F380683

General Info

Members Datasets Scaffolds Average Seq Length
275 216 550 161

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0029322|Ga0496116_0029322_2202_2753
Length 183
Sequence VYGAFEDMAYAAETLLFNKYRDRNGRVDMGFTHFNEQGRARMVDVSDKEVTTRQATAESMVRMAPDTLKQIKAGTIGKGDVLAVAQVAGIMAAKRTSDWIPMCHPLSLTGINIEFSDNDNDELYIEGTVKTTGKTGVEMEALTAVSAAALTVYDMCKALQKDMEIGPTRLTAKSGGKNGDYKR

Samples

Sample ID Description Type Environment
1 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
18 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
21 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
30 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
54 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
76 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
83 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
84 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
85 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
86 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
87 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
88 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
89 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
90 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
93 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
110 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
116 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
128 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
129 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
133 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
135 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
136 2554235283 Bacillus safensis VK Isolate Rhizosphere
137 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
138 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
139 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
140 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
141 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
142 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
143 2643221731 Bacillus sp. Root147 Isolate Unclassified
144 2643221732 Bacillus sp. Root239 Isolate Unclassified
145 2643221735 Bacillus sp. Root920 Isolate Unclassified
146 2671180694 Paenibacillus sp. A3 Isolate Unclassified
147 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
148 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
149 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
150 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
151 2738543006 Bacillus sp. OK077 Isolate Unclassified
152 2738543010 Bacillus sp. YR335 Isolate Unclassified
153 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
154 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
155 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
156 2811994870 Bacillus sp. JB4 Isolate Unclassified
157 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
158 2818991459 Paenibacillus sp. 597 Isolate Unclassified
159 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
160 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
161 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
162 2842882022 Bacillus sp. R-71893 Isolate Unclassified
163 2860837431 Bacillus sp. WR11 Isolate Unclassified
164 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
165 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
166 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
167 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
168 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
169 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
170 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
171 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
172 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
173 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
174 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
175 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
176 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
177 2919720352 Priestia megaterium 4340 Isolate Unclassified
178 2919726948 Bacillus pumilus 4489 Isolate Unclassified
179 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
180 2929004312 Priestia megaterium 1104 Isolate Unclassified
181 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
182 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
183 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
184 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
185 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
186 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
187 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
188 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
189 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
190 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
191 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
192 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
193 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
194 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
195 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
196 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
197 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
198 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
199 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
200 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
201 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
202 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
203 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
204 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
205 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
206 8022653035 Bacillus sp. Rc4 Isolate Unclassified
207 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
208 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
209 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
210 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
211 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
212 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
213 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
214 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
215 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
216 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 64.73
Metatranscriptomes 5.45
Isolates 29.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.55
Nodule 2.55
Rhizoplane 4.73
Rhizosphere 63.64
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496116_0029322 3300048919 Bacteria 3969
2 JGI25159J45721_1001297 3300002987 Bacteria 10556
3 JGI25151J46595_10000236 3300003187 Bacteria 65544
4 JGI25151J46595_10001304 3300003187 Bacteria 17469
5 JGI25151J46595_10001336 3300003187 Bacteria 17186
6 JGI25151J46595_10017239 3300003187 Bacteria 3137
7 JGI25151J46595_10017262 3300003187 Bacteria 3135
8 rootH2_10048591 3300003320 Bacteria 3691
9 rootH2_10208993 3300003320 Bacteria 1758
10 rootL2_10170377 3300003322 Bacteria 3336
11 rootH1_10012992 3300003323 Bacteria 4230
12 rootH1_10047699 3300003323 Bacteria 9127
13 Ga0006562J51391_1000523 3300003578 Bacteria 9870
14 Ga0006562J51391_1000524 3300003578 Bacteria 3130
15 Ga0006562J51391_1013458 3300003578 Bacteria 1417
16 Ga0070670_100761329 3300005331 Bacteria 873
17 Ga0070671_100109360 3300005355 Bacteria 2321
18 Ga0070713_100809577 3300005436 Bacteria 898
19 Ga0070681_10816095 3300005458 Bacteria 850
20 Ga0070681_11491276 3300005458 Bacteria 601
21 Ga0068867_100071365 3300005459 Bacteria 2597
22 Ga0070684_101016670 3300005535 Bacteria 778
23 Ga0070693_100807401 3300005547 Bacteria 696
24 Ga0070715_10068707 3300006163 Bacteria 1576
25 Ga0070712_100062564 3300006175 Bacteria 2632
26 Ga0070712_100337221 3300006175 Bacteria 1230
27 Ga0068865_100710397 3300006881 Bacteria 860
28 Ga0079104_1000517 3300006946 Bacteria 41298
29 Ga0079104_1004810 3300006946 Bacteria 5623
30 Ga0079104_1018235 3300006946 Bacteria 1994
31 Ga0105251_10117485 3300009011 Bacteria 1209
32 Ga0105244_10034683 3300009036 Bacteria 2655
33 Ga0105244_10050460 3300009036 Bacteria 2122
34 Ga0105250_10089905 3300009092 Bacteria 1248
35 Ga0105245_10770647 3300009098 Bacteria 999
36 Ga0105247_10265934 3300009101 Bacteria 1178
37 Ga0105243_10041663 3300009148 Bacteria 3591
38 Ga0105242_10028086 3300009176 Bacteria 4475
39 Ga0157370_10041845 3300013104 Bacteria 4417
40 Ga0157374_10240317 3300013296 Bacteria 1781
41 Ga0157374_10755823 3300013296 Bacteria 987
42 Ga0157378_10202193 3300013297 Bacteria 1879
43 Ga0183365_10001 3300015684 Bacteria 2090444
44 Ga0197907_11048334 3300020069 Bacteria 1042
45 Ga0224712_10108077 3300022467 Bacteria 1189
46 Ga0209784_101380 3300025224 Bacteria 3338
47 Ga0209147_100261 3300025229 Bacteria 49049
48 Ga0209147_112092 3300025229 Bacteria 937
49 Ga0209673_1003298 3300025273 Bacteria 9689
50 Ga0209130_1000504 3300025284 Bacteria 39736
51 Ga0209025_1000067 3300025294 Bacteria 295690
52 Ga0209025_1002129 3300025294 Bacteria 22283
53 Ga0209025_1006888 3300025294 Bacteria 8666
54 Ga0209025_1007171 3300025294 Bacteria 8415
55 Ga0209025_1007917 3300025294 Bacteria 7782
56 Ga0207696_1002608 3300025711 Bacteria 8743
57 Ga0207655_1010525 3300025728 Bacteria 5600
58 Ga0207655_1032726 3300025728 Bacteria 2371
59 Ga0207713_1004529 3300025735 Bacteria 8998
60 Ga0207680_10025601 3300025903 Bacteria 3256
61 Ga0207685_10194515 3300025905 Bacteria 949
62 Ga0207645_10911295 3300025907 Bacteria 597
63 Ga0207693_10074424 3300025915 Bacteria 2660
64 Ga0207660_10713047 3300025917 Bacteria 818
65 Ga0207644_10951133 3300025931 Bacteria 720
66 Ga0207686_10030195 3300025934 Bacteria 3206
67 Ga0207669_10179481 3300025937 Bacteria 1516
68 Ga0207669_10231911 3300025937 Bacteria 1362
69 Ga0207704_10960225 3300025938 Bacteria 721
70 Ga0207658_10237211 3300025986 Bacteria 1543
71 Ga0207677_11612236 3300026023 Bacteria 601
72 Ga0207648_10029307 3300026089 Bacteria 4881
73 Ga0207676_10805513 3300026095 Bacteria 917
74 Ga0209281_1000280 3300027111 Bacteria 96704
75 Ga0209281_1000323 3300027111 Bacteria 84095
76 Ga0209281_1009471 3300027111 Bacteria 2287
77 Ga0209973_1019790 3300027252 Bacteria 884
78 Ga0210000_1022751 3300027462 Bacteria 963
79 Ga0209999_1039074 3300027543 Bacteria 888
80 Ga0307408_100009294 3300031548 Bacteria 6481
81 Ga0307408_100096918 3300031548 Bacteria 2239
82 Ga0307405_10022396 3300031731 Unclassified 3572
83 Ga0307405_10200994 3300031731 Bacteria 1447
84 Ga0307405_10559386 3300031731 Bacteria 927
85 Ga0307413_10000431 3300031824 Bacteria 13601
86 Ga0307410_10000444 3300031852 Bacteria 16606
87 Ga0307406_10001129 3300031901 Bacteria 14919
88 Ga0307406_10420952 3300031901 Bacteria 1064
89 Ga0307407_10000292 3300031903 Bacteria 14791
90 Ga0307412_10095482 3300031911 Unclassified 2090
91 Ga0307409_100000263 3300031995 Bacteria 21269
92 Ga0307409_100001182 3300031995 Bacteria 12492
93 Ga0307409_100154563 3300031995 Bacteria 1997
94 Ga0307409_100267413 3300031995 Bacteria 1573
95 Ga0307416_100000999 3300032002 Bacteria 14988
96 Ga0307416_100001316 3300032002 Bacteria 13373
97 Ga0307414_10000594 3300032004 Bacteria 18638
98 Ga0307414_10051600 3300032004 Bacteria 2856
99 Ga0307411_10002918 3300032005 Bacteria 7748
100 Ga0307411_10044951 3300032005 Bacteria 2837
101 Ga0307411_10093203 3300032005 Bacteria 2108
102 Ga0307415_100005546 3300032126 Bacteria 6714
103 Ga0307415_100011592 3300032126 Bacteria 5053
104 Ga0307415_100266719 3300032126 Bacteria 1400
105 Ga0373951_0166310 3300035091 Bacteria 627
106 Ga0395899_0008676 3300037312 Bacteria 7824
107 Ga0395899_0020735 3300037312 Bacteria 4984
108 Ga0395899_0028386 3300037312 Bacteria 4214
109 Ga0395899_0038872 3300037312 Bacteria 3563
110 Ga0395900_0020412 3300037418 Bacteria 6764
111 Ga0395900_0041106 3300037418 Bacteria 4767
112 Ga0395900_0070011 3300037418 Bacteria 3606
113 Ga0395898_0008606 3300037466 Bacteria 10769
114 Ga0395898_0083099 3300037466 Bacteria 3086
115 Ga0395898_1193120 3300037466 Bacteria 692
116 Ga0395905_0019204 3300037471 Bacteria 6481
117 Ga0395905_0055854 3300037471 Bacteria 3695
118 Ga0395905_1090803 3300037471 Bacteria 701
119 Ga0395901_0031520 3300038443 Bacteria 5467
120 Ga0395901_0055174 3300038443 Bacteria 4131
121 Ga0395901_0056099 3300038443 Bacteria 4098
122 Ga0395901_0088862 3300038443 Bacteria 3232
123 Ga0439458_0000449 3300042157 Bacteria 10415
124 Ga0466969_0045336 3300044656 Bacteria 2183
125 Ga0466961_0159099 3300044693 Bacteria 1408
126 Ga0466968_0009447 3300044735 Bacteria 3750
127 Ga0466959_0004656 3300045049 Bacteria 9231
128 Ga0495603_0049348 3300046455 Bacteria 2505
129 Ga0495603_0078879 3300046455 Bacteria 1930
130 Ga0495650_0048443 3300046471 Bacteria 1771
131 Ga0495585_0166676 3300046492 Bacteria 1140
132 Ga0495620_0095063 3300046515 Bacteria 1192
133 Ga0495631_0114634 3300046518 Bacteria 1159
134 Ga0495654_0075440 3300046530 Bacteria 1591
135 Ga0495598_0098268 3300046537 Bacteria 965
136 Ga0495661_0194524 3300046665 Bacteria 1066
137 Ga0495647_0191741 3300046681 Bacteria 893
138 Ga0495660_0012978 3300046810 Bacteria 4829
139 Ga0495660_0062557 3300046810 Bacteria 1995
140 Ga0495672_0002873 3300047320 Bacteria 15277
141 Ga0495676_0070254 3300047321 Bacteria 2698
142 Ga0495683_0158232 3300047323 Bacteria 1049
143 Ga0495686_0192776 3300047472 Bacteria 1174
144 Ga0496100_0023488 3300048903 Bacteria 3746
145 Ga0496101_0106486 3300048904 Bacteria 2105
146 Ga0496102_0065981 3300048905 Bacteria 3317
147 Ga0496103_0012597 3300048906 Bacteria 5015
148 Ga0496104_0089676 3300048907 Bacteria 2937
149 Ga0496105_0004789 3300048908 Bacteria 10217
150 Ga0496107_0009001 3300048910 Bacteria 6920
151 Ga0496108_0044621 3300048911 Bacteria 3700
152 Ga0496109_0030778 3300048912 Bacteria 4810
153 Ga0496111_0001501 3300048914 Bacteria 13368
154 Ga0496112_0117110 3300048915 Bacteria 2634
155 Ga0496115_0943697 3300048918 Bacteria 663
156 Ga0496116_0012437 3300048919 Bacteria 6957
157 Ga0496116_0113837 3300048919 Bacteria 1582
158 Ga0496116_0255834 3300048919 Bacteria 868
159 Ga0496118_0353089 3300048921 Bacteria 783
160 Ga0496120_0078861 3300048923 Bacteria 1789
161 Ga0496120_0460965 3300048923 Bacteria 552
162 Ga0496121_0257158 3300048924 Bacteria 1208
163 Ga0496122_0020466 3300048925 Bacteria 5976
164 Ga0496122_0076767 3300048925 Bacteria 2349
165 Ga0496123_0003220 3300048926 Bacteria 18581
166 Ga0496124_0001311 3300048927 Bacteria 37570
167 Ga0496124_0206391 3300048927 Bacteria 1490
168 Ga0496125_0002116 3300048928 Bacteria 26683
169 Ga0496125_0061874 3300048928 Bacteria 2999
170 Ga0496125_0559461 3300048928 Bacteria 632
171 Ga0501343_004575 3300049132 Bacteria 1042
172 Ga0501305_016591 3300049161 Bacteria 1052
173 Ga0501300_018769 3300049523 Bacteria 1011
174 Ga0501311_008076 3300049527 Bacteria 1225
175 Ga0501312_012248 3300049528 Bacteria 1177
176 Ga0501313_026713 3300049529 Bacteria 735
177 Ga0501315_007593 3300049531 Bacteria 1239
178 Ga0501317_007450 3300049533 Bacteria 1235
179 Ga0501318_016960 3300049534 Bacteria 885
180 Ga0501321_012977 3300049537 Bacteria 951
181 Ga0501335_003922 3300049551 Bacteria 1281
182 Ga0501034_0003784 3300049571 Bacteria 17076
183 Ga0501047_0652004 3300049581 Bacteria 872
184 Ga0501067_0116114 3300049583 Bacteria 1489
185 Ga0501211_049252 3300049658 Unclassified 519
186 Ga0501221_072160 3300049704 Bacteria 817
187 Ga0501221_100255 3300049704 Bacteria 718
188 Ga0501234_040879 3300049707 Bacteria 759
189 nmdc:mga0qj67_128191_c1 3300050509 Bacteria 2053
190 nmdc:mga06r32_997638_c1 3300050510 Bacteria 790
191 Ga0500635_0000401 3300053080 Bacteria 13157
192 Ga0500608_000090 3300053122 Bacteria 37277
193 Ga0530510_0665251 3300061734 Bacteria 793
194 2540605701 2540341094 Bacteria 4061186
195 2555469469 2554235283 Bacteria 3683090
196 2563928033 2563366752 Bacteria 4961801
197 2573036511 2571042588 Bacteria 5045676
198 2578335554 2576861424 Bacteria 5270569
199 2580933257 2579778775 Bacteria 5360914
200 2601639820 2600255286 Bacteria 5390125
201 2621273778 2619619294 Bacteria 5575484
202 2644716517 2643221731 Bacteria 5623886
203 2644723615 2643221732 Bacteria 5756404
204 2644740950 2643221735 Bacteria 3676263
205 2673819509 2671180694 Bacteria 7506943
206 2686995822 2684623153 Bacteria 3878815
207 2687497043 2687453109 Bacteria 3860091
208 2705993603 2703719227 Bacteria 5631989
209 2730138742 2728369359 Bacteria 5621728
210 2739211137 2738543006 Bacteria 5904091
211 2739234165 2738543010 Bacteria 5583595
212 2793185943 2791355222 Bacteria 5898266
213 2802438908 2802428803 Bacteria 5806948
214 2809056652 2808606399 Bacteria 4021018
215 2812314940 2811994870 Bacteria 3776934
216 2817478718 2816332295 Bacteria 4352468
217 2819671328 2818991459 Bacteria 8736032
218 2819709990 2818991465 Bacteria 5388835
219 2819725624 2818991468 Bacteria 3723169
220 2823526910 2823526263 Bacteria 3765752
221 2842883727 2842882022 Bacteria 6158489
222 2860838096 2860837431 Bacteria 4202080
223 2864999879 2864997549 Bacteria 5139696
224 2865008633 2865002811 Bacteria 6333767
225 2881638253 2881636855 Bacteria 5205297
226 2889053521 2889049205 Bacteria 7524325
227 2889278727 2889276214 Bacteria 5979355
228 2889299724 2889295896 Bacteria 4704906
229 2904525244 2904524088 Bacteria 5887454
230 2904598668 2904595352 Bacteria 6124848
231 2907204839 2907202186 Bacteria 6632024
232 2908668978 2908665501 Bacteria 3678115
233 2919096727 2919093281 Bacteria 3660974
234 2919146168 2919143609 Bacteria 6219228
235 2919518090 2919517244 Bacteria 5858162
236 2919722450 2919720352 Bacteria 5986006
237 2919730591 2919726948 Bacteria 3696050
238 2928096990 2928093941 Bacteria 5965005
239 2929005609 2929004312 Bacteria 5678476
240 2938654405 2938649242 Bacteria 7118381
241 2954775605 2954773129 Bacteria 3741715
242 2956900959 2956897341 Bacteria 5447711
243 2960320077 2960319331 Bacteria 5502575
244 2960381805 2960375949 Bacteria 5361395
245 2962291435 2962290636 Bacteria 4072939
246 2968563013 2968558590 Bacteria 6956864
247 2969137517 2969136845 Bacteria 3923176
248 2969769528 2969765954 Bacteria 4216713
249 2969774064 2969770375 Bacteria 4271280
250 2971403904 2971403814 Bacteria 7370929
251 2971412396 2971410472 Bacteria 8311090
252 2971513167 2971511577 Bacteria 5404012
253 2980178629 2980176882 Bacteria 5397533
254 2980493271 2980492589 Bacteria 4072961
255 2981287195 2981284811 Bacteria 4641497
256 2981292143 2981289755 Bacteria 4641509
257 2981982825 2981980479 Bacteria 4641628
258 2981987385 2981985349 Bacteria 4641497
259 2988230966 2988225383 Bacteria 7221625
260 2996633225 2996632988 Bacteria 6921523
261 2996709131 2996706504 Bacteria 5757485
262 3006859041 3006858327 Bacteria 4317835
263 3006879614 3006879489 Bacteria 4064221
264 648169110 648028048 Bacteria 5394884
265 8022653647 8022653035 Bacteria 4035078
266 8022895637 8022893055 Bacteria 5300455
267 8022916587 8022914991 Bacteria 5584517
268 8054282691 8054280661 Bacteria 4232245
269 8054466418 8054465665 Bacteria 7323556
270 8054801472 8054795415 Bacteria 9785225
271 8055637016 8055632911 Bacteria 5283357
272 8056533135 8056533031 Bacteria 8964429
273 8057475109 8057473075 Bacteria 5892720
274 8057632734 8057632132 Bacteria 4726859
275 8057977875 8057977335 Bacteria 5694872
276 Ga0496116_0029322
277 JGI25159J45721_1001297
278 JGI25151J46595_10000236
279 JGI25151J46595_10001304
280 JGI25151J46595_10001336
281 JGI25151J46595_10017239
282 JGI25151J46595_10017262
283 rootH2_10048591
284 rootH2_10208993
285 rootL2_10170377
286 rootH1_10012992
287 rootH1_10047699
288 Ga0006562J51391_1000523
289 Ga0006562J51391_1000524
290 Ga0006562J51391_1013458
291 Ga0070670_100761329
292 Ga0070671_100109360
293 Ga0070713_100809577
294 Ga0070681_10816095
295 Ga0070681_11491276
296 Ga0068867_100071365
297 Ga0070684_101016670
298 Ga0070693_100807401
299 Ga0070715_10068707
300 Ga0070712_100062564
301 Ga0070712_100337221
302 Ga0068865_100710397
303 Ga0079104_1000517
304 Ga0079104_1004810
305 Ga0079104_1018235
306 Ga0105251_10117485
307 Ga0105244_10034683
308 Ga0105244_10050460
309 Ga0105250_10089905
310 Ga0105245_10770647
311 Ga0105247_10265934
312 Ga0105243_10041663
313 Ga0105242_10028086
314 Ga0157370_10041845
315 Ga0157374_10240317
316 Ga0157374_10755823
317 Ga0157378_10202193
318 Ga0183365_10001
319 Ga0197907_11048334
320 Ga0224712_10108077
321 Ga0209784_101380
322 Ga0209147_100261
323 Ga0209147_112092
324 Ga0209673_1003298
325 Ga0209130_1000504
326 Ga0209025_1000067
327 Ga0209025_1002129
328 Ga0209025_1006888
329 Ga0209025_1007171
330 Ga0209025_1007917
331 Ga0207696_1002608
332 Ga0207655_1010525
333 Ga0207655_1032726
334 Ga0207713_1004529
335 Ga0207680_10025601
336 Ga0207685_10194515
337 Ga0207645_10911295
338 Ga0207693_10074424
339 Ga0207660_10713047
340 Ga0207644_10951133
341 Ga0207686_10030195
342 Ga0207669_10179481
343 Ga0207669_10231911
344 Ga0207704_10960225
345 Ga0207658_10237211
346 Ga0207677_11612236
347 Ga0207648_10029307
348 Ga0207676_10805513
349 Ga0209281_1000280
350 Ga0209281_1000323
351 Ga0209281_1009471
352 Ga0209973_1019790
353 Ga0210000_1022751
354 Ga0209999_1039074
355 Ga0307408_100009294
356 Ga0307408_100096918
357 Ga0307405_10022396
358 Ga0307405_10200994
359 Ga0307405_10559386
360 Ga0307413_10000431
361 Ga0307410_10000444
362 Ga0307406_10001129
363 Ga0307406_10420952
364 Ga0307407_10000292
365 Ga0307412_10095482
366 Ga0307409_100000263
367 Ga0307409_100001182
368 Ga0307409_100154563
369 Ga0307409_100267413
370 Ga0307416_100000999
371 Ga0307416_100001316
372 Ga0307414_10000594
373 Ga0307414_10051600
374 Ga0307411_10002918
375 Ga0307411_10044951
376 Ga0307411_10093203
377 Ga0307415_100005546
378 Ga0307415_100011592
379 Ga0307415_100266719
380 Ga0373951_0166310
381 Ga0395899_0008676
382 Ga0395899_0020735
383 Ga0395899_0028386
384 Ga0395899_0038872
385 Ga0395900_0020412
386 Ga0395900_0041106
387 Ga0395900_0070011
388 Ga0395898_0008606
389 Ga0395898_0083099
390 Ga0395898_1193120
391 Ga0395905_0019204
392 Ga0395905_0055854
393 Ga0395905_1090803
394 Ga0395901_0031520
395 Ga0395901_0055174
396 Ga0395901_0056099
397 Ga0395901_0088862
398 Ga0439458_0000449
399 Ga0466969_0045336
400 Ga0466961_0159099
401 Ga0466968_0009447
402 Ga0466959_0004656
403 Ga0495603_0049348
404 Ga0495603_0078879
405 Ga0495650_0048443
406 Ga0495585_0166676
407 Ga0495620_0095063
408 Ga0495631_0114634
409 Ga0495654_0075440
410 Ga0495598_0098268
411 Ga0495661_0194524
412 Ga0495647_0191741
413 Ga0495660_0012978
414 Ga0495660_0062557
415 Ga0495672_0002873
416 Ga0495676_0070254
417 Ga0495683_0158232
418 Ga0495686_0192776
419 Ga0496100_0023488
420 Ga0496101_0106486
421 Ga0496102_0065981
422 Ga0496103_0012597
423 Ga0496104_0089676
424 Ga0496105_0004789
425 Ga0496107_0009001
426 Ga0496108_0044621
427 Ga0496109_0030778
428 Ga0496111_0001501
429 Ga0496112_0117110
430 Ga0496115_0943697
431 Ga0496116_0012437
432 Ga0496116_0113837
433 Ga0496116_0255834
434 Ga0496118_0353089
435 Ga0496120_0078861
436 Ga0496120_0460965
437 Ga0496121_0257158
438 Ga0496122_0020466
439 Ga0496122_0076767
440 Ga0496123_0003220
441 Ga0496124_0001311
442 Ga0496124_0206391
443 Ga0496125_0002116
444 Ga0496125_0061874
445 Ga0496125_0559461
446 Ga0501343_004575
447 Ga0501305_016591
448 Ga0501300_018769
449 Ga0501311_008076
450 Ga0501312_012248
451 Ga0501313_026713
452 Ga0501315_007593
453 Ga0501317_007450
454 Ga0501318_016960
455 Ga0501321_012977
456 Ga0501335_003922
457 Ga0501034_0003784
458 Ga0501047_0652004
459 Ga0501067_0116114
460 Ga0501211_049252
461 Ga0501221_072160
462 Ga0501221_100255
463 Ga0501234_040879
464 nmdc:mga0qj67_128191_c1
465 nmdc:mga06r32_997638_c1
466 Ga0500635_0000401
467 Ga0500608_000090
468 Ga0530510_0665251
469 2540605701
470 2555469469
471 2563928033
472 2573036511
473 2578335554
474 2580933257
475 2601639820
476 2621273778
477 2644716517
478 2644723615
479 2644740950
480 2673819509
481 2686995822
482 2687497043
483 2705993603
484 2730138742
485 2739211137
486 2739234165
487 2793185943
488 2802438908
489 2809056652
490 2812314940
491 2817478718
492 2819671328
493 2819709990
494 2819725624
495 2823526910
496 2842883727
497 2860838096
498 2864999879
499 2865008633
500 2881638253
501 2889053521
502 2889278727
503 2889299724
504 2904525244
505 2904598668
506 2907204839
507 2908668978
508 2919096727
509 2919146168
510 2919518090
511 2919722450
512 2919730591
513 2928096990
514 2929005609
515 2938654405
516 2954775605
517 2956900959
518 2960320077
519 2960381805
520 2962291435
521 2968563013
522 2969137517
523 2969769528
524 2969774064
525 2971403904
526 2971412396
527 2971513167
528 2980178629
529 2980493271
530 2981287195
531 2981292143
532 2981982825
533 2981987385
534 2988230966
535 2996633225
536 2996709131
537 3006859041
538 3006879614
539 648169110
540 8022653647
541 8022895637
542 8022916587
543 8054282691
544 8054466418
545 8054801472
546 8055637016
547 8056533135
548 8057475109
549 8057632734
550 8057977875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

42

176

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyd-assembly1.cif.gz_A moac in complex with cpmp crystallized in space group p212121 0.9604 15 159
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9586 12 149
2eey-assembly1.cif.gz_A structure of gk0241 protein from geobacillus kaustophilus 0.9564 2 161
1ekr-assembly1.cif.gz_A moac protein from e. coli 0.9552 11 157
4pyd-assembly1.cif.gz_D moac in complex with cpmp crystallized in space group p212121 0.9545 6 153
ID Description Score Start End Superfamily
af_Q2FVX9_1_163_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9792 1 162 3.30.70.640
af_Q2FVX9_1_163_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9733 1 162 3.30.70.640
af_Q20624_440_595_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.968 4 160 3.30.70.640
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9582 4 160 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9552 11 157 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A2T7YXV4-F1-model_v4 deleted 0.9868 15 161
AF-A0A2P8H1Y3-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9864 15 160 GO:0006777
GO:0061799
AF-A0A178A2D0-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9841 15 159 GO:0006777
GO:0061798
GO:0061799
AF-W7ZQT7-F1-model_v4 deleted 0.9836 1 134
AF-A0A0F7HJC8-F1-model_v4 Cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) (Molybdenum cofactor biosynthesis protein C) 0.9835 1 160 GO:0006777
GO:0061799

Map