
346 Ga0070712_100000316
347 Ga0097621_100039853
348 Ga0068871_100031569
349 Ga0075428_100000285
350 Ga0075428_100048432
351 Ga0075428_100154186
352 Ga0075428_100262345
353 Ga0075428_100444411
354 Ga0075428_100645912
355 Ga0075430_100001700
356 Ga0075430_100046257
357 Ga0075431_100024128
358 Ga0075431_100514648
359 Ga0075433_10019058
360 Ga0075434_100023900
361 Ga0075429_100004655
362 Ga0075429_100019292
363 Ga0075429_100057868
364 Ga0075436_100007073
365 Ga0097620_100057473
366 Ga0097620_100090602
367 Ga0105251_10130476
368 Ga0105240_10341880
369 Ga0105245_10405557
370 Ga0105247_10011597
371 Ga0114129_10005110
372 Ga0114129_10014049
373 Ga0114129_10483294
374 Ga0114129_10511853
375 Ga0114129_10636542
376 Ga0105238_10040458
377 Ga0105239_10062923
378 Ga0105246_10001918
379 Ga0157370_10061772
380 Ga0157369_10035750
381 Ga0157374_10173381
382 Ga0157372_10518345
383 Ga0157375_10814929
384 Ga0163163_10421637
385 Ga0163163_10779716
386 Ga0182008_10029493
387 Ga0157376_10141104
388 Ga0197907_11294301
389 Ga0206353_11095838
390 Ga0206353_11619828
391 Ga0224712_10010516
392 Ga0224712_10017046
393 Ga0207656_10063525
394 Ga0207692_10000834
395 Ga0207688_10001356
396 Ga0207699_10000431
397 Ga0207699_10108687
398 Ga0207643_10000252
399 Ga0207705_10023393
400 Ga0207705_10030568
401 Ga0207695_10179200
402 Ga0207693_10029794
403 Ga0207660_10278316
404 Ga0207662_10101798
405 Ga0207657_10012261
406 Ga0207649_10002137
407 Ga0207649_10030112
408 Ga0207650_10009635
409 Ga0207687_10016338
410 Ga0207700_10000150
411 Ga0207700_10145917
412 Ga0207700_10704921
413 Ga0207664_10011375
414 Ga0207664_10141997
415 Ga0207644_10099578
416 Ga0207644_10416088
417 Ga0207690_10140249
418 Ga0207709_10481710
419 Ga0207670_10053959
420 Ga0207665_10013076
421 Ga0207691_10022185
422 Ga0207711_10549055
423 Ga0207689_10014949
424 Ga0207689_10265810
425 Ga0207667_10245441
426 Ga0207703_10067299
427 Ga0207639_10120102
428 Ga0207678_10001822
429 Ga0207678_10158491
430 Ga0207708_10200777
431 Ga0207702_10010930
432 Ga0207702_10035915
433 Ga0207641_10053736
434 Ga0207641_10245447
435 Ga0207641_10280156
436 Ga0207641_10303952
437 Ga0207676_10006835
438 Ga0207676_10299797
439 Ga0207674_10250656
440 Ga0207683_10000558
441 Ga0207698_10004323
442 Ga0268264_10088368
443 Ga0268264_10184078
444 Ga0307515_10076997
445 Ga0307513_10021101
446 Ga0307408_100015421
447 Ga0307408_100502305
448 Ga0307516_10028964
449 Ga0307405_10110819
450 Ga0307413_10083364
451 Ga0307413_10474610
452 Ga0307410_10022462
453 Ga0307410_10033849
454 Ga0307406_10050642
455 Ga0307406_10226010
456 Ga0307409_100101464
457 Ga0307409_100232666
458 Ga0307416_100929328
459 Ga0307411_10377941
460 Ga0307415_100181635
461 Ga0307415_100274756
462 Ga0307415_100487134
463 Ga0373925_0175227
464 Ga0439448_0050179
465 Ga0439463_072975
466 Ga0495594_0044674
467 Ga0495594_0160714
468 Ga0495593_0048418
469 Ga0496102_0010950
470 Ga0496104_0005657
471 Ga0496105_0015166
472 Ga0496106_0005516
473 Ga0496107_0009898
474 Ga0496109_0037231
475 Ga0496109_0137023
476 Ga0496110_0013247
477 Ga0496111_0008718
478 Ga0496112_0005211
479 Ga0496112_0172684
480 Ga0496112_0422092
481 Ga0496113_0011663
482 Ga0496126_0072597
483 Ga0501046_0134080
484 Ga0501047_0059434
485 Ga0501068_0189211
486 Ga0501044_0525180
487 nmdc:mga05p37_169469_c1
488 nmdc:mga05p37_40880_c1
489 nmdc:mga05p37_480522_c1
490 nmdc:mga05p37_497988_c1
491 nmdc:mga05p37_79778_c1
492 nmdc:mga09592_133775_c1
493 nmdc:mga09592_231356_c1
494 nmdc:mga0qj67_1655_c1
495 nmdc:mga0qj67_18101_c1
496 nmdc:mga06r32_16515_c1
497 nmdc:mga0n895_14278_c1
498 nmdc:mga0rr50_8525_c1
499 nmdc:mga0a205_9224_c1
500 Ga0495619_0102006
501 Ga0500579_053068
502 2501941821
503 2515493942
504 2515720598
505 2515755318
506 2516086779
507 2516092364
508 2623586410
509 2644017493
510 2644173545
511 2676484891
512 2753272213
513 2772641652
514 2819740831
515 2831939885
516 2832007995
517 2855672206
518 2855678845
519 2855685271
520 2856860330
521 2857295182
522 2858854513
523 2858874097
524 2858888515
525 2858890779
526 2858898532
527 2858905621
528 2866070499
529 2866553062
530 2867303785
531 2867313384
532 2867322797
533 2867509294
534 2869051726
535 2869065802
536 2869070646
537 2880493769
538 2880498554
539 2902586418
540 2929220544
541 2929227133
542 2996224772
543 649811069
544 8001785254
545 8003835356
546 8003859281
547 8003873543
548 8054710250
549 8054731010
550 8054735141
551 8055415251
552 8056061277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

30

285

0.94

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

35

261

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sla-assembly2.cif.gz_FFF crystal structure of isomerase paag mutant - d136n with oxepin-coa 0.9795 5 262
6sla-assembly2.cif.gz_FFF crystal structure of isomerase paag mutant - d136n with oxepin-coa 0.9717 5 262
2ej5-assembly1.cif.gz_A crystal structure of gk2038 protein (enoyl-coa hydratase subunit ii) from geobacillus kaustophilus 0.9713 1 262
4fzw-assembly1.cif.gz_D crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9678 5 262
2ej5-assembly1.cif.gz_A crystal structure of gk2038 protein (enoyl-coa hydratase subunit ii) from geobacillus kaustophilus 0.9675 1 262
ID Description Score Start End Superfamily
af_P77467_205_262_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9801 211 262 1.10.12.10
2ej5A02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.977 208 262 1.10.12.10
4mi2A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9759 5 204 3.90.226.10
2ej5B02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9759 208 262 1.10.12.10
4fzwD02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9743 211 262 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A7V9IS23-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9916 4 262 GO:0006631
GO:0016853
AF-A0A848IVA8-F1-model_v4 Enoyl-CoA hydratase 0.9903 3 262 GO:0003824
AF-A0A7V8YGN1-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9868 15 262 GO:0016853
AF-A0A1Q4ZPB0-F1-model_v4 Enoyl-CoA hydratase 0.9851 1 262 GO:0003824
GO:0006631
AF-A0A5S4GEJ4-F1-model_v4 Enoyl-CoA hydratase 0.9851 15 262 GO:0003824

Map