F380619

General Info

Members Datasets Scaffolds Average Seq Length
275 189 550 294

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0003919|Ga0495603_0003919_7652_8632
Length 326
Sequence VTTPSQQSGSARGGEDPVPAAPLDVRWIHGSPSAKHNTDPDIQVHAYDEHTVILRQNMAVDYEAPFMFLLFGTARAVLIDTGATASADHFPLRRVVDEVMESWLAEHPREGYGLLVLHTHPHGDHIAADGQFTGRPGTEVVAAALDTAWDFFGFHDDPDAVARVDLGGRVLECLATPGHHAAAVTFFDPWTGLLLTGDTVYPGRLYVEDWPAFTRTVDRLIEFCGRRPVTHVLGCHIEMTREPGRDYPVRTTYQPDEPSLQMTTDQLLDIRRAIGTAGPRPGRHVFDDFIICRGDTPGEDQEPRQEHPDAASPSLHTRADGPVPGR

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
72 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
78 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
83 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
175 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
177 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
178 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
179 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
180 2643221679 Angustibacter sp. Root456 Isolate Unclassified
181 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
182 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
183 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
184 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
185 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
186 2891562705 Microbispora tritici MT50 Isolate Unclassified
187 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
188 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
189 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.55
Metatranscriptomes 0.36
Isolates 5.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.36
Nodule 0
Rhizoplane 16
Rhizosphere 70.18
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0003919 3300046455 Bacteria 8867
2 rootH1_10042001 3300003316 Bacteria 1729
3 rootH2_10016047 3300003320 Bacteria 3059
4 rootL2_10078069 3300003322 Bacteria 3640
5 rootH1_10239649 3300003323 Bacteria 2116
6 Ga0065714_10004525 3300005288 Bacteria 6178
7 Ga0070676_10001857 3300005328 Bacteria 10758
8 Ga0070683_100010237 3300005329 Bacteria 8055
9 Ga0070683_100292915 3300005329 Bacteria 1548
10 Ga0070666_10180671 3300005335 Bacteria 1480
11 Ga0070682_100032999 3300005337 Bacteria 3142
12 Ga0070687_100310963 3300005343 Bacteria 1003
13 Ga0070668_100000937 3300005347 Bacteria 20317
14 Ga0070669_100026790 3300005353 Bacteria 4147
15 Ga0070675_100090577 3300005354 Bacteria 2562
16 Ga0070671_100044052 3300005355 Bacteria 3707
17 Ga0070674_100009752 3300005356 Bacteria 5769
18 Ga0070673_100021081 3300005364 Bacteria 4714
19 Ga0070667_100397628 3300005367 Bacteria 1254
20 Ga0070711_100185678 3300005439 Bacteria 1594
21 Ga0070663_100031986 3300005455 Bacteria 3621
22 Ga0070678_100139589 3300005456 Bacteria 1937
23 Ga0070672_100150278 3300005543 Bacteria 1926
24 Ga0070664_100500188 3300005564 Bacteria 1120
25 Ga0068854_100144206 3300005578 Bacteria 1830
26 Ga0068864_100148964 3300005618 Bacteria 2118
27 Ga0068870_10188010 3300005840 Bacteria 1244
28 Ga0068863_100508900 3300005841 Bacteria 1186
29 Ga0070717_10016557 3300006028 Bacteria 5718
30 Ga0075365_10030675 3300006038 Bacteria 3446
31 Ga0075363_100025981 3300006048 Bacteria 2992
32 Ga0075367_10000220 3300006178 Bacteria 19117
33 Ga0075369_10060903 3300006186 Bacteria 1647
34 Ga0075428_100024329 3300006844 Bacteria 6701
35 Ga0075428_100233078 3300006844 Bacteria 1987
36 Ga0075430_100112965 3300006846 Bacteria 2265
37 Ga0075431_100052240 3300006847 Bacteria 4214
38 Ga0075429_100066663 3300006880 Bacteria 3134
39 Ga0075429_100109426 3300006880 Bacteria 2415
40 Ga0068865_100554769 3300006881 Bacteria 965
41 Ga0105244_10015794 3300009036 Bacteria 4321
42 Ga0105245_10222850 3300009098 Bacteria 1821
43 Ga0105248_10319692 3300009177 Bacteria 1748
44 Ga0105238_10716130 3300009551 Bacteria 1013
45 Ga0105239_10178341 3300010375 Bacteria 2376
46 Ga0105246_10056403 3300011119 Bacteria 2715
47 Ga0105246_10112492 3300011119 Bacteria 2003
48 Ga0105246_10147529 3300011119 Bacteria 1777
49 Ga0157373_10026701 3300013100 Bacteria 4168
50 Ga0157371_10095873 3300013102 Bacteria 2102
51 Ga0157369_10090920 3300013105 Bacteria 3259
52 Ga0163162_10087588 3300013306 Bacteria 3192
53 Ga0163162_10256410 3300013306 Bacteria 1881
54 Ga0157372_10141624 3300013307 Bacteria 2771
55 Ga0157375_10022649 3300013308 Bacteria 5784
56 Ga0157375_10421815 3300013308 Unclassified 1500
57 Ga0157375_10811355 3300013308 Bacteria 1084
58 Ga0163163_10134029 3300014325 Bacteria 2517
59 Ga0157376_10187670 3300014969 Bacteria 1894
60 Ga0209758_1004813 3300025297 Bacteria 10897
61 Ga0209051_1002116 3300025303 Bacteria 14859
62 Ga0207697_10004037 3300025315 Bacteria 7109
63 Ga0207655_1009569 3300025728 Bacteria 6004
64 Ga0207645_10001051 3300025907 Bacteria 22851
65 Ga0207643_10046916 3300025908 Bacteria 2442
66 Ga0207662_10318302 3300025918 Bacteria 1038
67 Ga0207681_10046776 3300025923 Bacteria 2911
68 Ga0207694_10319682 3300025924 Bacteria 1281
69 Ga0207650_10005626 3300025925 Bacteria 8560
70 Ga0207669_10041322 3300025937 Bacteria 2683
71 Ga0207711_10647101 3300025941 Bacteria 986
72 Ga0207661_10040376 3300025944 Bacteria 3668
73 Ga0207661_10043538 3300025944 Bacteria 3543
74 Ga0207668_10000719 3300025972 Bacteria 20260
75 Ga0207668_10072085 3300025972 Bacteria 2470
76 Ga0207678_10033513 3300026067 Bacteria 4473
77 Ga0207683_10006658 3300026121 Bacteria 9883
78 Ga0268266_10008465 3300028379 Bacteria 9145
79 Ga0268266_10545440 3300028379 Bacteria 1111
80 Ga0307515_10372430 3300028794 Bacteria 1064
81 Ga0307511_10003090 3300030521 Bacteria 17155
82 Ga0307512_10001716 3300030522 Bacteria 29935
83 Ga0316181_1111987 3300030744 Bacteria 3215
84 Ga0307513_10000001 3300031456 Bacteria 1660464
85 Ga0307513_10055566 3300031456 Bacteria 4235
86 Ga0307509_10013229 3300031507 Bacteria 9791
87 Ga0307508_10127676 3300031616 Bacteria 2145
88 Ga0307516_10039658 3300031730 Bacteria 4693
89 Ga0307507_10000013 3300033179 Bacteria 242708
90 Ga0439439_0007822 3300041406 Bacteria 2510
91 Ga0439449_0003557 3300042007 Bacteria 6052
92 Ga0466963_0113775 3300044694 Bacteria 1859
93 Ga0466967_0004751 3300045976 Bacteria 9246
94 Ga0466967_0536189 3300045976 Bacteria 1151
95 Ga0495617_070385 3300046452 Bacteria 1150
96 Ga0495603_0061031 3300046455 Bacteria 2227
97 Ga0495590_0038344 3300046457 Bacteria 1671
98 Ga0495629_0019435 3300046459 Bacteria 4852
99 Ga0495629_0157253 3300046459 Bacteria 1579
100 Ga0495641_0033861 3300046461 Bacteria 2421
101 Ga0495651_0105691 3300046462 Bacteria 2088
102 Ga0495653_0002119 3300046463 Bacteria 15632
103 Ga0495580_0014382 3300046472 Bacteria 6002
104 Ga0495580_0076308 3300046472 Bacteria 2338
105 Ga0495582_0020443 3300046473 Bacteria 3625
106 Ga0495582_0038215 3300046473 Bacteria 2641
107 Ga0495582_0067451 3300046473 Bacteria 1977
108 Ga0495639_0002398 3300046475 Bacteria 8197
109 Ga0495639_0043845 3300046475 Bacteria 2021
110 Ga0495662_0012645 3300046476 Bacteria 4116
111 Ga0495662_0027178 3300046476 Bacteria 2764
112 Ga0495662_0098026 3300046476 Bacteria 1433
113 Ga0495662_0119351 3300046476 Bacteria 1294
114 Ga0495664_0012313 3300046477 Bacteria 4843
115 Ga0495594_0081823 3300046499 Bacteria 1803
116 Ga0495594_0086324 3300046499 Bacteria 1756
117 Ga0495594_0151310 3300046499 Bacteria 1317
118 Ga0495607_0009144 3300046501 Bacteria 6735
119 Ga0495583_0041748 3300046506 Bacteria 2146
120 Ga0495606_0006554 3300046507 Bacteria 10702
121 Ga0495608_0059988 3300046511 Bacteria 2505
122 Ga0495620_0014782 3300046515 Bacteria 3957
123 Ga0495631_0000799 3300046518 Bacteria 20085
124 Ga0495643_0017357 3300046522 Bacteria 4208
125 Ga0495644_0088056 3300046523 Bacteria 1171
126 Ga0495648_0171749 3300046524 Bacteria 1110
127 Ga0495666_0067148 3300046526 Bacteria 1709
128 Ga0495642_0031383 3300046528 Bacteria 2130
129 Ga0495652_0337141 3300046529 Bacteria 1084
130 Ga0495665_0000504 3300046531 Bacteria 19671
131 Ga0495640_0032525 3300046533 Bacteria 3714
132 Ga0495640_0059979 3300046533 Bacteria 2589
133 Ga0495586_0022904 3300046535 Bacteria 3334
134 Ga0495586_0171327 3300046535 Bacteria 1226
135 Ga0495587_0048109 3300046536 Bacteria 2526
136 Ga0495597_0042213 3300046542 Bacteria 2034
137 Ga0495597_0043880 3300046542 Bacteria 1989
138 Ga0495645_0004124 3300046543 Bacteria 9921
139 Ga0495622_0010314 3300046557 Bacteria 4318
140 Ga0495633_0118608 3300046558 Bacteria 1226
141 Ga0495667_0005045 3300046559 Bacteria 8925
142 Ga0495634_0069288 3300046642 Bacteria 2328
143 Ga0495625_0066241 3300046660 Bacteria 2544
144 Ga0495635_0032874 3300046663 Bacteria 3598
145 Ga0495659_0017020 3300046664 Bacteria 2404
146 Ga0495588_0002509 3300046674 Bacteria 7856
147 Ga0495588_0008859 3300046674 Bacteria 4628
148 Ga0495588_0072307 3300046674 Bacteria 1794
149 Ga0495588_0176395 3300046674 Bacteria 1129
150 Ga0495588_0211179 3300046674 Bacteria 1025
151 Ga0495657_0015640 3300046675 Bacteria 5546
152 Ga0495657_0030693 3300046675 Bacteria 3761
153 Ga0495657_0148543 3300046675 Bacteria 1456
154 Ga0495658_0141578 3300046683 Bacteria 1471
155 Ga0495613_0020181 3300046689 Bacteria 4965
156 Ga0495613_0024272 3300046689 Bacteria 4517
157 Ga0495613_0070302 3300046689 Bacteria 2552
158 Ga0495624_0008262 3300046690 Bacteria 7276
159 Ga0495670_0008401 3300046691 Bacteria 5076
160 Ga0495670_0067811 3300046691 Bacteria 1802
161 Ga0495671_0038207 3300046692 Bacteria 2427
162 Ga0495649_0020497 3300046694 Bacteria 3709
163 Ga0495589_0025157 3300046794 Bacteria 3022
164 Ga0495589_0035631 3300046794 Bacteria 2494
165 Ga0495589_0076548 3300046794 Bacteria 1631
166 Ga0495600_0122244 3300046809 Bacteria 1693
167 Ga0495600_0126040 3300046809 Bacteria 1665
168 Ga0495660_0084515 3300046810 Bacteria 1659
169 Ga0495581_0015039 3300047315 Bacteria 4491
170 Ga0495581_0016311 3300047315 Bacteria 4319
171 Ga0495581_0178546 3300047315 Bacteria 1241
172 Ga0495604_0040656 3300047317 Bacteria 3650
173 Ga0495636_0025622 3300047318 Bacteria 2395
174 Ga0495636_0025934 3300047318 Bacteria 2382
175 Ga0495636_0026219 3300047318 Bacteria 2370
176 Ga0495674_0055479 3300047319 Bacteria 3475
177 Ga0495676_0011664 3300047321 Bacteria 7927
178 Ga0495676_0048772 3300047321 Bacteria 3410
179 Ga0495676_0057413 3300047321 Bacteria 3070
180 Ga0495676_0141912 3300047321 Bacteria 1720
181 Ga0495676_0142127 3300047321 Bacteria 1719
182 Ga0495676_0166357 3300047321 Bacteria 1555
183 Ga0495680_0014043 3300047322 Bacteria 6958
184 Ga0495680_0046341 3300047322 Bacteria 3428
185 Ga0495687_008634 3300047443 Bacteria 5807
186 Ga0495687_027331 3300047443 Bacteria 2671
187 Ga0495687_051261 3300047443 Bacteria 1752
188 Ga0495675_0178193 3300047444 Bacteria 1302
189 Ga0495685_004335 3300047447 Bacteria 4574
190 Ga0495685_029859 3300047447 Bacteria 1875
191 Ga0495685_045188 3300047447 Bacteria 1501
192 Ga0495681_0016667 3300047470 Bacteria 4107
193 Ga0495686_0032863 3300047472 Bacteria 3355
194 Ga0495593_0004463 3300047673 Bacteria 8314
195 Ga0495593_0105352 3300047673 Bacteria 1443
196 Ga0495602_0162032 3300048088 Bacteria 1745
197 Ga0495614_0023275 3300048089 Bacteria 2672
198 Ga0495614_0028275 3300048089 Bacteria 2416
199 Ga0495614_0034231 3300048089 Bacteria 2184
200 Ga0496100_0005136 3300048903 Bacteria 7018
201 Ga0496100_0067413 3300048903 Bacteria 2377
202 Ga0496101_0010993 3300048904 Bacteria 5996
203 Ga0496102_0176381 3300048905 Bacteria 2012
204 Ga0496102_0245251 3300048905 Bacteria 1689
205 Ga0496103_0261796 3300048906 Bacteria 1113
206 Ga0496104_0027110 3300048907 Bacteria 5299
207 Ga0496104_0140039 3300048907 Bacteria 2324
208 Ga0496104_0608783 3300048907 Bacteria 1002
209 Ga0496105_0016719 3300048908 Bacteria 5862
210 Ga0496105_0019720 3300048908 Bacteria 5440
211 Ga0496106_0010844 3300048909 Bacteria 6733
212 Ga0496106_0038049 3300048909 Bacteria 3599
213 Ga0496106_0279344 3300048909 Bacteria 1338
214 Ga0496107_0014982 3300048910 Bacteria 5430
215 Ga0496107_0014990 3300048910 Bacteria 5428
216 Ga0496107_0127238 3300048910 Bacteria 1879
217 Ga0496107_0272181 3300048910 Bacteria 1260
218 Ga0496108_0032904 3300048911 Bacteria 4307
219 Ga0496108_0036922 3300048911 Bacteria 4067
220 Ga0496108_0145429 3300048911 Bacteria 2044
221 Ga0496108_0307234 3300048911 Unclassified 1382
222 Ga0496109_0005817 3300048912 Bacteria 10331
223 Ga0496109_0047475 3300048912 Bacteria 3904
224 Ga0496109_0050667 3300048912 Bacteria 3780
225 Ga0496109_0090713 3300048912 Unclassified 2826
226 Ga0496110_0015910 3300048913 Bacteria 6273
227 Ga0496110_0020109 3300048913 Bacteria 5632
228 Ga0496110_0055443 3300048913 Bacteria 3488
229 Ga0496110_0293608 3300048913 Bacteria 1480
230 Ga0496111_0012130 3300048914 Bacteria 5828
231 Ga0496111_0024391 3300048914 Bacteria 4258
232 Ga0496111_0032138 3300048914 Bacteria 3742
233 Ga0496111_0034996 3300048914 Bacteria 3587
234 Ga0496111_0133002 3300048914 Bacteria 1841
235 Ga0496111_0188199 3300048914 Bacteria 1534
236 Ga0496112_0023543 3300048915 Bacteria 5886
237 Ga0496112_0027902 3300048915 Bacteria 5446
238 Ga0496112_0133189 3300048915 Bacteria 2456
239 Ga0496114_0043687 3300048917 Bacteria 3716
240 Ga0496114_0046147 3300048917 Bacteria 3620
241 Ga0496114_0061223 3300048917 Bacteria 3147
242 Ga0496114_0101859 3300048917 Unclassified 2452
243 Ga0496115_0033121 3300048918 Bacteria 4078
244 Ga0496122_0240959 3300048925 Bacteria 1020
245 Ga0495678_034095 3300049459 Bacteria 2097
246 Ga0501047_0367555 3300049581 Bacteria 1274
247 Ga0501044_0422135 3300049823 Bacteria 1244
248 nmdc:mga03n38_5640_c1 3300050490 Bacteria 4281
249 nmdc:mga0yw44_1264_c1 3300050492 Bacteria 9955
250 nmdc:mga06z11_642_c1 3300050494 Bacteria 12731
251 nmdc:mga07m45_218728_c1 3300050496 Bacteria 1108
252 nmdc:mga05p37_116011_c1 3300050507 Bacteria 2951
253 nmdc:mga09592_133990_c1 3300050508 Bacteria 2133
254 nmdc:mga09592_61731_c1 3300050508 Bacteria 3170
255 nmdc:mga0qj67_136199_c1 3300050509 Bacteria 1990
256 nmdc:mga06r32_20377_c1 3300050510 Bacteria 6105
257 nmdc:mga0a205_28399_c1 3300050515 Bacteria 5350
258 nmdc:mga0sz30_46284_c1 3300050516 Bacteria 1836
259 Ga0495619_0180346 3300053085 Bacteria 1461
260 Ga0500556_0003735 3300053104 Bacteria 4421
261 Ga0587079_022808 3300059647 Bacteria 1140
262 2616698692 2616644814 Bacteria 11555299
263 2643851869 2643221567 Bacteria 4163945
264 2644137543 2643221624 Bacteria 4384879
265 2644178412 2643221631 Bacteria 8168043
266 2644444234 2643221679 Bacteria 3839507
267 2738707719 2738541274 Bacteria 6909446
268 2739332731 2738543028 Bacteria 6917070
269 2856742536 2856741275 Bacteria 8096094
270 2861525074 2861520306 Bacteria 8348283
271 2891404183 2891395885 Bacteria 9251614
272 2891565031 2891562705 Bacteria 8039471
273 2995464376 2995463766 Bacteria 8577691
274 3006325968 3006321560 Bacteria 8247479
275 8057572927 8057568493 Bacteria 7221719
276 Ga0495603_0003919
277 rootH1_10042001
278 rootH2_10016047
279 rootL2_10078069
280 rootH1_10239649
281 Ga0065714_10004525
282 Ga0070676_10001857
283 Ga0070683_100010237
284 Ga0070683_100292915
285 Ga0070666_10180671
286 Ga0070682_100032999
287 Ga0070687_100310963
288 Ga0070668_100000937
289 Ga0070669_100026790
290 Ga0070675_100090577
291 Ga0070671_100044052
292 Ga0070674_100009752
293 Ga0070673_100021081
294 Ga0070667_100397628
295 Ga0070711_100185678
296 Ga0070663_100031986
297 Ga0070678_100139589
298 Ga0070672_100150278
299 Ga0070664_100500188
300 Ga0068854_100144206
301 Ga0068864_100148964
302 Ga0068870_10188010
303 Ga0068863_100508900
304 Ga0070717_10016557
305 Ga0075365_10030675
306 Ga0075363_100025981
307 Ga0075367_10000220
308 Ga0075369_10060903
309 Ga0075428_100024329
310 Ga0075428_100233078
311 Ga0075430_100112965
312 Ga0075431_100052240
313 Ga0075429_100066663
314 Ga0075429_100109426
315 Ga0068865_100554769
316 Ga0105244_10015794
317 Ga0105245_10222850
318 Ga0105248_10319692
319 Ga0105238_10716130
320 Ga0105239_10178341
321 Ga0105246_10056403
322 Ga0105246_10112492
323 Ga0105246_10147529
324 Ga0157373_10026701
325 Ga0157371_10095873
326 Ga0157369_10090920
327 Ga0163162_10087588
328 Ga0163162_10256410
329 Ga0157372_10141624
330 Ga0157375_10022649
331 Ga0157375_10421815
332 Ga0157375_10811355
333 Ga0163163_10134029
334 Ga0157376_10187670
335 Ga0209758_1004813
336 Ga0209051_1002116
337 Ga0207697_10004037
338 Ga0207655_1009569
339 Ga0207645_10001051
340 Ga0207643_10046916
341 Ga0207662_10318302
342 Ga0207681_10046776
343 Ga0207694_10319682
344 Ga0207650_10005626
345 Ga0207669_10041322
346 Ga0207711_10647101
347 Ga0207661_10040376
348 Ga0207661_10043538
349 Ga0207668_10000719
350 Ga0207668_10072085
351 Ga0207678_10033513
352 Ga0207683_10006658
353 Ga0268266_10008465
354 Ga0268266_10545440
355 Ga0307515_10372430
356 Ga0307511_10003090
357 Ga0307512_10001716
358 Ga0316181_1111987
359 Ga0307513_10000001
360 Ga0307513_10055566
361 Ga0307509_10013229
362 Ga0307508_10127676
363 Ga0307516_10039658
364 Ga0307507_10000013
365 Ga0439439_0007822
366 Ga0439449_0003557
367 Ga0466963_0113775
368 Ga0466967_0004751
369 Ga0466967_0536189
370 Ga0495617_070385
371 Ga0495603_0061031
372 Ga0495590_0038344
373 Ga0495629_0019435
374 Ga0495629_0157253
375 Ga0495641_0033861
376 Ga0495651_0105691
377 Ga0495653_0002119
378 Ga0495580_0014382
379 Ga0495580_0076308
380 Ga0495582_0020443
381 Ga0495582_0038215
382 Ga0495582_0067451
383 Ga0495639_0002398
384 Ga0495639_0043845
385 Ga0495662_0012645
386 Ga0495662_0027178
387 Ga0495662_0098026
388 Ga0495662_0119351
389 Ga0495664_0012313
390 Ga0495594_0081823
391 Ga0495594_0086324
392 Ga0495594_0151310
393 Ga0495607_0009144
394 Ga0495583_0041748
395 Ga0495606_0006554
396 Ga0495608_0059988
397 Ga0495620_0014782
398 Ga0495631_0000799
399 Ga0495643_0017357
400 Ga0495644_0088056
401 Ga0495648_0171749
402 Ga0495666_0067148
403 Ga0495642_0031383
404 Ga0495652_0337141
405 Ga0495665_0000504
406 Ga0495640_0032525
407 Ga0495640_0059979
408 Ga0495586_0022904
409 Ga0495586_0171327
410 Ga0495587_0048109
411 Ga0495597_0042213
412 Ga0495597_0043880
413 Ga0495645_0004124
414 Ga0495622_0010314
415 Ga0495633_0118608
416 Ga0495667_0005045
417 Ga0495634_0069288
418 Ga0495625_0066241
419 Ga0495635_0032874
420 Ga0495659_0017020
421 Ga0495588_0002509
422 Ga0495588_0008859
423 Ga0495588_0072307
424 Ga0495588_0176395
425 Ga0495588_0211179
426 Ga0495657_0015640
427 Ga0495657_0030693
428 Ga0495657_0148543
429 Ga0495658_0141578
430 Ga0495613_0020181
431 Ga0495613_0024272
432 Ga0495613_0070302
433 Ga0495624_0008262
434 Ga0495670_0008401
435 Ga0495670_0067811
436 Ga0495671_0038207
437 Ga0495649_0020497
438 Ga0495589_0025157
439 Ga0495589_0035631
440 Ga0495589_0076548
441 Ga0495600_0122244
442 Ga0495600_0126040
443 Ga0495660_0084515
444 Ga0495581_0015039
445 Ga0495581_0016311
446 Ga0495581_0178546
447 Ga0495604_0040656
448 Ga0495636_0025622
449 Ga0495636_0025934
450 Ga0495636_0026219
451 Ga0495674_0055479
452 Ga0495676_0011664
453 Ga0495676_0048772
454 Ga0495676_0057413
455 Ga0495676_0141912
456 Ga0495676_0142127
457 Ga0495676_0166357
458 Ga0495680_0014043
459 Ga0495680_0046341
460 Ga0495687_008634
461 Ga0495687_027331
462 Ga0495687_051261
463 Ga0495675_0178193
464 Ga0495685_004335
465 Ga0495685_029859
466 Ga0495685_045188
467 Ga0495681_0016667
468 Ga0495686_0032863
469 Ga0495593_0004463
470 Ga0495593_0105352
471 Ga0495602_0162032
472 Ga0495614_0023275
473 Ga0495614_0028275
474 Ga0495614_0034231
475 Ga0496100_0005136
476 Ga0496100_0067413
477 Ga0496101_0010993
478 Ga0496102_0176381
479 Ga0496102_0245251
480 Ga0496103_0261796
481 Ga0496104_0027110
482 Ga0496104_0140039
483 Ga0496104_0608783
484 Ga0496105_0016719
485 Ga0496105_0019720
486 Ga0496106_0010844
487 Ga0496106_0038049
488 Ga0496106_0279344
489 Ga0496107_0014982
490 Ga0496107_0014990
491 Ga0496107_0127238
492 Ga0496107_0272181
493 Ga0496108_0032904
494 Ga0496108_0036922
495 Ga0496108_0145429
496 Ga0496108_0307234
497 Ga0496109_0005817
498 Ga0496109_0047475
499 Ga0496109_0050667
500 Ga0496109_0090713
501 Ga0496110_0015910
502 Ga0496110_0020109
503 Ga0496110_0055443
504 Ga0496110_0293608
505 Ga0496111_0012130
506 Ga0496111_0024391
507 Ga0496111_0032138
508 Ga0496111_0034996
509 Ga0496111_0133002
510 Ga0496111_0188199
511 Ga0496112_0023543
512 Ga0496112_0027902
513 Ga0496112_0133189
514 Ga0496114_0043687
515 Ga0496114_0046147
516 Ga0496114_0061223
517 Ga0496114_0101859
518 Ga0496115_0033121
519 Ga0496122_0240959
520 Ga0495678_034095
521 Ga0501047_0367555
522 Ga0501044_0422135
523 nmdc:mga03n38_5640_c1
524 nmdc:mga0yw44_1264_c1
525 nmdc:mga06z11_642_c1
526 nmdc:mga07m45_218728_c1
527 nmdc:mga05p37_116011_c1
528 nmdc:mga09592_133990_c1
529 nmdc:mga09592_61731_c1
530 nmdc:mga0qj67_136199_c1
531 nmdc:mga06r32_20377_c1
532 nmdc:mga0a205_28399_c1
533 nmdc:mga0sz30_46284_c1
534 Ga0495619_0180346
535 Ga0500556_0003735
536 Ga0587079_022808
537 2616698692
538 2643851869
539 2644137543
540 2644178412
541 2644444234
542 2738707719
543 2739332731
544 2856742536
545 2861525074
546 2891404183
547 2891565031
548 2995464376
549 3006325968
550 8057572927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

61

273

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eaj-assembly1.cif.gz_A co-crystal of ampk core with amp soaked with atp 0.748 36 65
6r79-assembly4.cif.gz_D structure of imp-13 metallo-beta-lactamase in apo form (loop open) 0.7472 35 270
2nzf-assembly1.cif.gz_A structure of beta-lactamase ii from bacillus cereus. r121h, c221s double mutant. space group c2. 0.7438 36 268
2ya3-assembly1.cif.gz_A structure of the regulatory fragment of mammalian ampk in complex with coumarin adp 0.7414 36 65
4cfh-assembly1.cif.gz_A structure of an active form of mammalian ampk 0.7398 36 65
ID Description Score Start End Superfamily
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7822 147 230 3.60.15.10
2y94A03 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7405 36 65 3.30.310.80
af_O18645_463_582_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7289 37 65 3.30.310.80
af_I1MD49_73_326_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7283 60 230 3.60.15.10
af_A4HZ66_7_206_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7213 31 230 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A850CB61-F1-model_v4 MBL fold metallo-hydrolase 0.9925 17 139 GO:0016787
AF-A0A1V4DTY2-F1-model_v4 MBL fold metallo-hydrolase 0.9894 5 286 GO:0016787
AF-A0A7W7SJ71-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9883 5 287 GO:0016787
AF-D3PWS4-F1-model_v4 Beta-lactamase domain protein 0.9836 6 289
AF-A0A397RSY0-F1-model_v4 deleted 0.9831 6 289

Map