F380715

General Info

Members Datasets Scaffolds Average Seq Length
275 136 550 123

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0148074|Ga0501041_0148074_1049_1453
Length 134
Sequence MTDTGPWRGGLAVDFNSILIGSEDPGRLAAYYTTLFGDPSWSDRDYTGWLVGSGAVTVGPHSEVTGRNPQPGRLIWNVESADVQADFERFKAAGAIVVREPYGFDDAPGSLIATFEDPDGNYFQLVSPMGPPEG

Samples

Sample ID Description Type Environment
1 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
84 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
85 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
86 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
87 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
88 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
89 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.82
Rhizosphere 98.18
Stem 0
Stem Tuber 0
Unclassified 28.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501041_0148074 3300049577 Unclassified 1465
2 Ga0058863_11864677 3300004799 Bacteria 669
3 Ga0070676_11374925 3300005328 Unclassified 541
4 Ga0068869_100144989 3300005334 Bacteria 1837
5 Ga0068869_101755853 3300005334 Unclassified 554
6 Ga0070680_100000008 3300005336 Bacteria 100309
7 Ga0070691_10214547 3300005341 Bacteria 1017
8 Ga0070687_100511846 3300005343 Unclassified 810
9 Ga0070687_100690089 3300005343 Unclassified 712
10 Ga0070687_100937048 3300005343 Unclassified 623
11 Ga0070692_10490403 3300005345 Unclassified 794
12 Ga0070669_100423285 3300005353 Bacteria 1093
13 Ga0070674_101653479 3300005356 Unclassified 578
14 Ga0070674_101871758 3300005356 Unclassified 545
15 Ga0070701_10344844 3300005438 Unclassified 929
16 Ga0070705_100064959 3300005440 Bacteria 2183
17 Ga0070705_101870595 3300005440 Unclassified 510
18 Ga0070700_100565175 3300005441 Bacteria 886
19 Ga0070700_101494397 3300005441 Unclassified 574
20 Ga0070694_100223317 3300005444 Bacteria 1414
21 Ga0070694_100247095 3300005444 Bacteria 1348
22 Ga0070708_100060685 3300005445 Bacteria 3376
23 Ga0070708_100077234 3300005445 Unclassified 3009
24 Ga0070708_100705089 3300005445 Unclassified 950
25 Ga0070662_100034185 3300005457 Bacteria 3584
26 Ga0070662_101018527 3300005457 Bacteria 709
27 Ga0070681_10639128 3300005458 Bacteria 979
28 Ga0068867_100349535 3300005459 Bacteria 1233
29 Ga0070706_100000176 3300005467 Bacteria 81107
30 Ga0070706_100016548 3300005467 Bacteria 6811
31 Ga0070706_101121598 3300005467 Bacteria 724
32 Ga0070706_101127389 3300005467 Bacteria 722
33 Ga0070707_100001211 3300005468 Bacteria 25388
34 Ga0070707_100001560 3300005468 Bacteria 22257
35 Ga0070707_100478329 3300005468 Bacteria 1207
36 Ga0070707_100672836 3300005468 Bacteria 998
37 Ga0070707_100837563 3300005468 Unclassified 884
38 Ga0070698_100068240 3300005471 Bacteria 3574
39 Ga0070698_100114139 3300005471 Bacteria 2666
40 Ga0070698_100385088 3300005471 Bacteria 1335
41 Ga0070698_100418904 3300005471 Bacteria 1273
42 Ga0070698_101523478 3300005471 Bacteria 620
43 Ga0070699_100013723 3300005518 Bacteria 6972
44 Ga0070699_100137405 3300005518 Bacteria 2156
45 Ga0070679_100410313 3300005530 Bacteria 1300
46 Ga0070684_102243079 3300005535 Unclassified 515
47 Ga0070697_100604882 3300005536 Bacteria 964
48 Ga0070697_101343464 3300005536 Bacteria 638
49 Ga0070686_100278150 3300005544 Unclassified 1233
50 Ga0070695_100005040 3300005545 Bacteria 7784
51 Ga0070695_100773199 3300005545 Bacteria 767
52 Ga0070696_100023101 3300005546 Bacteria 4227
53 Ga0070696_100255403 3300005546 Bacteria 1327
54 Ga0070696_100466699 3300005546 Bacteria 999
55 Ga0070696_101028144 3300005546 Bacteria 690
56 Ga0070693_100194720 3300005547 Bacteria 1313
57 Ga0070704_100114075 3300005549 Bacteria 2062
58 Ga0070704_101174088 3300005549 Bacteria 699
59 Ga0070704_101747324 3300005549 Unclassified 575
60 Ga0068855_101412509 3300005563 Bacteria 717
61 Ga0068857_101622522 3300005577 Bacteria 632
62 Ga0068859_100529439 3300005617 Bacteria 1273
63 Ga0068866_11437939 3300005718 Unclassified 505
64 Ga0068858_102119665 3300005842 Unclassified 556
65 Ga0081455_10241213 3300005937 Bacteria 1328
66 Ga0075428_100214284 3300006844 Bacteria 2081
67 Ga0075428_100711228 3300006844 Bacteria 1070
68 Ga0075428_101913926 3300006844 Unclassified 616
69 Ga0075430_100001099 3300006846 Bacteria 21488
70 Ga0075431_100029383 3300006847 Bacteria 5658
71 Ga0075433_10315174 3300006852 Bacteria 1384
72 Ga0075433_10399475 3300006852 Bacteria 1213
73 Ga0075433_10517137 3300006852 Bacteria 1050
74 Ga0075434_100059876 3300006871 Bacteria 3786
75 Ga0075434_100898854 3300006871 Bacteria 900
76 Ga0075429_100001938 3300006880 Bacteria 17169
77 Ga0075429_101167394 3300006880 Unclassified 672
78 Ga0075436_100523301 3300006914 Bacteria 869
79 Ga0097620_100529467 3300006931 Bacteria 1273
80 Ga0075435_100022409 3300007076 Bacteria 4874
81 Ga0111539_10510667 3300009094 Bacteria 1400
82 Ga0111539_10645224 3300009094 Bacteria 1233
83 Ga0111539_11184038 3300009094 Bacteria 888
84 Ga0105245_10151177 3300009098 Bacteria 2196
85 Ga0105245_12583509 3300009098 Unclassified 561
86 Ga0114129_10027691 3300009147 Bacteria 8024
87 Ga0114129_10076286 3300009147 Bacteria 4667
88 Ga0114129_10275367 3300009147 Bacteria 2250
89 Ga0114129_11766325 3300009147 Unclassified 753
90 Ga0105243_10195381 3300009148 Unclassified 1771
91 Ga0105243_10747710 3300009148 Bacteria 958
92 Ga0105249_10564826 3300009553 Bacteria 1190
93 Ga0105239_11886854 3300010375 Bacteria 693
94 Ga0105246_10983344 3300011119 Unclassified 763
95 Ga0157378_10085288 3300013297 Bacteria 2861
96 Ga0157378_10615781 3300013297 Bacteria 1098
97 Ga0157378_11419976 3300013297 Bacteria 737
98 Ga0163163_10236658 3300014325 Bacteria 1875
99 Ga0157380_10171082 3300014326 Bacteria 1898
100 Ga0157380_10441351 3300014326 Unclassified 1247
101 Ga0157380_10485288 3300014326 Bacteria 1196
102 Ga0207688_10114564 3300025901 Bacteria 1568
103 Ga0207688_10501007 3300025901 Bacteria 760
104 Ga0207645_10227787 3300025907 Bacteria 1230
105 Ga0207684_10000494 3300025910 Bacteria 50002
106 Ga0207684_10073584 3300025910 Bacteria 2902
107 Ga0207654_11188629 3300025911 Bacteria 556
108 Ga0207707_10413128 3300025912 Bacteria 1158
109 Ga0207660_10000001 3300025917 Bacteria 1034169
110 Ga0207662_10636506 3300025918 Unclassified 744
111 Ga0207646_10002491 3300025922 Bacteria 21746
112 Ga0207646_10002524 3300025922 Bacteria 21605
113 Ga0207646_10321367 3300025922 Bacteria 1398
114 Ga0207646_10544636 3300025922 Unclassified 1044
115 Ga0207646_11912573 3300025922 Unclassified 505
116 Ga0207681_10268684 3300025923 Bacteria 1338
117 Ga0207687_10038271 3300025927 Bacteria 3277
118 Ga0207687_10451243 3300025927 Unclassified 1066
119 Ga0207706_10171208 3300025933 Bacteria 1908
120 Ga0207686_10677325 3300025934 Bacteria 818
121 Ga0207709_10108102 3300025935 Bacteria 1854
122 Ga0207709_10254133 3300025935 Bacteria 1285
123 Ga0207669_11156414 3300025937 Unclassified 655
124 Ga0207689_11308005 3300025942 Unclassified 609
125 Ga0207668_10859150 3300025972 Bacteria 806
126 Ga0207708_10060714 3300026075 Bacteria 2886
127 Ga0207708_10148113 3300026075 Bacteria 1846
128 Ga0207708_11483494 3300026075 Bacteria 596
129 Ga0207641_11391115 3300026088 Bacteria 703
130 Ga0207648_10489030 3300026089 Bacteria 1125
131 Ga0207648_10712800 3300026089 Unclassified 930
132 Ga0207674_10754906 3300026116 Bacteria 939
133 Ga0207675_102529282 3300026118 Unclassified 524
134 Ga0207683_10421902 3300026121 Unclassified 1229
135 Ga0209998_10057295 3300027717 Bacteria 912
136 Ga0207428_10393648 3300027907 Bacteria 1015
137 Ga0268264_11065521 3300028381 Bacteria 816
138 Ga0268264_11253506 3300028381 Bacteria 751
139 Ga0307405_10691044 3300031731 Bacteria 844
140 Ga0307409_102538687 3300031995 Unclassified 541
141 Ga0439466_0232735 3300041411 Bacteria 559
142 Ga0439465_0126993 3300041413 Unclassified 898
143 Ga0439441_002838 3300042001 Bacteria 2483
144 Ga0439443_118971 3300042003 Unclassified 517
145 Ga0450910_106762 3300042147 Unclassified 506
146 Ga0439446_0376891 3300042156 Unclassified 509
147 Ga0439435_0186372 3300042436 Unclassified 679
148 Ga0451577_1166847 3300042876 Unclassified 688
149 Ga0453683_0229530 3300044673 Bacteria 1181
150 Ga0453683_0586268 3300044673 Unclassified 727
151 Ga0495657_0776797 3300046675 Bacteria 548
152 Ga0495623_0595348 3300046679 Bacteria 575
153 Ga0496102_0145495 3300048905 Bacteria 2224
154 Ga0496103_0228627 3300048906 Bacteria 1196
155 Ga0496107_0095104 3300048910 Bacteria 2180
156 Ga0496109_0104278 3300048912 Bacteria 2633
157 Ga0496110_0434402 3300048913 Unclassified 1197
158 Ga0501031_0066367 3300049568 Bacteria 2351
159 Ga0501031_0148261 3300049568 Bacteria 1533
160 Ga0501031_0588665 3300049568 Unclassified 716
161 Ga0501033_0333316 3300049570 Bacteria 1065
162 Ga0501033_0691292 3300049570 Unclassified 695
163 Ga0501036_0083342 3300049572 Unclassified 2703
164 Ga0501036_0114995 3300049572 Bacteria 2273
165 Ga0501036_0456929 3300049572 Unclassified 1064
166 Ga0501038_0871820 3300049574 Bacteria 666
167 Ga0501038_1131763 3300049574 Unclassified 570
168 Ga0501038_1399784 3300049574 Unclassified 502
169 Ga0501039_0035505 3300049575 Bacteria 3847
170 Ga0501039_0127479 3300049575 Bacteria 1997
171 Ga0501039_1020571 3300049575 Unclassified 642
172 Ga0501040_0003092 3300049576 Bacteria 10795
173 Ga0501040_0045205 3300049576 Bacteria 3003
174 Ga0501040_0064634 3300049576 Unclassified 2519
175 Ga0501040_0143785 3300049576 Unclassified 1681
176 Ga0501041_0008241 3300049577 Bacteria 6130
177 Ga0501042_0076044 3300049578 Bacteria 2403
178 Ga0501043_0210515 3300049579 Archaea 1507
179 Ga0501043_0997325 3300049579 Bacteria 596
180 Ga0501046_0098650 3300049580 Archaea 2243
181 Ga0501046_0149091 3300049580 Bacteria 1765
182 Ga0501048_0007959 3300049582 Bacteria 8027
183 Ga0501048_0060877 3300049582 Bacteria 2674
184 Ga0501048_0074494 3300049582 Unclassified 2395
185 Ga0501068_0004069 3300049584 Bacteria 7940
186 Ga0501068_0218067 3300049584 Bacteria 1212
187 Ga0501068_0249240 3300049584 Unclassified 1132
188 Ga0501070_0193700 3300049586 Bacteria 1670
189 Ga0501070_0291682 3300049586 Unclassified 1329
190 Ga0501070_0675543 3300049586 Unclassified 818
191 Ga0501071_0004467 3300049587 Bacteria 8877
192 Ga0501071_0024893 3300049587 Bacteria 4188
193 Ga0501071_0126389 3300049587 Bacteria 1898
194 Ga0501071_0155361 3300049587 Bacteria 1708
195 Ga0501071_0805665 3300049587 Bacteria 724
196 Ga0501072_0010093 3300049588 Bacteria 7188
197 Ga0501072_0055267 3300049588 Bacteria 3129
198 Ga0501072_0288085 3300049588 Bacteria 1306
199 Ga0501072_0388553 3300049588 Bacteria 1107
200 Ga0501072_0877295 3300049588 Unclassified 701
201 Ga0501073_0049973 3300049589 Bacteria 2932
202 Ga0501073_0198908 3300049589 Bacteria 1386
203 Ga0501074_0010864 3300049590 Bacteria 6612
204 Ga0501074_0198398 3300049590 Unclassified 1430
205 Ga0501074_0324907 3300049590 Bacteria 1092
206 Ga0501074_0532727 3300049590 Bacteria 832
207 Ga0501074_0789847 3300049590 Bacteria 669
208 Ga0501075_0005018 3300049591 Bacteria 9034
209 Ga0501075_0021261 3300049591 Bacteria 4729
210 Ga0501075_0068606 3300049591 Bacteria 2679
211 Ga0501075_0142976 3300049591 Unclassified 1824
212 Ga0501075_0214519 3300049591 Bacteria 1468
213 Ga0501075_0341707 3300049591 Bacteria 1141
214 Ga0501076_0008014 3300049592 Bacteria 7716
215 Ga0501076_0179324 3300049592 Unclassified 1727
216 Ga0501076_0218699 3300049592 Unclassified 1557
217 Ga0501076_0253225 3300049592 Unclassified 1441
218 Ga0501076_0721898 3300049592 Bacteria 822
219 Ga0501076_1019767 3300049592 Unclassified 682
220 Ga0501076_1047114 3300049592 Bacteria 672
221 Ga0501076_1102038 3300049592 Bacteria 654
222 Ga0501077_0077413 3300049593 Unclassified 2107
223 Ga0501077_0225383 3300049593 Bacteria 1191
224 Ga0501077_0226254 3300049593 Bacteria 1189
225 Ga0501079_0012189 3300049741 Bacteria 6563
226 Ga0501079_0054034 3300049741 Bacteria 3098
227 Ga0501079_1137351 3300049741 Unclassified 615
228 Ga0501080_0007203 3300049742 Bacteria 10040
229 Ga0501080_0063980 3300049742 Bacteria 3423
230 Ga0501080_0588968 3300049742 Bacteria 988
231 Ga0501081_0045530 3300049743 Bacteria 3013
232 Ga0501081_0066009 3300049743 Bacteria 2516
233 Ga0501081_0074451 3300049743 Unclassified 2369
234 Ga0501081_0150542 3300049743 Bacteria 1671
235 Ga0501083_0308337 3300049744 Bacteria 1029
236 Ga0501083_0726461 3300049744 Bacteria 646
237 Ga0501035_0174413 3300049822 Unclassified 1856
238 Ga0501035_0195814 3300049822 Archaea 1736
239 Ga0501035_1277561 3300049822 Bacteria 567
240 Ga0501035_1378859 3300049822 Unclassified 541
241 Ga0501044_0563859 3300049823 Bacteria 1035
242 Ga0501045_0002390 3300049824 Bacteria 12747
243 Ga0501045_0074054 3300049824 Unclassified 2508
244 Ga0501045_0146312 3300049824 Bacteria 1758
245 Ga0501045_0276251 3300049824 Bacteria 1250
246 nmdc:mga05p37_1278376_c1 3300050507 Bacteria 750
247 nmdc:mga05p37_13886_c1 3300050507 Bacteria 9653
248 nmdc:mga05p37_167152_c1 3300050507 Bacteria 2684
249 nmdc:mga05p37_172590_c1 3300050507 Bacteria 2636
250 nmdc:mga05p37_793371_c1 3300050507 Unclassified 1037
251 nmdc:mga09592_2852_c1 3300050508 Bacteria 14018
252 nmdc:mga06r32_168163_c1 3300050510 Bacteria 2176
253 nmdc:mga08y16_149388_c1 3300050511 Bacteria 2429
254 nmdc:mga08y16_966936_c1 3300050511 Unclassified 833
255 nmdc:mga0n895_1016314_c1 3300050512 Bacteria 810
256 nmdc:mga08x19_475233_c1 3300050514 Unclassified 881
257 nmdc:mga0a205_125134_c1 3300050515 Bacteria 2470
258 nmdc:mga0a205_204080_c1 3300050515 Bacteria 1866
259 Ga0501084_0007565 3300054114 Bacteria 8956
260 Ga0501084_0052479 3300054114 Bacteria 3412
261 Ga0501084_0053591 3300054114 Bacteria 3374
262 Ga0501084_0088504 3300054114 Unclassified 2600
263 Ga0501084_0129215 3300054114 Bacteria 2126
264 Ga0501084_0492858 3300054114 Unclassified 1035
265 Ga0590075_041861 3300059424 Bacteria 1171
266 Ga0590077_018276 3300059426 Bacteria 1479
267 Ga0501082_0007300 3300060353 Bacteria 9534
268 Ga0501082_0030975 3300060353 Bacteria 4611
269 Ga0501082_0077498 3300060353 Bacteria 2866
270 Ga0501082_0078426 3300060353 Unclassified 2849
271 Ga0501082_0106028 3300060353 Unclassified 2431
272 Ga0501082_0838600 3300060353 Bacteria 804
273 Ga0530510_0045821 3300061734 Bacteria 3159
274 Ga0530510_0222961 3300061734 Bacteria 1401
275 Ga0530510_0370437 3300061734 Bacteria 1077
276 Ga0501041_0148074
277 Ga0058863_11864677
278 Ga0070676_11374925
279 Ga0068869_100144989
280 Ga0068869_101755853
281 Ga0070680_100000008
282 Ga0070691_10214547
283 Ga0070687_100511846
284 Ga0070687_100690089
285 Ga0070687_100937048
286 Ga0070692_10490403
287 Ga0070669_100423285
288 Ga0070674_101653479
289 Ga0070674_101871758
290 Ga0070701_10344844
291 Ga0070705_100064959
292 Ga0070705_101870595
293 Ga0070700_100565175
294 Ga0070700_101494397
295 Ga0070694_100223317
296 Ga0070694_100247095
297 Ga0070708_100060685
298 Ga0070708_100077234
299 Ga0070708_100705089
300 Ga0070662_100034185
301 Ga0070662_101018527
302 Ga0070681_10639128
303 Ga0068867_100349535
304 Ga0070706_100000176
305 Ga0070706_100016548
306 Ga0070706_101121598
307 Ga0070706_101127389
308 Ga0070707_100001211
309 Ga0070707_100001560
310 Ga0070707_100478329
311 Ga0070707_100672836
312 Ga0070707_100837563
313 Ga0070698_100068240
314 Ga0070698_100114139
315 Ga0070698_100385088
316 Ga0070698_100418904
317 Ga0070698_101523478
318 Ga0070699_100013723
319 Ga0070699_100137405
320 Ga0070679_100410313
321 Ga0070684_102243079
322 Ga0070697_100604882
323 Ga0070697_101343464
324 Ga0070686_100278150
325 Ga0070695_100005040
326 Ga0070695_100773199
327 Ga0070696_100023101
328 Ga0070696_100255403
329 Ga0070696_100466699
330 Ga0070696_101028144
331 Ga0070693_100194720
332 Ga0070704_100114075
333 Ga0070704_101174088
334 Ga0070704_101747324
335 Ga0068855_101412509
336 Ga0068857_101622522
337 Ga0068859_100529439
338 Ga0068866_11437939
339 Ga0068858_102119665
340 Ga0081455_10241213
341 Ga0075428_100214284
342 Ga0075428_100711228
343 Ga0075428_101913926
344 Ga0075430_100001099
345 Ga0075431_100029383
346 Ga0075433_10315174
347 Ga0075433_10399475
348 Ga0075433_10517137
349 Ga0075434_100059876
350 Ga0075434_100898854
351 Ga0075429_100001938
352 Ga0075429_101167394
353 Ga0075436_100523301
354 Ga0097620_100529467
355 Ga0075435_100022409
356 Ga0111539_10510667
357 Ga0111539_10645224
358 Ga0111539_11184038
359 Ga0105245_10151177
360 Ga0105245_12583509
361 Ga0114129_10027691
362 Ga0114129_10076286
363 Ga0114129_10275367
364 Ga0114129_11766325
365 Ga0105243_10195381
366 Ga0105243_10747710
367 Ga0105249_10564826
368 Ga0105239_11886854
369 Ga0105246_10983344
370 Ga0157378_10085288
371 Ga0157378_10615781
372 Ga0157378_11419976
373 Ga0163163_10236658
374 Ga0157380_10171082
375 Ga0157380_10441351
376 Ga0157380_10485288
377 Ga0207688_10114564
378 Ga0207688_10501007
379 Ga0207645_10227787
380 Ga0207684_10000494
381 Ga0207684_10073584
382 Ga0207654_11188629
383 Ga0207707_10413128
384 Ga0207660_10000001
385 Ga0207662_10636506
386 Ga0207646_10002491
387 Ga0207646_10002524
388 Ga0207646_10321367
389 Ga0207646_10544636
390 Ga0207646_11912573
391 Ga0207681_10268684
392 Ga0207687_10038271
393 Ga0207687_10451243
394 Ga0207706_10171208
395 Ga0207686_10677325
396 Ga0207709_10108102
397 Ga0207709_10254133
398 Ga0207669_11156414
399 Ga0207689_11308005
400 Ga0207668_10859150
401 Ga0207708_10060714
402 Ga0207708_10148113
403 Ga0207708_11483494
404 Ga0207641_11391115
405 Ga0207648_10489030
406 Ga0207648_10712800
407 Ga0207674_10754906
408 Ga0207675_102529282
409 Ga0207683_10421902
410 Ga0209998_10057295
411 Ga0207428_10393648
412 Ga0268264_11065521
413 Ga0268264_11253506
414 Ga0307405_10691044
415 Ga0307409_102538687
416 Ga0439466_0232735
417 Ga0439465_0126993
418 Ga0439441_002838
419 Ga0439443_118971
420 Ga0450910_106762
421 Ga0439446_0376891
422 Ga0439435_0186372
423 Ga0451577_1166847
424 Ga0453683_0229530
425 Ga0453683_0586268
426 Ga0495657_0776797
427 Ga0495623_0595348
428 Ga0496102_0145495
429 Ga0496103_0228627
430 Ga0496107_0095104
431 Ga0496109_0104278
432 Ga0496110_0434402
433 Ga0501031_0066367
434 Ga0501031_0148261
435 Ga0501031_0588665
436 Ga0501033_0333316
437 Ga0501033_0691292
438 Ga0501036_0083342
439 Ga0501036_0114995
440 Ga0501036_0456929
441 Ga0501038_0871820
442 Ga0501038_1131763
443 Ga0501038_1399784
444 Ga0501039_0035505
445 Ga0501039_0127479
446 Ga0501039_1020571
447 Ga0501040_0003092
448 Ga0501040_0045205
449 Ga0501040_0064634
450 Ga0501040_0143785
451 Ga0501041_0008241
452 Ga0501042_0076044
453 Ga0501043_0210515
454 Ga0501043_0997325
455 Ga0501046_0098650
456 Ga0501046_0149091
457 Ga0501048_0007959
458 Ga0501048_0060877
459 Ga0501048_0074494
460 Ga0501068_0004069
461 Ga0501068_0218067
462 Ga0501068_0249240
463 Ga0501070_0193700
464 Ga0501070_0291682
465 Ga0501070_0675543
466 Ga0501071_0004467
467 Ga0501071_0024893
468 Ga0501071_0126389
469 Ga0501071_0155361
470 Ga0501071_0805665
471 Ga0501072_0010093
472 Ga0501072_0055267
473 Ga0501072_0288085
474 Ga0501072_0388553
475 Ga0501072_0877295
476 Ga0501073_0049973
477 Ga0501073_0198908
478 Ga0501074_0010864
479 Ga0501074_0198398
480 Ga0501074_0324907
481 Ga0501074_0532727
482 Ga0501074_0789847
483 Ga0501075_0005018
484 Ga0501075_0021261
485 Ga0501075_0068606
486 Ga0501075_0142976
487 Ga0501075_0214519
488 Ga0501075_0341707
489 Ga0501076_0008014
490 Ga0501076_0179324
491 Ga0501076_0218699
492 Ga0501076_0253225
493 Ga0501076_0721898
494 Ga0501076_1019767
495 Ga0501076_1047114
496 Ga0501076_1102038
497 Ga0501077_0077413
498 Ga0501077_0225383
499 Ga0501077_0226254
500 Ga0501079_0012189
501 Ga0501079_0054034
502 Ga0501079_1137351
503 Ga0501080_0007203
504 Ga0501080_0063980
505 Ga0501080_0588968
506 Ga0501081_0045530
507 Ga0501081_0066009
508 Ga0501081_0074451
509 Ga0501081_0150542
510 Ga0501083_0308337
511 Ga0501083_0726461
512 Ga0501035_0174413
513 Ga0501035_0195814
514 Ga0501035_1277561
515 Ga0501035_1378859
516 Ga0501044_0563859
517 Ga0501045_0002390
518 Ga0501045_0074054
519 Ga0501045_0146312
520 Ga0501045_0276251
521 nmdc:mga05p37_1278376_c1
522 nmdc:mga05p37_13886_c1
523 nmdc:mga05p37_167152_c1
524 nmdc:mga05p37_172590_c1
525 nmdc:mga05p37_793371_c1
526 nmdc:mga09592_2852_c1
527 nmdc:mga06r32_168163_c1
528 nmdc:mga08y16_149388_c1
529 nmdc:mga08y16_966936_c1
530 nmdc:mga0n895_1016314_c1
531 nmdc:mga08x19_475233_c1
532 nmdc:mga0a205_125134_c1
533 nmdc:mga0a205_204080_c1
534 Ga0501084_0007565
535 Ga0501084_0052479
536 Ga0501084_0053591
537 Ga0501084_0088504
538 Ga0501084_0129215
539 Ga0501084_0492858
540 Ga0590075_041861
541 Ga0590077_018276
542 Ga0501082_0007300
543 Ga0501082_0030975
544 Ga0501082_0077498
545 Ga0501082_0078426
546 Ga0501082_0106028
547 Ga0501082_0838600
548 Ga0530510_0045821
549 Ga0530510_0222961
550 Ga0530510_0370437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

17

126

0.86

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

125

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.8204 1 116
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.7758 4 114
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.7664 3 114
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.761 1 116
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7548 2 114
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9256 63 112 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8712 63 114 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.864 63 113 3.30.720.110
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8418 65 115 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8412 63 112 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1Z4IIY0-F1-model_v4 VOC domain-containing protein 0.9412 65 115 GO:0004493
GO:0046491
GO:0046872
AF-A0A7W3W7R9-F1-model_v4 deleted 0.9338 63 114
AF-J2APJ2-F1-model_v4 VOC domain-containing protein 0.9262 65 114
AF-A0A1W1D985-F1-model_v4 Lactoylglutathione lyase (EC 4.4.1.5) 0.9168 63 115 GO:0004462
GO:0005737
GO:0019243
AF-A0A3D0ZSW0-F1-model_v4 VOC domain-containing protein 0.913 63 114

Map