F380807

General Info

Members Datasets Scaffolds Average Seq Length
275 240 140 347

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2989349275|2989350916
Length 399
Sequence IGWSLGFGCQRRHEADGSHKINEVLSNRLDSKPEMRRLPCGAPRTPNNRKRPMFALRHRPFLQNARPRLALVARLAAAAVAGGLLAGCMAMDVASLAEAPQLSSKVKGEMAKKKMSPTSPVLVRIFKQESELEVWKVNASGQYALFKTYPMCRWSGKLGPKTKSGDRQAPEGFYHVSAGMLNPNSQYYVSFNLGYPNRLESALGYTGEALMVHGACSSSGCYAMTDQGVGEIYAIVQKALDGGQQRFQVQAYPFRMTTENMAKHKGDPNMPFWRTLKEGYDAFAFTKRQPKVSVCGSRYVFNKEFVDGEPDDPLAQCPAVVGGSEGDLMAKIGEEQKKLDAAIATTTTVSSFAYADGGMHPSFRTLLKQQGAKGLAARISRTKYPVSRPEAALADPYDH

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
4 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
5 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
6 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
7 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
8 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
9 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
10 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
11 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
12 2516143018 Ensifer sp. BR816 Isolate Nodule
13 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
14 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
15 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
16 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
17 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
18 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
19 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
20 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
21 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
22 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
23 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
24 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
25 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
26 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
27 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
28 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
29 2643221557 Ensifer sp. Root558 Isolate Unclassified
30 2643221558 Rhizobium sp. Root149 Isolate Unclassified
31 2643221568 Rhizobium sp. Root564 Isolate Unclassified
32 2643221582 Rhizobium sp. Root651 Isolate Unclassified
33 2643221607 Rhizobium sp. Root73 Isolate Unclassified
34 2643221610 Ensifer sp. Root74 Isolate Unclassified
35 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
36 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
37 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
38 2643221668 Ensifer sp. Root423 Isolate Unclassified
39 2643221675 Ensifer sp. Root1298 Isolate Unclassified
40 2643221680 Ensifer sp. Root1312 Isolate Unclassified
41 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
42 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
43 2643221693 Rhizobium sp. Root491 Isolate Unclassified
44 2643221718 Rhizobium sp. Root268 Isolate Unclassified
45 2643221723 Ensifer sp. Root278 Isolate Unclassified
46 2643221726 Ensifer sp. Root954 Isolate Unclassified
47 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
48 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
49 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
50 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
51 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
52 2791355262 Rhizobium sp. M1 Isolate Nodule
53 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
54 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
55 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
56 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
57 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
58 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
59 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
60 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
61 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
62 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
63 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
64 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
65 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
66 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
67 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
68 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
69 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
70 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
71 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
72 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
73 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
74 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
75 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
76 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
77 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
78 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
79 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
80 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
81 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
82 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
83 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
84 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
85 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
86 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
87 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
88 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
89 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
90 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
91 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
92 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
93 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
94 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
95 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
96 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
97 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
98 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
99 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
100 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
101 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
102 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
103 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
104 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
105 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
106 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
107 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
108 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
109 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
110 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
111 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
112 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
113 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
114 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
115 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
116 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
117 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
118 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
119 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
120 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
121 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
122 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
123 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
124 3004167301 Mesorhizobium loti 582 Isolate Unclassified
125 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
126 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
127 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
128 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
129 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
130 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
131 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
132 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
133 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
134 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
135 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
136 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
137 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
138 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
139 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
140 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
141 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
142 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
143 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
144 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
145 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
146 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
147 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
148 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
154 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
155 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
156 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
168 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
172 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
181 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
221 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
222 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
223 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
224 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
225 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
226 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
231 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
232 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
234 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
235 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
236 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
237 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
238 8018176218 Rhizobium sp. N122 Isolate Nodule
239 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
240 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 50.91
Metatranscriptomes 0.36
Isolates 48.73

Biome Distribution

Category Percentage (%)
Aerial Root 1.82
Bulb 0
Endosphere 20.36
Nodule 25.45
Rhizoplane 2.18
Rhizosphere 25.09
Stem 0
Stem Tuber 0
Unclassified 25.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000158 3300002773 Bacteria 46003
2 JGI25159J45721_1000005 3300002987 Bacteria 214315
3 JGI25151J46595_10032775 3300003187 Bacteria 2009
4 JGI25153J46596_10000242 3300003215 Bacteria 46003
5 rootH2_10098262 3300003320 Bacteria 2703
6 rootL2_10240716 3300003322 Bacteria 2342
7 JGI25160J50197_1000005 3300003354 Bacteria 417280
8 JGI25161J50226_1000584 3300003374 Bacteria 15412
9 Ga0055526_1003755 3300003771 Bacteria 9476
10 Ga0055524_1003475 3300003775 Bacteria 7640
11 Ga0055528_1000064 3300003790 Bacteria 85584
12 Ga0055531_10024233 3300003794 Bacteria 2246
13 Ga0058692_1003848 3300003856 Bacteria 4557
14 Ga0055543_1000091 3300004625 Bacteria 79152
15 Ga0065165_1000002 3300005262 Bacteria 444192
16 Ga0070669_100116664 3300005353 Bacteria 2032
17 Ga0070665_100205420 3300005548 Bacteria 1970
18 Ga0075365_10055038 3300006038 Bacteria 2640
19 Ga0075365_10091939 3300006038 Bacteria 2068
20 Ga0075364_10034363 3300006051 Bacteria 3270
21 Ga0075367_10093735 3300006178 Bacteria 1829
22 Ga0075369_10060849 3300006186 Bacteria 1648
23 Ga0075366_10002007 3300006195 Bacteria 10319
24 Ga0099826_10000054 3300006948 Bacteria 71175
25 Ga0105243_10009447 3300009148 Bacteria 7430
26 Ga0105239_10101247 3300010375 Bacteria 3187
27 Ga0157373_10089837 3300013100 Bacteria 2163
28 Ga0157371_10000002 3300013102 Bacteria 665040
29 Ga0157370_10000286 3300013104 Bacteria 64173
30 Ga0214542_1030488 3300021321 Bacteria 2096
31 Ga0214543_1000018 3300021327 Bacteria 272335
32 Ga0209436_101266 3300025208 Bacteria 9072
33 Ga0207425_1000076 3300025245 Bacteria 106313
34 Ga0209129_1000295 3300025258 Bacteria 46972
35 Ga0209673_1000341 3300025273 Bacteria 85808
36 Ga0209130_1000010 3300025284 Bacteria 444920
37 Ga0209676_1011162 3300025292 Bacteria 3652
38 Ga0209025_1000234 3300025294 Bacteria 130341
39 Ga0209025_1000469 3300025294 Bacteria 78737
40 Ga0209025_1003844 3300025294 Bacteria 13648
41 Ga0209025_1011188 3300025294 Bacteria 5957
42 Ga0209564_1000025 3300025295 Bacteria 520535
43 Ga0209564_1000807 3300025295 Bacteria 42868
44 Ga0209758_1000752 3300025297 Bacteria 46978
45 Ga0209256_1000209 3300025299 Bacteria 110253
46 Ga0209256_1000308 3300025299 Bacteria 85808
47 Ga0209256_1000311 3300025299 Bacteria 84751
48 Ga0207426_1000036 3300025302 Bacteria 444920
49 Ga0209257_1000902 3300025304 Bacteria 41639
50 Ga0209281_1001119 3300027111 Bacteria 19337
51 Ga0209371_1000012 3300027312 Bacteria 748304
52 Ga0209371_1002204 3300027312 Bacteria 11321
53 Ga0209282_1000140 3300027666 Bacteria 42807
54 Ga0268266_10043145 3300028379 Bacteria 3853
55 Ga0268256_1000013 3300030500 Bacteria 752103
56 Ga0268256_1004573 3300030500 Bacteria 5689
57 Ga0316181_1002114 3300030744 Bacteria 4281
58 Ga0307513_10001773 3300031456 Bacteria 30712
59 Ga0307513_10006546 3300031456 Bacteria 15215
60 Ga0307408_100234644 3300031548 Bacteria 1504
61 Ga0307516_10132470 3300031730 Bacteria 2271
62 Ga0307405_10121096 3300031731 Bacteria 1791
63 Ga0395905_0010907 3300037471 Bacteria 8798
64 Ga0395905_0027492 3300037471 Bacteria 5364
65 Ga0395905_0141317 3300037471 Bacteria 2264
66 Ga0439447_027107 3300041407 Bacteria 1464
67 Ga0439465_0005396 3300041413 Bacteria 4079
68 Ga0439465_0009965 3300041413 Bacteria 2991
69 Ga0450920_013218 3300042122 Bacteria 1554
70 Ga0495617_049393 3300046452 Bacteria 1400
71 Ga0495590_0062717 3300046457 Bacteria 1301
72 Ga0495638_0000931 3300046460 Bacteria 29693
73 Ga0495605_0080762 3300046474 Bacteria 1521
74 Ga0495585_0027936 3300046492 Bacteria 3220
75 Ga0495607_0140745 3300046501 Bacteria 1245
76 Ga0495583_0005156 3300046506 Bacteria 8998
77 Ga0495631_0088958 3300046518 Bacteria 1330
78 Ga0495632_0046496 3300046519 Bacteria 2156
79 Ga0495633_0062851 3300046558 Bacteria 1738
80 Ga0495668_0004871 3300046616 Bacteria 9323
81 Ga0495611_0104991 3300046648 Bacteria 1314
82 Ga0495625_0024309 3300046660 Bacteria 4613
83 Ga0495588_0002140 3300046674 Bacteria 8455
84 Ga0495588_0023480 3300046674 Bacteria 3054
85 Ga0495660_0140861 3300046810 Bacteria 1200
86 Ga0495636_0012924 3300047318 Bacteria 3309
87 Ga0495687_043883 3300047443 Bacteria 1946
88 Ga0495681_0000886 3300047470 Bacteria 23149
89 Ga0496106_0094230 3300048909 Bacteria 2315
90 Ga0496117_0000016 3300048920 Bacteria 523642
91 Ga0496117_0005584 3300048920 Bacteria 13155
92 Ga0496117_0042214 3300048920 Bacteria 3330
93 Ga0496118_0000535 3300048921 Bacteria 62444
94 Ga0496118_0023796 3300048921 Bacteria 5308
95 Ga0496119_0016762 3300048922 Bacteria 5551
96 Ga0496120_0000056 3300048923 Bacteria 180367
97 Ga0496120_0025290 3300048923 Bacteria 3687
98 Ga0496121_0000003 3300048924 Bacteria 1191431
99 Ga0496122_0000002 3300048925 Bacteria 905834
100 Ga0496122_0000606 3300048925 Bacteria 73602
101 Ga0496122_0059447 3300048925 Bacteria 2821
102 Ga0496123_0000002 3300048926 Bacteria 1811682
103 Ga0496123_0000450 3300048926 Bacteria 73652
104 Ga0496124_0000704 3300048927 Bacteria 54690
105 Ga0496124_0025759 3300048927 Bacteria 5318
106 Ga0496124_0031298 3300048927 Bacteria 4711
107 Ga0496124_0146195 3300048927 Bacteria 1860
108 Ga0496125_0000262 3300048928 Bacteria 108389
109 Ga0496125_0003535 3300048928 Bacteria 18835
110 Ga0496126_0011975 3300048929 Bacteria 8914
111 Ga0496126_0172680 3300048929 Bacteria 1840
112 Ga0495682_0060420 3300049460 Bacteria 1369
113 Ga0501032_0002309 3300049569 Bacteria 14970
114 Ga0501034_0000318 3300049571 Bacteria 85198
115 Ga0501034_0017149 3300049571 Bacteria 7431
116 Ga0501034_0192106 3300049571 Bacteria 2003
117 Ga0501038_0000021 3300049574 Bacteria 151672
118 Ga0501039_0000026 3300049575 Bacteria 150606
119 Ga0501035_0001048 3300049822 Bacteria 28937
120 nmdc:mga00v17_16056_c1 3300050491 Bacteria 4216
121 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
122 nmdc:mga0yw44_3130_c1 3300050492 Bacteria 7260
123 nmdc:mga0yw44_67401_c1 3300050492 Bacteria 2212
124 nmdc:mga0k408_3057_c2 3300050493 Bacteria 8582
125 nmdc:mga0sz30_111494_c1 3300050516 Bacteria 1199
126 nmdc:mga0sz30_11198_c1 3300050516 Bacteria 3456
127 nmdc:mga0sz30_486_c1 3300050516 Bacteria 14844
128 Ga0500610_0070013 3300053079 Bacteria 1829
129 Ga0500650_0131414 3300053098 Bacteria 1164
130 Ga0500560_000080 3300053107 Bacteria 9369
131 Ga0500569_021763 3300053109 Bacteria 1699
132 Ga0500621_026611 3300053126 Bacteria 2272
133 Ga0500561_0000032 3300053137 Bacteria 28548
134 Ga0500564_099897 3300053138 Bacteria 1284
135 Ga0500568_0003134 3300053139 Bacteria 9425
136 Ga0500616_0003578 3300053153 Bacteria 11751
137 Ga0500622_0000789 3300053156 Bacteria 27478
138 Ga0500624_000321 3300053157 Bacteria 16362
139 Ga0500627_0111102 3300053158 Bacteria 1234
140 Ga0587090_001776 3300059510 Bacteria 2247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053098 Ga0500650_0131414 Ga0500650_0131414_47_919 290
2 3300041413 Ga0439465_0005396 Ga0439465_0005396_2388_3437 302
3 3300049460 Ga0495682_0060420 Ga0495682_0060420_13_945 310
4 3300053109 Ga0500569_021763 Ga0500569_021763_745_1677 310
5 3300003320 rootH2_10098262 rootH2_100982622 311
6 3300037471 Ga0395905_0141317 Ga0395905_0141317_872_1894 312
7 3300003322 rootL2_10240716 rootL2_102407163 314
8 3300053156 Ga0500622_0000789 Ga0500622_0000789_18671_19675 314
9 3300031456 Ga0307513_10001773 Ga0307513_100017737 316
10 3300031730 Ga0307516_10132470 Ga0307516_101324704 316
11 iso_pu_bacteria 2923556063 2923558407 316
12 3300049571 Ga0501034_0017149 Ga0501034_0017149_2604_3605 317
13 3300005548 Ga0070665_100205420 Ga0070665_1002054201 318
14 3300028379 Ga0268266_10043145 Ga0268266_100431452 318
15 3300053126 Ga0500621_026611 Ga0500621_026611_81_1109 318
16 iso_pu_bacteria 2643221582 2643919760 319
17 iso_pu_bacteria 2920822456 2920827804 319
18 3300010375 Ga0105239_10101247 Ga0105239_101012473 320
19 3300031548 Ga0307408_100234644 Ga0307408_1002346442 320
20 3300037471 Ga0395905_0010907 Ga0395905_0010907_75_1103 320
21 3300037471 Ga0395905_0027492 Ga0395905_0027492_2232_3257 320
22 3300041407 Ga0439447_027107 Ga0439447_027107_119_1132 320
23 3300041413 Ga0439465_0009965 Ga0439465_0009965_787_1800 320
24 3300042122 Ga0450920_013218 Ga0450920_013218_244_1257 320
25 3300049569 Ga0501032_0002309 Ga0501032_0002309_11905_12909 320
26 3300049571 Ga0501034_0000318 Ga0501034_0000318_33254_34258 320
27 3300049574 Ga0501038_0000021 Ga0501038_0000021_98677_99681 320
28 3300049575 Ga0501039_0000026 Ga0501039_0000026_98661_99665 320
29 3300049822 Ga0501035_0001048 Ga0501035_0001048_4527_5531 320
30 iso_pu_bacteria 2643221623 2644129775 320
31 iso_pu_bacteria 2881861095 2881865201 320
32 iso_pu_bacteria 2996310559 2996314330 320
33 iso_pu_bacteria 8002285264 8002288547 320
34 3300006948 Ga0099826_10000054 Ga0099826_1000005439 321
35 3300025294 Ga0209025_1003844 Ga0209025_100384414 321
36 3300027312 Ga0209371_1002204 Ga0209371_100220414 321
37 3300027666 Ga0209282_1000140 Ga0209282_100014021 321
38 3300030500 Ga0268256_1004573 Ga0268256_10045739 321
39 3300030744 Ga0316181_1002114 Ga0316181_10021144 321
40 3300046452 Ga0495617_049393 Ga0495617_049393_49_1026 321
41 3300046457 Ga0495590_0062717 Ga0495590_0062717_299_1267 321
42 3300046474 Ga0495605_0080762 Ga0495605_0080762_83_1060 321
43 3300046492 Ga0495585_0027936 Ga0495585_0027936_1340_2317 321
44 3300046501 Ga0495607_0140745 Ga0495607_0140745_183_1160 321
45 3300046519 Ga0495632_0046496 Ga0495632_0046496_738_1715 321
46 3300046616 Ga0495668_0004871 Ga0495668_0004871_841_1818 321
47 3300046810 Ga0495660_0140861 Ga0495660_0140861_171_1148 321
48 3300053079 Ga0500610_0070013 Ga0500610_0070013_553_1530 321
49 3300053158 Ga0500627_0111102 Ga0500627_0111102_24_1001 321
50 iso_pu_bacteria 2537561587 2537876841 321
51 iso_pu_bacteria 2599185156 2599331386 321
52 iso_pu_bacteria 2599185210 2599602906 321
53 iso_pu_bacteria 2838714209 2838717231 321
54 iso_pu_bacteria 2841859092 2841861323 321
55 iso_pu_bacteria 2842130223 2842132757 321
56 iso_pu_bacteria 2842175837 2842178371 321
57 iso_pu_bacteria 2842515876 2842518410 321
58 iso_pu_bacteria 2842922631 2842923781 321
59 iso_pu_bacteria 2916061851 2916061956 321
60 iso_pu_bacteria 2921250672 2921255864 321
61 iso_pu_bacteria 2933006813 2933009867 321
62 iso_pu_bacteria 2933011516 2933014036 321
63 3300048909 Ga0496106_0094230 Ga0496106_0094230_948_2066 322
64 iso_pu_bacteria 2513237146 2513927688 324
65 iso_pu_bacteria 2599185170 2599414634 324
66 iso_pu_bacteria 2838035591 2838036995 324
67 iso_pu_bacteria 2838661181 2838661952 324
68 iso_pu_bacteria 2513237159 2513997291 326
69 iso_pu_bacteria 2643221558 2643810826 326
70 iso_pu_bacteria 2643221568 2643858305 326
71 iso_pu_bacteria 2643221568 2643858444 326
72 iso_pu_bacteria 2775507049 2776912103 326
73 iso_pu_bacteria 2842521101 2842522464 326
74 iso_pu_bacteria 2891373044 2891376190 326
75 3300003790 Ga0055528_1000064 Ga0055528_100006448 327
76 3300025273 Ga0209673_1000341 Ga0209673_100034151 327
77 3300025295 Ga0209564_1000807 Ga0209564_100080739 327
78 3300025299 Ga0209256_1000308 Ga0209256_100030851 327
79 3300027111 Ga0209281_1001119 Ga0209281_100111913 327
80 3300053138 Ga0500564_099897 Ga0500564_099897_56_1141 327
81 iso_pu_bacteria 2854896431 2854896723 327
82 iso_pu_bacteria 8056875544 8056875891 327
83 3300047443 Ga0495687_043883 Ga0495687_043883_291_1361 328
84 iso_pu_bacteria 2516143018 2516208356 328
85 iso_pu_bacteria 3004167301 3004169949 328
86 3300025294 Ga0209025_1000469 Ga0209025_100046953 329
87 3300048920 Ga0496117_0005584 Ga0496117_0005584_9895_10938 329
88 3300048925 Ga0496122_0000606 Ga0496122_0000606_26654_27697 329
89 3300048926 Ga0496123_0000450 Ga0496123_0000450_26704_27747 329
90 3300048927 Ga0496124_0000704 Ga0496124_0000704_23715_24758 329
91 3300048927 Ga0496124_0146195 Ga0496124_0146195_695_1738 329
92 3300048928 Ga0496125_0003535 Ga0496125_0003535_5905_6948 329
93 3300048929 Ga0496126_0011975 Ga0496126_0011975_6833_7876 329
94 3300049571 Ga0501034_0192106 Ga0501034_0192106_675_1718 329
95 iso_pu_bacteria 2582581306 2585267906 329
96 iso_pu_bacteria 2582581865 2585386990 329
97 iso_pu_bacteria 2582581866 2585396854 329
98 iso_pu_bacteria 2643221607 2644049275 329
99 iso_pu_bacteria 2643221636 2644204380 329
100 iso_pu_bacteria 2643221637 2644210336 329
101 iso_pu_bacteria 2643221686 2644482309 329
102 iso_pu_bacteria 2643221689 2644501944 329
103 iso_pu_bacteria 2643221718 2644653888 329
104 iso_pu_bacteria 2989349275 2989350916 329
105 3300031456 Ga0307513_10006546 Ga0307513_100065464 330
106 3300031731 Ga0307405_10121096 Ga0307405_101210961 330
107 3300046674 Ga0495588_0023480 Ga0495588_0023480_471_1523 330
108 iso_pu_bacteria 2508501122 2509110807 330
109 iso_pu_bacteria 2509276019 2509378539 330
110 iso_pu_bacteria 2582581283 2585165896 330
111 iso_pu_bacteria 2599185352 2600196407 330
112 iso_pu_bacteria 2643221557 2643809275 330
113 iso_pu_bacteria 2643221610 2644069263 330
114 iso_pu_bacteria 2643221668 2644379838 330
115 iso_pu_bacteria 2643221675 2644420416 330
116 iso_pu_bacteria 2643221680 2644453942 330
117 iso_pu_bacteria 2643221723 2644674893 330
118 iso_pu_bacteria 2643221726 2644686285 330
119 iso_pu_bacteria 2850079185 2850084030 330
120 iso_pu_bacteria 2929138655 2929141125 330
121 3300002987 JGI25159J45721_1000005 JGI25159J45721_1000005184 331
122 3300003187 JGI25151J46595_10032775 JGI25151J46595_100327751 331
123 3300003354 JGI25160J50197_1000005 JGI25160J50197_1000005208 331
124 3300003374 JGI25161J50226_1000584 JGI25161J50226_10005843 331
125 3300003771 Ga0055526_1003755 Ga0055526_10037553 331
126 3300003775 Ga0055524_1003475 Ga0055524_10034751 331
127 3300003794 Ga0055531_10024233 Ga0055531_100242332 331
128 3300004625 Ga0055543_1000091 Ga0055543_100009114 331
129 3300005262 Ga0065165_1000002 Ga0065165_1000002183 331
130 3300025208 Ga0209436_101266 Ga0209436_1012667 331
131 3300025284 Ga0209130_1000010 Ga0209130_1000010181 331
132 3300025292 Ga0209676_1011162 Ga0209676_10111625 331
133 3300025294 Ga0209025_1000234 Ga0209025_100023465 331
134 3300025295 Ga0209564_1000025 Ga0209564_1000025216 331
135 3300025299 Ga0209256_1000209 Ga0209256_100020957 331
136 3300025299 Ga0209256_1000311 Ga0209256_100031166 331
137 3300025302 Ga0207426_1000036 Ga0207426_1000036181 331
138 3300025304 Ga0209257_1000902 Ga0209257_10009022 331
139 3300046460 Ga0495638_0000931 Ga0495638_0000931_5810_6865 331
140 3300047318 Ga0495636_0012924 Ga0495636_0012924_1192_2262 331
141 3300053139 Ga0500568_0003134 Ga0500568_0003134_768_1838 331
142 3300053153 Ga0500616_0003578 Ga0500616_0003578_10159_11229 331
143 3300006038 Ga0075365_10055038 Ga0075365_100550381 332
144 3300006051 Ga0075364_10034363 Ga0075364_100343632 332
145 3300013100 Ga0157373_10089837 Ga0157373_100898372 332
146 3300046506 Ga0495583_0005156 Ga0495583_0005156_7166_8242 332
147 3300048920 Ga0496117_0042214 Ga0496117_0042214_259_1311 332
148 3300048922 Ga0496119_0016762 Ga0496119_0016762_4000_5052 332
149 3300048923 Ga0496120_0025290 Ga0496120_0025290_630_1682 332
150 3300048924 Ga0496121_0000003 Ga0496121_0000003_675750_676802 332
151 3300048925 Ga0496122_0059447 Ga0496122_0059447_39_1091 332
152 3300048927 Ga0496124_0025759 Ga0496124_0025759_1988_3040 332
153 3300048928 Ga0496125_0000262 Ga0496125_0000262_64345_65397 332
154 3300048929 Ga0496126_0172680 Ga0496126_0172680_102_1154 332
155 3300050491 nmdc:mga00v17_16056_c1 nmdc:mga00v17_16056_c1_3056_4108 332
156 iso_pu_bacteria 2510917028 2511181479 332
157 iso_pu_bacteria 2513237085 2513575649 332
158 iso_pu_bacteria 2513237138 2513868624 332
159 iso_pu_bacteria 2513237144 2513911435 332
160 iso_pu_bacteria 2554235003 2554245570 332
161 iso_pu_bacteria 2558860242 2559296600 332
162 iso_pu_bacteria 2582581299 2585233618 332
163 iso_pu_bacteria 2585427528 2585540107 332
164 iso_pu_bacteria 2585427593 2585838305 332
165 iso_pu_bacteria 2600255279 2601610514 332
166 iso_pu_bacteria 2600255308 2601747156 332
167 iso_pu_bacteria 2643221582 2643917425 332
168 iso_pu_bacteria 2643221693 2644520729 332
169 iso_pu_bacteria 2718218233 2720617970 332
170 iso_pu_bacteria 2718218269 2720773012 332
171 iso_pu_bacteria 2721755819 2724093041 332
172 iso_pu_bacteria 2724679232 2725952375 332
173 iso_pu_bacteria 2791355262 2793334956 332
174 iso_pu_bacteria 2808606387 2808987053 332
175 iso_pu_bacteria 2818991439 2819560642 332
176 iso_pu_bacteria 2838675328 2838677864 332
177 iso_pu_bacteria 2838719591 2838722160 332
178 iso_pu_bacteria 2838724970 2838727980 332
179 iso_pu_bacteria 2841846520 2841849641 332
180 iso_pu_bacteria 2842124991 2842127611 332
181 iso_pu_bacteria 2842152218 2842154751 332
182 iso_pu_bacteria 2842170452 2842173249 332
183 iso_pu_bacteria 2842187318 2842190338 332
184 iso_pu_bacteria 2842211629 2842214652 332
185 iso_pu_bacteria 2842224351 2842227372 332
186 iso_pu_bacteria 2899792073 2899795075 332
187 iso_pu_bacteria 2899845264 2899849907 332
188 iso_pu_bacteria 2919114240 2919117489 332
189 iso_pu_bacteria 2926754445 2926758934 332
190 iso_pu_bacteria 2926760298 2926763552 332
191 iso_pu_bacteria 2933594066 2933595821 332
192 iso_pu_bacteria 2979089926 2979091408 332
193 iso_pu_bacteria 2979095461 2979096931 332
194 iso_pu_bacteria 2979100975 2979101400 332
195 iso_pu_bacteria 2984509177 2984510648 332
196 iso_pu_bacteria 2984518228 2984518649 332
197 iso_pu_bacteria 2984537506 2984538997 332
198 iso_pu_bacteria 2984587000 2984588480 332
199 iso_pu_bacteria 2984601300 2984605694 332
200 iso_pu_bacteria 650716007 650843022 332
201 iso_pu_bacteria 8003570095 8003574267 332
202 iso_pu_bacteria 8005619151 8005624530 332
203 iso_pu_bacteria 8018176218 8018178236 332
204 iso_pu_bacteria 8054460903 8054464422 332
205 3300002773 JGI25152J39213_1000158 JGI25152J39213_100015815 333
206 3300003215 JGI25153J46596_10000242 JGI25153J46596_1000024247 333
207 3300003856 Ga0058692_1003848 Ga0058692_10038482 333
208 3300005353 Ga0070669_100116664 Ga0070669_1001166642 333
209 3300006038 Ga0075365_10091939 Ga0075365_100919393 333
210 3300006178 Ga0075367_10093735 Ga0075367_100937352 333
211 3300006186 Ga0075369_10060849 Ga0075369_100608491 333
212 3300006195 Ga0075366_10002007 Ga0075366_100020076 333
213 3300009148 Ga0105243_10009447 Ga0105243_100094475 333
214 3300013102 Ga0157371_10000002 Ga0157371_10000002450 333
215 3300013104 Ga0157370_10000286 Ga0157370_1000028630 333
216 3300021321 Ga0214542_1030488 Ga0214542_10304882 333
217 3300021327 Ga0214543_1000018 Ga0214543_1000018233 333
218 3300025245 Ga0207425_1000076 Ga0207425_1000076110 333
219 3300025258 Ga0209129_1000295 Ga0209129_100029518 333
220 3300025294 Ga0209025_1011188 Ga0209025_10111885 333
221 3300025297 Ga0209758_1000752 Ga0209758_100075218 333
222 3300027312 Ga0209371_1000012 Ga0209371_1000012193 333
223 3300030500 Ga0268256_1000013 Ga0268256_1000013193 333
224 3300046518 Ga0495631_0088958 Ga0495631_0088958_153_1232 333
225 3300046558 Ga0495633_0062851 Ga0495633_0062851_623_1678 333
226 3300046648 Ga0495611_0104991 Ga0495611_0104991_48_1127 333
227 3300046660 Ga0495625_0024309 Ga0495625_0024309_2209_3288 333
228 3300046674 Ga0495588_0002140 Ga0495588_0002140_106_1161 333
229 3300047470 Ga0495681_0000886 Ga0495681_0000886_15324_16379 333
230 3300048920 Ga0496117_0000016 Ga0496117_0000016_326896_327951 333
231 3300048921 Ga0496118_0000535 Ga0496118_0000535_19267_20322 333
232 3300048921 Ga0496118_0023796 Ga0496118_0023796_935_1990 333
233 3300048923 Ga0496120_0000056 Ga0496120_0000056_15873_16928 333
234 3300048925 Ga0496122_0000002 Ga0496122_0000002_327557_328612 333
235 3300048926 Ga0496123_0000002 Ga0496123_0000002_1483071_1484126 333
236 3300048926 Ga0496123_0000002 Ga0496123_0000002_327557_328612 333
237 3300048927 Ga0496124_0031298 Ga0496124_0031298_2370_3419 333
238 3300050491 nmdc:mga00v17_3_c1 nmdc:mga00v17_3_c1_106769_107818 333
239 3300050492 nmdc:mga0yw44_3130_c1 nmdc:mga0yw44_3130_c1_2176_3225 333
240 3300050492 nmdc:mga0yw44_67401_c1 nmdc:mga0yw44_67401_c1_1009_2103 333
241 3300050493 nmdc:mga0k408_3057_c2 nmdc:mga0k408_3057_c2_804_1859 333
242 3300050516 nmdc:mga0sz30_111494_c1 nmdc:mga0sz30_111494_c1_95_1150 333
243 3300050516 nmdc:mga0sz30_11198_c1 nmdc:mga0sz30_11198_c1_935_1990 333
244 3300050516 nmdc:mga0sz30_486_c1 nmdc:mga0sz30_486_c1_7078_8127 333
245 3300053107 Ga0500560_000080 Ga0500560_000080_5992_7047 333
246 3300053137 Ga0500561_0000032 Ga0500561_0000032_17391_18440 333
247 3300053157 Ga0500624_000321 Ga0500624_000321_8841_9896 333
248 3300059510 Ga0587090_001776 Ga0587090_001776_351_1406 333
249 iso_pu_bacteria 2513237089 2513602488 333
250 iso_pu_bacteria 2513237156 2513984306 333
251 iso_pu_bacteria 2513237160 2514004668 333
252 iso_pu_bacteria 2802428858 2802716309 333
253 iso_pu_bacteria 2802428859 2802722653 333
254 iso_pu_bacteria 2802428860 2802729205 333
255 iso_pu_bacteria 2802428861 2802735597 333
256 iso_pu_bacteria 2802428862 2802741828 333
257 iso_pu_bacteria 2802428863 2802748277 333
258 iso_pu_bacteria 2937029754 2937030908 333
259 iso_pu_bacteria 2937036028 2937039590 333
260 iso_pu_bacteria 2937078374 2937081298 333
261 iso_pu_bacteria 2937084907 2937088023 333
262 iso_pu_bacteria 2957375807 2957377040 333
263 iso_pu_bacteria 2957437181 2957442921 333
264 iso_pu_bacteria 2960591022 2960592307 333
265 iso_pu_bacteria 2960631154 2960631406 333
266 iso_pu_bacteria 2960680706 2960682770 333
267 iso_pu_bacteria 2960693952 2960699421 333
268 iso_pu_bacteria 2967686174 2967689077 333
269 iso_pu_bacteria 2967728569 2967731655 333
270 iso_pu_bacteria 2970026789 2970026851 333
271 iso_pu_bacteria 2970122695 2970124783 333
272 iso_pu_bacteria 2970143518 2970144709 333
273 iso_pu_bacteria 2977530762 2977533029 333
274 iso_pu_bacteria 2977544691 2977545030 333
275 iso_pu_bacteria 8003999396 8004003718 333

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ikr-assembly1.cif.gz_B crystal structure of dpaa 0.9232 52 236
8ikr-assembly1.cif.gz_A crystal structure of dpaa 0.9214 52 240
8ikr-assembly1.cif.gz_B crystal structure of dpaa 0.8936 52 236
8ikr-assembly1.cif.gz_A crystal structure of dpaa 0.8898 52 240
5a9q-assembly1.cif.gz_7 human nuclear pore complex 0.7917 64 84
ID Description Score Start End Superfamily
af_P0AA99_43_186_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.9392 54 198 2.40.440.10
af_P0AA99_43_186_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.933 54 198 2.40.440.10
af_P53011_1_346_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8394 65 82 2.130.10.10
af_B8JIR3_129_323_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8206 62 85 2.130.10.10
af_K7MC23_265_403_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8203 60 84 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A285R5S0-F1-model_v4 Murein L,D-transpeptidase YafK 0.9686 49 328 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A529ZL94-F1-model_v4 Murein L,D-transpeptidase 0.9661 48 234 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A2C9DE02-F1-model_v4 L,D-transpeptidase catalytic domain 0.9645 35 278 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A7Y1UKZ6-F1-model_v4 Murein L,D-transpeptidase 0.9641 38 236 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A4Q2YXG1-F1-model_v4 Murein L,D-transpeptidase 0.9638 38 236 GO:0008360
GO:0009252
GO:0016740
GO:0071555

Feature Viewer

pLDDT pTM Quality
77.94 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map