F380652

General Info

Members Datasets Scaffolds Average Seq Length
275 175 550 116

Family's Representative Sequence

Representative Sequence 3300046557|Ga0495622_0040060|Ga0495622_0040060_868_1266
Length 132
Sequence MLFPLKCREKRGEVMLAMFFWAFVIGGLICVIGQLLMDVGKLTPGHTLSLLVVVGAVLDGLGLYEPLVDFAGAGATIPITSFGNSLVHGALQEAQRHGIVGVLTGMFEVTSSGISAAIVFGFIGALIFKPKG

Samples

Sample ID Description Type Environment
1 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
21 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
22 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
38 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
41 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
49 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
50 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
51 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
52 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
53 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
54 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
55 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
56 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
57 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
58 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
59 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
60 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
61 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
62 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
63 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
64 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
65 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
66 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
67 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
68 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
69 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
70 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
71 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
72 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
73 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
74 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
75 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
76 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
77 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
78 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
79 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
80 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
81 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
82 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
84 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
85 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
86 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
87 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
88 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
89 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
90 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
91 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
92 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
93 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
94 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
95 2643221729 Bacillus sp. Root11 Isolate Unclassified
96 2643221730 Bacillus sp. Root131 Isolate Unclassified
97 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
98 2684622632 Bacillus cereus 905 Isolate Unclassified
99 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
100 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
101 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
102 2738541295 Bacillus sp. OK085 Isolate Unclassified
103 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
104 2738541358 Bacillus sp. OV752 Isolate Unclassified
105 2738543006 Bacillus sp. OK077 Isolate Unclassified
106 2738543010 Bacillus sp. YR335 Isolate Unclassified
107 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
108 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
109 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
110 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
111 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
112 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
113 2818991441 Niallia circulans 3243 Isolate Rhizosphere
114 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
115 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
116 2818991459 Paenibacillus sp. 597 Isolate Unclassified
117 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
118 2842682962 Bacillus sp. R-72492 Isolate Unclassified
119 2849139964 Bacillus sp. R-71875 Isolate Unclassified
120 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
121 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
122 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
123 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
124 2857581216 Bacillus sp. R-71922 Isolate Unclassified
125 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
126 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
127 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
128 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
129 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
130 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
131 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
132 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
133 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
134 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
135 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
136 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
137 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
138 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
139 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
140 2919720352 Priestia megaterium 4340 Isolate Unclassified
141 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
142 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
143 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
144 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
145 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
146 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
147 2938917290 Bacillus sp. CR71 Isolate Unclassified
148 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
149 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
150 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
151 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
152 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
153 2965761152 Bacillus sp. COPE52 Isolate Unclassified
154 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
155 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
156 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
157 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
158 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
159 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
160 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
161 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
162 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
163 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
164 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
165 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
166 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
167 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
168 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
169 8022792930 Bacillus sp. Xin Isolate Rhizosphere
170 8023438354 Bacillus sp. BH2 Isolate Unclassified
171 8023444577 Bacillus sp. BH32 Isolate Unclassified
172 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
173 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
174 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
175 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 65.45
Metatranscriptomes 0.36
Isolates 34.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.55
Nodule 1.09
Rhizoplane 10.91
Rhizosphere 47.64
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495622_0040060 3300046557 Bacteria 2181
2 JGI25159J45721_1008452 3300002987 Bacteria 2825
3 JGI25159J45721_1037818 3300002987 Bacteria 722
4 JGI25159J45721_1049244 3300002987 Bacteria 583
5 JGI25151J46595_10008810 3300003187 Bacteria 4822
6 JGI25151J46595_10010463 3300003187 Bacteria 4308
7 JGI25151J46595_10021535 3300003187 Bacteria 2695
8 JGI25151J46595_10022758 3300003187 Bacteria 2595
9 JGI25151J46595_10039108 3300003187 Bacteria 1756
10 JGI25151J46595_10045403 3300003187 Bacteria 1551
11 JGI25151J46595_10048919 3300003187 Bacteria 1456
12 JGI25151J46595_10060427 3300003187 Bacteria 1212
13 JGI25151J46595_10106901 3300003187 Bacteria 740
14 JGI25151J46595_10127185 3300003187 Bacteria 640
15 JGI25151J46595_10149705 3300003187 Bacteria 559
16 JGI25151J46595_10172112 3300003187 Bacteria 500
17 Ga0055538_1000599 3300003751 Bacteria 11970
18 Ga0055532_1001022 3300003758 Bacteria 8675
19 Ga0055536_1012198 3300003781 Bacteria 3208
20 Ga0055528_1011065 3300003790 Bacteria 3613
21 Ga0058692_1036087 3300003856 Bacteria 896
22 Ga0070669_100241100 3300005353 Bacteria 1436
23 Ga0070675_100793473 3300005354 Bacteria 865
24 Ga0105251_10007577 3300009011 Bacteria 6662
25 Ga0105251_10017258 3300009011 Bacteria 3875
26 Ga0105251_10608849 3300009011 Bacteria 519
27 Ga0105244_10007562 3300009036 Bacteria 6899
28 Ga0105244_10025128 3300009036 Bacteria 3242
29 Ga0105244_10055665 3300009036 Bacteria 2003
30 Ga0105244_10269282 3300009036 Bacteria 791
31 Ga0105244_10497640 3300009036 Bacteria 561
32 Ga0105250_10012385 3300009092 Bacteria 3522
33 Ga0105250_10014129 3300009092 Bacteria 3284
34 Ga0105250_10024551 3300009092 Bacteria 2429
35 Ga0105250_10030986 3300009092 Bacteria 2148
36 Ga0105250_10048686 3300009092 Bacteria 1700
37 Ga0105250_10272148 3300009092 Bacteria 727
38 Ga0105247_10403658 3300009101 Bacteria 974
39 Ga0105243_10117336 3300009148 Bacteria 2237
40 Ga0105243_10475690 3300009148 Bacteria 1178
41 Ga0105249_12696811 3300009553 Bacteria 569
42 Ga0105246_10021015 3300011119 Bacteria 4193
43 Ga0105246_10354348 3300011119 Bacteria 1204
44 Ga0157371_10002775 3300013102 Bacteria 16424
45 Ga0157371_10106655 3300013102 Bacteria 1988
46 Ga0157374_10018324 3300013296 Bacteria 6177
47 Ga0157377_10498788 3300014745 Bacteria 850
48 Ga0182007_10080005 3300015262 Bacteria 1072
49 Ga0209784_100174 3300025224 Bacteria 55266
50 Ga0209147_100042 3300025229 Bacteria 301263
51 Ga0209147_102462 3300025229 Bacteria 4580
52 Ga0209673_1003698 3300025273 Bacteria 8781
53 Ga0209130_1002811 3300025284 Bacteria 8117
54 Ga0209130_1003995 3300025284 Bacteria 5881
55 Ga0209130_1004881 3300025284 Bacteria 4881
56 Ga0209130_1030713 3300025284 Bacteria 1108
57 Ga0209675_1006419 3300025291 Bacteria 4717
58 Ga0209675_1036743 3300025291 Bacteria 1107
59 Ga0209676_1000702 3300025292 Bacteria 46826
60 Ga0209676_1017005 3300025292 Bacteria 2594
61 Ga0209676_1022307 3300025292 Bacteria 2101
62 Ga0209676_1097312 3300025292 Bacteria 634
63 Ga0209025_1002166 3300025294 Bacteria 21856
64 Ga0209025_1002508 3300025294 Bacteria 19222
65 Ga0209025_1003262 3300025294 Bacteria 15629
66 Ga0209025_1003382 3300025294 Bacteria 15222
67 Ga0209025_1004547 3300025294 Bacteria 11952
68 Ga0209025_1005859 3300025294 Bacteria 9827
69 Ga0209025_1007221 3300025294 Bacteria 8365
70 Ga0209025_1015296 3300025294 Bacteria 4638
71 Ga0209025_1016470 3300025294 Bacteria 4357
72 Ga0209025_1018265 3300025294 Bacteria 3992
73 Ga0209025_1020263 3300025294 Bacteria 3647
74 Ga0209025_1023185 3300025294 Bacteria 3255
75 Ga0209025_1035318 3300025294 Bacteria 2261
76 Ga0209025_1041877 3300025294 Bacteria 1954
77 Ga0209025_1060221 3300025294 Bacteria 1427
78 Ga0209025_1097746 3300025294 Bacteria 939
79 Ga0209025_1138375 3300025294 Bacteria 694
80 Ga0207426_1007905 3300025302 Bacteria 4382
81 Ga0207696_1001614 3300025711 Bacteria 11924
82 Ga0207696_1003615 3300025711 Bacteria 6969
83 Ga0207696_1004239 3300025711 Bacteria 6225
84 Ga0207696_1004645 3300025711 Bacteria 5878
85 Ga0207696_1021122 3300025711 Bacteria 2088
86 Ga0207696_1179743 3300025711 Bacteria 559
87 Ga0207655_1001622 3300025728 Bacteria 19983
88 Ga0207655_1005979 3300025728 Bacteria 8147
89 Ga0207655_1022363 3300025728 Bacteria 3172
90 Ga0207655_1046826 3300025728 Bacteria 1791
91 Ga0207655_1187580 3300025728 Bacteria 627
92 Ga0207713_1009237 3300025735 Bacteria 5582
93 Ga0207713_1017018 3300025735 Bacteria 3666
94 Ga0207713_1020334 3300025735 Bacteria 3219
95 Ga0207713_1124835 3300025735 Bacteria 859
96 Ga0207681_10230781 3300025923 Bacteria 1436
97 Ga0207664_11941313 3300025929 Unclassified 511
98 Ga0207709_10497016 3300025935 Bacteria 951
99 Ga0207709_10559648 3300025935 Bacteria 900
100 Ga0207712_10074809 3300025961 Bacteria 2446
101 Ga0209281_1000153 3300027111 Bacteria 166921
102 Ga0209371_1003275 3300027312 Bacteria 8027
103 Ga0265338_10551281 3300028800 Bacteria 807
104 Ga0237817_10173 3300030083 Bacteria 18383
105 Ga0237817_10637 3300030083 Bacteria 3369
106 Ga0268256_1002976 3300030500 Bacteria 8027
107 Ga0307408_100098023 3300031548 Bacteria 2227
108 Ga0307408_101167053 3300031548 Bacteria 717
109 Ga0307405_10086348 3300031731 Bacteria 2065
110 Ga0307412_10210998 3300031911 Bacteria 1482
111 Ga0307409_100138735 3300031995 Bacteria 2091
112 Ga0307409_101181298 3300031995 Bacteria 788
113 Ga0307416_100023840 3300032002 Bacteria 4452
114 Ga0307416_100598247 3300032002 Bacteria 1182
115 Ga0307416_100925477 3300032002 Bacteria 973
116 Ga0395898_0378187 3300037466 Bacteria 1351
117 Ga0395898_0941516 3300037466 Bacteria 801
118 Ga0237819_00283 3300038705 Bacteria 18642
119 Ga0237819_00395 3300038705 Bacteria 15201
120 Ga0466958_0740401 3300045836 Bacteria 641
121 Ga0466967_0020775 3300045976 Bacteria 5317
122 Ga0495627_076995 3300046453 Bacteria 970
123 Ga0495654_0013442 3300046530 Bacteria 4381
124 Ga0495654_0263833 3300046530 Bacteria 713
125 Ga0495661_0089554 3300046665 Bacteria 1754
126 Ga0495661_0107173 3300046665 Bacteria 1563
127 Ga0495589_0100143 3300046794 Bacteria 1403
128 Ga0495660_0148001 3300046810 Bacteria 1162
129 Ga0495660_0498818 3300046810 Unclassified 521
130 Ga0495672_0005532 3300047320 Bacteria 9998
131 Ga0495680_0567606 3300047322 Bacteria 763
132 Ga0495626_0189790 3300048091 Bacteria 848
133 Ga0496100_0003459 3300048903 Bacteria 8236
134 Ga0496101_0000534 3300048904 Bacteria 23347
135 Ga0496101_0532777 3300048904 Bacteria 928
136 Ga0496102_0014011 3300048905 Bacteria 6962
137 Ga0496102_0113382 3300048905 Bacteria 2529
138 Ga0496103_0410233 3300048906 Bacteria 870
139 Ga0496105_0150448 3300048908 Bacteria 1913
140 Ga0496105_0882409 3300048908 Bacteria 675
141 Ga0496106_0046974 3300048909 Bacteria 3247
142 Ga0496107_0024382 3300048910 Bacteria 4279
143 Ga0496107_1131102 3300048910 Bacteria 565
144 Ga0496108_0001737 3300048911 Bacteria 17313
145 Ga0496108_0196860 3300048911 Bacteria 1748
146 Ga0496109_0010214 3300048912 Bacteria 8015
147 Ga0496110_0000485 3300048913 Bacteria 27040
148 Ga0496110_0000586 3300048913 Bacteria 25041
149 Ga0496110_0026537 3300048913 Bacteria 4958
150 Ga0496110_0167717 3300048913 Bacteria 1991
151 Ga0496110_0392361 3300048913 Bacteria 1265
152 Ga0496110_0422797 3300048913 Bacteria 1215
153 Ga0496110_0940227 3300048913 Bacteria 771
154 Ga0496111_0002743 3300048914 Bacteria 10709
155 Ga0496111_0007220 3300048914 Bacteria 7266
156 Ga0496111_1229666 3300048914 Unclassified 530
157 Ga0496112_0000472 3300048915 Bacteria 26897
158 Ga0496112_0239678 3300048915 Bacteria 1767
159 Ga0496113_0005080 3300048916 Bacteria 8171
160 Ga0496113_0094728 3300048916 Bacteria 2307
161 Ga0496113_0246832 3300048916 Bacteria 1425
162 Ga0496115_0383383 3300048918 Bacteria 1143
163 Ga0496116_0080010 3300048919 Bacteria 2031
164 Ga0496116_0478214 3300048919 Bacteria 525
165 Ga0496117_0107721 3300048920 Bacteria 1745
166 Ga0496119_0081594 3300048922 Bacteria 1862
167 Ga0496120_0158259 3300048923 Bacteria 1132
168 Ga0496122_0008655 3300048925 Bacteria 10919
169 Ga0496123_0301966 3300048926 Bacteria 764
170 Ga0496125_0010754 3300048928 Bacteria 9218
171 Ga0496126_0180535 3300048929 Bacteria 1793
172 Ga0501290_043423 3300049513 Bacteria 680
173 Ga0501317_052001 3300049533 Bacteria 653
174 Ga0501072_0801113 3300049588 Bacteria 738
175 Ga0501076_1814554 3300049592 Bacteria 500
176 Ga0501207_090270 3300049654 Bacteria 602
177 Ga0501217_023532 3300049661 Bacteria 1468
178 Ga0501217_026553 3300049661 Bacteria 1400
179 Ga0501243_052367 3300049675 Bacteria 739
180 Ga0501221_053005 3300049704 Bacteria 919
181 Ga0501270_127112 3300049767 Bacteria 560
182 2511179426 2510917027 Bacteria 5287437
183 2511180007 2510917027 Bacteria 5287437
184 2512636123 2512564013 Bacteria 6286191
185 2512638957 2512564013 Bacteria 6286191
186 2553394384 2551306519 Bacteria 5465154
187 2587737667 2585428059 Bacteria 8696589
188 2644423240 2643221676 Bacteria 8119172
189 2644707290 2643221729 Bacteria 6621700
190 2644714247 2643221730 Bacteria 6523787
191 2672333887 2671180330 Bacteria 5521719
192 2672334764 2671180330 Bacteria 5521719
193 2685153090 2684622632 Bacteria 5380049
194 2698320099 2695420987 Bacteria 6152737
195 2705997017 2703719227 Bacteria 5631989
196 2721508245 2718218445 Bacteria 5113413
197 2738812637 2738541295 Bacteria 5730091
198 2738837382 2738541299 Bacteria 4020721
199 2739157136 2738541358 Bacteria 5932299
200 2739209114 2738543006 Bacteria 5904091
201 2739230811 2738543010 Bacteria 5583595
202 2745168000 2744054657 Bacteria 5016802
203 2777761410 2775507177 Bacteria 4384303
204 2791212040 2788500588 Bacteria 4584915
205 2808868266 2808606364 Bacteria 4465927
206 2816863616 2816332186 Bacteria 5331395
207 2817618880 2816332336 Bacteria 5207640
208 2819569947 2818991441 Bacteria 5062707
209 2819582413 2818991443 Bacteria 6598732
210 2819627994 2818991451 Bacteria 4697364
211 2819670654 2818991459 Bacteria 8736032
212 2831905747 2831905167 Bacteria 3319172
213 2842685480 2842682962 Bacteria 5589973
214 2849140520 2849139964 Bacteria 5613304
215 2852674784 2852673933 Bacteria 3347676
216 2857458521 2857453340 Bacteria 8090534
217 2857461249 2857460504 Bacteria 5194327
218 2857465339 2857460504 Bacteria 5194327
219 2857469964 2857465823 Bacteria 6772595
220 2857584664 2857581216 Bacteria 5522813
221 2857591699 2857591370 Bacteria 6569758
222 2857607782 2857604169 Bacteria 5111450
223 2857612367 2857609550 Bacteria 3753890
224 2881649918 2881644220 Bacteria 5302661
225 2888580815 2888578766 Bacteria 6743310
226 2898909453 2898907183 Bacteria 4067722
227 2904530073 2904524088 Bacteria 5887454
228 2904611405 2904606771 Bacteria 4684500
229 2904759963 2904755435 Bacteria 7986759
230 2915601031 2915597211 Bacteria 6475886
231 2915602838 2915597211 Bacteria 6475886
232 2915607281 2915606848 Bacteria 6032732
233 2915608721 2915606848 Bacteria 6032732
234 2916974401 2916971899 Bacteria 4250608
235 2919149432 2919143609 Bacteria 6219228
236 2919417532 2919414237 Bacteria 5429133
237 2919429244 2919425241 Bacteria 8055701
238 2919726372 2919720352 Bacteria 5986006
239 2928099299 2928093941 Bacteria 5965005
240 2928511475 2928510474 Bacteria 4815308
241 2929186174 2929183550 Bacteria 6377511
242 2929187891 2929183550 Bacteria 6377511
243 2929238808 2929233124 Bacteria 5948380
244 2929298561 2929297113 Bacteria 3141306
245 2936364808 2936361878 Bacteria 5632809
246 2938923028 2938917290 Bacteria 5914775
247 2939593927 2939593269 Bacteria 4798695
248 2947431893 2947426588 Bacteria 5357194
249 2956900655 2956897341 Bacteria 5447711
250 2962291988 2962290636 Bacteria 4072939
251 2962294900 2962290636 Bacteria 4072939
252 2964377098 2964375228 Bacteria 4909004
253 2965766424 2965761152 Bacteria 5806513
254 2977258666 2977254563 Bacteria 4828420
255 2979088801 2979083700 Bacteria 5894929
256 2990279696 2990275345 Bacteria 4887158
257 3001267285 3001267043 Bacteria 4823521
258 3001272814 3001272096 Bacteria 4729684
259 3001893778 3001892409 Bacteria 6328293
260 3006827631 3006826541 Bacteria 4678913
261 3006970973 3006969106 Bacteria 4739423
262 3006974362 3006973921 Bacteria 4423788
263 3006978875 3006978542 Bacteria 5328100
264 3006985812 3006984091 Bacteria 4207523
265 3006989875 3006988479 Bacteria 4767936
266 8007374414 8007371054 Bacteria 4849201
267 8007376252 8007375930 Bacteria 4080554
268 8022626598 8022621104 Bacteria 5241040
269 8022797742 8022792930 Bacteria 5693794
270 8023441233 8023438354 Bacteria 5779374
271 8023448805 8023444577 Bacteria 5661597
272 8055532679 8055531788 Bacteria 5249694
273 8056540123 8056533031 Bacteria 8964429
274 8057587539 8057582654 Bacteria 5218944
275 8057633901 8057632132 Bacteria 4726859
276 Ga0495622_0040060
277 JGI25159J45721_1008452
278 JGI25159J45721_1037818
279 JGI25159J45721_1049244
280 JGI25151J46595_10008810
281 JGI25151J46595_10010463
282 JGI25151J46595_10021535
283 JGI25151J46595_10022758
284 JGI25151J46595_10039108
285 JGI25151J46595_10045403
286 JGI25151J46595_10048919
287 JGI25151J46595_10060427
288 JGI25151J46595_10106901
289 JGI25151J46595_10127185
290 JGI25151J46595_10149705
291 JGI25151J46595_10172112
292 Ga0055538_1000599
293 Ga0055532_1001022
294 Ga0055536_1012198
295 Ga0055528_1011065
296 Ga0058692_1036087
297 Ga0070669_100241100
298 Ga0070675_100793473
299 Ga0105251_10007577
300 Ga0105251_10017258
301 Ga0105251_10608849
302 Ga0105244_10007562
303 Ga0105244_10025128
304 Ga0105244_10055665
305 Ga0105244_10269282
306 Ga0105244_10497640
307 Ga0105250_10012385
308 Ga0105250_10014129
309 Ga0105250_10024551
310 Ga0105250_10030986
311 Ga0105250_10048686
312 Ga0105250_10272148
313 Ga0105247_10403658
314 Ga0105243_10117336
315 Ga0105243_10475690
316 Ga0105249_12696811
317 Ga0105246_10021015
318 Ga0105246_10354348
319 Ga0157371_10002775
320 Ga0157371_10106655
321 Ga0157374_10018324
322 Ga0157377_10498788
323 Ga0182007_10080005
324 Ga0209784_100174
325 Ga0209147_100042
326 Ga0209147_102462
327 Ga0209673_1003698
328 Ga0209130_1002811
329 Ga0209130_1003995
330 Ga0209130_1004881
331 Ga0209130_1030713
332 Ga0209675_1006419
333 Ga0209675_1036743
334 Ga0209676_1000702
335 Ga0209676_1017005
336 Ga0209676_1022307
337 Ga0209676_1097312
338 Ga0209025_1002166
339 Ga0209025_1002508
340 Ga0209025_1003262
341 Ga0209025_1003382
342 Ga0209025_1004547
343 Ga0209025_1005859
344 Ga0209025_1007221
345 Ga0209025_1015296
346 Ga0209025_1016470
347 Ga0209025_1018265
348 Ga0209025_1020263
349 Ga0209025_1023185
350 Ga0209025_1035318
351 Ga0209025_1041877
352 Ga0209025_1060221
353 Ga0209025_1097746
354 Ga0209025_1138375
355 Ga0207426_1007905
356 Ga0207696_1001614
357 Ga0207696_1003615
358 Ga0207696_1004239
359 Ga0207696_1004645
360 Ga0207696_1021122
361 Ga0207696_1179743
362 Ga0207655_1001622
363 Ga0207655_1005979
364 Ga0207655_1022363
365 Ga0207655_1046826
366 Ga0207655_1187580
367 Ga0207713_1009237
368 Ga0207713_1017018
369 Ga0207713_1020334
370 Ga0207713_1124835
371 Ga0207681_10230781
372 Ga0207664_11941313
373 Ga0207709_10497016
374 Ga0207709_10559648
375 Ga0207712_10074809
376 Ga0209281_1000153
377 Ga0209371_1003275
378 Ga0265338_10551281
379 Ga0237817_10173
380 Ga0237817_10637
381 Ga0268256_1002976
382 Ga0307408_100098023
383 Ga0307408_101167053
384 Ga0307405_10086348
385 Ga0307412_10210998
386 Ga0307409_100138735
387 Ga0307409_101181298
388 Ga0307416_100023840
389 Ga0307416_100598247
390 Ga0307416_100925477
391 Ga0395898_0378187
392 Ga0395898_0941516
393 Ga0237819_00283
394 Ga0237819_00395
395 Ga0466958_0740401
396 Ga0466967_0020775
397 Ga0495627_076995
398 Ga0495654_0013442
399 Ga0495654_0263833
400 Ga0495661_0089554
401 Ga0495661_0107173
402 Ga0495589_0100143
403 Ga0495660_0148001
404 Ga0495660_0498818
405 Ga0495672_0005532
406 Ga0495680_0567606
407 Ga0495626_0189790
408 Ga0496100_0003459
409 Ga0496101_0000534
410 Ga0496101_0532777
411 Ga0496102_0014011
412 Ga0496102_0113382
413 Ga0496103_0410233
414 Ga0496105_0150448
415 Ga0496105_0882409
416 Ga0496106_0046974
417 Ga0496107_0024382
418 Ga0496107_1131102
419 Ga0496108_0001737
420 Ga0496108_0196860
421 Ga0496109_0010214
422 Ga0496110_0000485
423 Ga0496110_0000586
424 Ga0496110_0026537
425 Ga0496110_0167717
426 Ga0496110_0392361
427 Ga0496110_0422797
428 Ga0496110_0940227
429 Ga0496111_0002743
430 Ga0496111_0007220
431 Ga0496111_1229666
432 Ga0496112_0000472
433 Ga0496112_0239678
434 Ga0496113_0005080
435 Ga0496113_0094728
436 Ga0496113_0246832
437 Ga0496115_0383383
438 Ga0496116_0080010
439 Ga0496116_0478214
440 Ga0496117_0107721
441 Ga0496119_0081594
442 Ga0496120_0158259
443 Ga0496122_0008655
444 Ga0496123_0301966
445 Ga0496125_0010754
446 Ga0496126_0180535
447 Ga0501290_043423
448 Ga0501317_052001
449 Ga0501072_0801113
450 Ga0501076_1814554
451 Ga0501207_090270
452 Ga0501217_023532
453 Ga0501217_026553
454 Ga0501243_052367
455 Ga0501221_053005
456 Ga0501270_127112
457 2511179426
458 2511180007
459 2512636123
460 2512638957
461 2553394384
462 2587737667
463 2644423240
464 2644707290
465 2644714247
466 2672333887
467 2672334764
468 2685153090
469 2698320099
470 2705997017
471 2721508245
472 2738812637
473 2738837382
474 2739157136
475 2739209114
476 2739230811
477 2745168000
478 2777761410
479 2791212040
480 2808868266
481 2816863616
482 2817618880
483 2819569947
484 2819582413
485 2819627994
486 2819670654
487 2831905747
488 2842685480
489 2849140520
490 2852674784
491 2857458521
492 2857461249
493 2857465339
494 2857469964
495 2857584664
496 2857591699
497 2857607782
498 2857612367
499 2881649918
500 2888580815
501 2898909453
502 2904530073
503 2904611405
504 2904759963
505 2915601031
506 2915602838
507 2915607281
508 2915608721
509 2916974401
510 2919149432
511 2919417532
512 2919429244
513 2919726372
514 2928099299
515 2928511475
516 2929186174
517 2929187891
518 2929238808
519 2929298561
520 2936364808
521 2938923028
522 2939593927
523 2947431893
524 2956900655
525 2962291988
526 2962294900
527 2964377098
528 2965766424
529 2977258666
530 2979088801
531 2990279696
532 3001267285
533 3001272814
534 3001893778
535 3006827631
536 3006970973
537 3006974362
538 3006978875
539 3006985812
540 3006989875
541 8007374414
542 8007376252
543 8022626598
544 8022797742
545 8023441233
546 8023448805
547 8055532679
548 8056540123
549 8057587539
550 8057633901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03862

SpoVAC_SpoVAEB

SpoVAC/SpoVAEB sporulation membrane protein

18

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4194 1 93
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.3901 2 96
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.3784 17 113
5kc4-assembly2.cif.gz_E structure of tmribu, orthorhombic crystal form 0.374 17 113
2w0g-assembly1.cif.gz_A hsp90 co-chaperone cdc37 0.3706 18 95
ID Description Score Start End Superfamily
1h9zA02 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1; 0.491 32 113 1.10.246.10
af_P81309_1_82_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4702 20 110 1.10.287.3510
af_P81309_1_82_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4607 20 110 1.10.287.3510
af_Q55F14_99_213_1.10.8.270 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;putative rabgap domain of human tbc1 domain family member 14 like domains 0.4531 22 104 1.10.8.270
af_P9WJY3_11_221_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4287 32 113 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0F2J583-F1-model_v4 Stage V sporulation protein AE (SpoVAE) 0.9369 2 82 GO:0016020
AF-A0A353N802-F1-model_v4 Stage V sporulation protein AE 0.9267 2 80 GO:0016020
AF-A0A3C0QS27-F1-model_v4 Stage V sporulation protein AE 0.9167 1 71 GO:0016020
AF-A0A1C0A9P6-F1-model_v4 Stage V sporulation protein AE 0.9124 1 116 GO:0016020
AF-R6SBJ1-F1-model_v4 Stage V sporulation protein AE 0.9054 1 112 GO:0016020

Map