F380402

General Info

Members Datasets Scaffolds Average Seq Length
275 196 550 100

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_12080459|Ga0114129_120804591
Length 119
Sequence MPNTNRPTISTHVLDTTRGAPAAGVAVSLWRLDGNQRAEPQGSGETDADGRIGDLLNGKASLVAGMYRLTFDVAPYFKKKGDAPFLGRVTLDLEVTDTSRRYHVPLLVSPFSCASYRGS

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
111 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
112 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 5.45
Rhizosphere 91.27
Stem 0
Stem Tuber 0
Unclassified 12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_12080459 3300009147 Bacteria 685
2 JGI25407J50210_10167560 3300003373 Unclassified 541
3 Ga0070683_101166644 3300005329 Bacteria 740
4 Ga0070690_100133127 3300005330 Bacteria 1681
5 Ga0070680_100009402 3300005336 Bacteria 7510
6 Ga0070682_100247546 3300005337 Bacteria 1283
7 Ga0068868_101359920 3300005338 Bacteria 661
8 Ga0070691_10103493 3300005341 Bacteria 1417
9 Ga0070674_100456257 3300005356 Bacteria 1056
10 Ga0070667_100235213 3300005367 Bacteria 1634
11 Ga0070703_10280516 3300005406 Bacteria 687
12 Ga0070714_100165398 3300005435 Bacteria 2004
13 Ga0070713_100275349 3300005436 Bacteria 1542
14 Ga0070713_101545973 3300005436 Bacteria 644
15 Ga0070710_10086963 3300005437 Bacteria 1836
16 Ga0070710_10245374 3300005437 Bacteria 1149
17 Ga0070711_100487357 3300005439 Bacteria 1014
18 Ga0070711_100761537 3300005439 Bacteria 819
19 Ga0070705_100012239 3300005440 Bacteria 4356
20 Ga0070705_100179617 3300005440 Bacteria 1432
21 Ga0070705_100352432 3300005440 Bacteria 1074
22 Ga0070705_100386492 3300005440 Bacteria 1032
23 Ga0070694_100029636 3300005444 Bacteria 3573
24 Ga0070694_100497556 3300005444 Bacteria 969
25 Ga0070708_100140583 3300005445 Bacteria 2238
26 Ga0070663_100530722 3300005455 Bacteria 981
27 Ga0070678_100002181 3300005456 Bacteria 10639
28 Ga0070678_101523344 3300005456 Bacteria 626
29 Ga0070678_102226691 3300005456 Bacteria 520
30 Ga0070678_102273572 3300005456 Unclassified 514
31 Ga0070706_100061227 3300005467 Bacteria 3476
32 Ga0070706_100070520 3300005467 Bacteria 3232
33 Ga0070706_100813751 3300005467 Bacteria 865
34 Ga0070706_101132099 3300005467 Bacteria 720
35 Ga0070707_100095767 3300005468 Bacteria 2875
36 Ga0070698_100029817 3300005471 Bacteria 5661
37 Ga0070698_100179456 3300005471 Unclassified 2056
38 Ga0070698_102136550 3300005471 Unclassified 513
39 Ga0070699_100028569 3300005518 Bacteria 4809
40 Ga0070699_100109317 3300005518 Bacteria 2426
41 Ga0070699_100524926 3300005518 Bacteria 1077
42 Ga0070699_100634724 3300005518 Bacteria 975
43 Ga0070699_100908445 3300005518 Bacteria 807
44 Ga0070679_100660916 3300005530 Bacteria 988
45 Ga0070684_100099184 3300005535 Bacteria 2599
46 Ga0070697_100449857 3300005536 Bacteria 1122
47 Ga0070672_102154040 3300005543 Bacteria 503
48 Ga0070686_100013091 3300005544 Bacteria 4734
49 Ga0070686_100690798 3300005544 Bacteria 813
50 Ga0070696_100054961 3300005546 Unclassified 2776
51 Ga0070693_100280333 3300005547 Bacteria 1116
52 Ga0070704_100064487 3300005549 Bacteria 2633
53 Ga0070704_100072570 3300005549 Bacteria 2504
54 Ga0070704_100487426 3300005549 Bacteria 1068
55 Ga0068857_100045104 3300005577 Bacteria 3910
56 Ga0068854_101176180 3300005578 Unclassified 686
57 Ga0070702_100005529 3300005615 Bacteria 5901
58 Ga0068864_102133938 3300005618 Unclassified 567
59 Ga0068866_10017126 3300005718 Bacteria 3254
60 Ga0068866_10978663 3300005718 Bacteria 600
61 Ga0068860_100074455 3300005843 Bacteria 3229
62 Ga0081455_10046101 3300005937 Bacteria 3786
63 Ga0081538_10021467 3300005981 Bacteria 4713
64 Ga0070717_10504362 3300006028 Bacteria 1094
65 Ga0075365_10009695 3300006038 Bacteria 5557
66 Ga0075432_10038851 3300006058 Bacteria 1659
67 Ga0070715_10036159 3300006163 Bacteria 2036
68 Ga0070712_100039640 3300006175 Bacteria 3224
69 Ga0075362_10238300 3300006177 Bacteria 892
70 Ga0075366_10445057 3300006195 Bacteria 799
71 Ga0097621_100011611 3300006237 Bacteria 6494
72 Ga0075428_100386013 3300006844 Bacteria 1501
73 Ga0075430_101542384 3300006846 Bacteria 546
74 Ga0075431_100896250 3300006847 Bacteria 857
75 Ga0075434_100065852 3300006871 Bacteria 3609
76 Ga0068865_100043971 3300006881 Bacteria 3054
77 Ga0068865_100432154 3300006881 Bacteria 1085
78 Ga0075436_100224595 3300006914 Unclassified 1333
79 Ga0075436_100900264 3300006914 Unclassified 662
80 Ga0111539_10076588 3300009094 Bacteria 3938
81 Ga0111539_10078427 3300009094 Bacteria 3886
82 Ga0111539_10447652 3300009094 Bacteria 1504
83 Ga0105245_11083536 3300009098 Bacteria 847
84 Ga0105247_10005276 3300009101 Bacteria 8155
85 Ga0114129_10164619 3300009147 Bacteria 3028
86 Ga0114129_10313861 3300009147 Bacteria 2086
87 Ga0114129_10626210 3300009147 Bacteria 1391
88 Ga0114129_10712462 3300009147 Bacteria 1289
89 Ga0114129_11405755 3300009147 Bacteria 861
90 Ga0105243_11506775 3300009148 Bacteria 696
91 Ga0105243_12095945 3300009148 Bacteria 601
92 Ga0105241_10333362 3300009174 Bacteria 1312
93 Ga0105248_10050050 3300009177 Bacteria 4686
94 Ga0105249_11166000 3300009553 Bacteria 841
95 Ga0157374_11383793 3300013296 Bacteria 726
96 Ga0157378_10073563 3300013297 Bacteria 3073
97 Ga0157375_10024525 3300013308 Bacteria 5584
98 Ga0163163_12832870 3300014325 Bacteria 541
99 Ga0182008_10667486 3300014497 Bacteria 590
100 Ga0157379_10167889 3300014968 Bacteria 1981
101 Ga0157376_10022008 3300014969 Bacteria 4960
102 Ga0157376_11079833 3300014969 Bacteria 828
103 Ga0213875_10023280 3300021388 Bacteria 2959
104 Ga0207653_10109436 3300025885 Unclassified 985
105 Ga0207653_10383433 3300025885 Unclassified 550
106 Ga0207692_10071135 3300025898 Bacteria 1833
107 Ga0207642_10268044 3300025899 Bacteria 977
108 Ga0207642_10711069 3300025899 Bacteria 634
109 Ga0207710_10003335 3300025900 Bacteria 7174
110 Ga0207699_10230943 3300025906 Bacteria 1267
111 Ga0207684_10122334 3300025910 Bacteria 2231
112 Ga0207684_10173519 3300025910 Bacteria 1858
113 Ga0207654_10138359 3300025911 Bacteria 1550
114 Ga0207693_10008721 3300025915 Bacteria 8290
115 Ga0207663_10231923 3300025916 Bacteria 1349
116 Ga0207660_10091033 3300025917 Unclassified 2261
117 Ga0207660_10565420 3300025917 Bacteria 925
118 Ga0207652_10787426 3300025921 Bacteria 845
119 Ga0207646_10457599 3300025922 Bacteria 1151
120 Ga0207700_11443222 3300025928 Bacteria 611
121 Ga0207664_10323902 3300025929 Bacteria 1360
122 Ga0207686_10052996 3300025934 Bacteria 2535
123 Ga0207709_10034468 3300025935 Bacteria 2984
124 Ga0207669_10403730 3300025937 Bacteria 1071
125 Ga0207704_10274872 3300025938 Bacteria 1277
126 Ga0207704_10363693 3300025938 Bacteria 1130
127 Ga0207665_10014513 3300025939 Bacteria 5188
128 Ga0207691_10266216 3300025940 Bacteria 1477
129 Ga0207668_10610769 3300025972 Bacteria 951
130 Ga0207677_11032598 3300026023 Bacteria 747
131 Ga0207703_11576586 3300026035 Bacteria 632
132 Ga0207678_10164491 3300026067 Bacteria 1894
133 Ga0207678_10183739 3300026067 Bacteria 1786
134 Ga0207708_10021333 3300026075 Bacteria 4884
135 Ga0207648_11621613 3300026089 Bacteria 608
136 Ga0207676_11976071 3300026095 Unclassified 582
137 Ga0207674_10078595 3300026116 Bacteria 3304
138 Ga0207674_10079972 3300026116 Bacteria 3272
139 Ga0207683_10000903 3300026121 Bacteria 27320
140 Ga0207683_10829032 3300026121 Bacteria 859
141 Ga0207428_10091529 3300027907 Bacteria 2361
142 Ga0207428_10361873 3300027907 Bacteria 1066
143 Ga0268266_11272263 3300028379 Unclassified 711
144 Ga0307408_100357342 3300031548 Bacteria 1241
145 Ga0307405_10179168 3300031731 Bacteria 1520
146 Ga0307406_10168856 3300031901 Bacteria 1581
147 Ga0307416_100501552 3300032002 Bacteria 1278
148 Ga0373946_0149031 3300035171 Bacteria 1090
149 Ga0395900_0216443 3300037418 Bacteria 1933
150 Ga0436364_0069531 3300037853 Bacteria 17658
151 Ga0436365_0181186 3300039437 Bacteria 849
152 Ga0439448_0019149 3300042005 Bacteria 2105
153 Ga0439459_0147212 3300042438 Unclassified 613
154 Ga0439460_0242923 3300042461 Bacteria 621
155 Ga0450893_0040674 3300042532 Bacteria 851
156 Ga0453683_0397442 3300044673 Unclassified 888
157 Ga0466961_0293779 3300044693 Bacteria 993
158 Ga0466960_0714543 3300044901 Bacteria 602
159 Ga0466959_0256272 3300045049 Bacteria 1206
160 Ga0451576_0209510 3300045051 Bacteria 2036
161 Ga0451576_0453978 3300045051 Bacteria 1346
162 Ga0495603_0021324 3300046455 Bacteria 3924
163 Ga0495590_0019499 3300046457 Bacteria 2416
164 Ga0495629_1093284 3300046459 Bacteria 516
165 Ga0495641_0283027 3300046461 Unclassified 747
166 Ga0495641_0415036 3300046461 Unclassified 611
167 Ga0495653_0645926 3300046463 Unclassified 647
168 Ga0495582_0433188 3300046473 Bacteria 759
169 Ga0495582_0443588 3300046473 Bacteria 749
170 Ga0495582_0573794 3300046473 Bacteria 653
171 Ga0495605_0414942 3300046474 Bacteria 558
172 Ga0495639_0317006 3300046475 Bacteria 779
173 Ga0495584_0320169 3300046491 Bacteria 787
174 Ga0495585_0108250 3300046492 Bacteria 1480
175 Ga0495585_0371483 3300046492 Bacteria 692
176 Ga0495594_0762675 3300046499 Bacteria 546
177 Ga0495596_0246746 3300046500 Bacteria 693
178 Ga0495596_0352610 3300046500 Bacteria 573
179 Ga0495607_0264485 3300046501 Bacteria 822
180 Ga0495583_0283647 3300046506 Bacteria 660
181 Ga0495620_0347953 3300046515 Bacteria 562
182 Ga0495637_0344912 3300046520 Bacteria 523
183 Ga0495644_0250407 3300046523 Unclassified 688
184 Ga0495663_0039172 3300046525 Bacteria 1435
185 Ga0495663_0280037 3300046525 Bacteria 597
186 Ga0495642_0013039 3300046528 Unclassified 3210
187 Ga0495642_0147272 3300046528 Bacteria 1018
188 Ga0495654_0300326 3300046530 Bacteria 656
189 Ga0495598_0078767 3300046537 Unclassified 1053
190 Ga0495609_0110805 3300046538 Unclassified 1185
191 Ga0495609_0161168 3300046538 Bacteria 951
192 Ga0495621_0019702 3300046539 Bacteria 2206
193 Ga0495621_0070960 3300046539 Bacteria 1283
194 Ga0495611_0129172 3300046648 Bacteria 1179
195 Ga0495635_0285574 3300046663 Bacteria 1108
196 Ga0495659_0060741 3300046664 Bacteria 1395
197 Ga0495658_0065234 3300046683 Bacteria 2100
198 Ga0495669_0220021 3300046684 Unclassified 910
199 Ga0495670_0060551 3300046691 Bacteria 1902
200 Ga0495670_0357261 3300046691 Bacteria 787
201 Ga0495600_0516431 3300046809 Bacteria 733
202 Ga0495636_0153929 3300047318 Unclassified 1033
203 Ga0495636_0503394 3300047318 Bacteria 586
204 Ga0495636_0684669 3300047318 Bacteria 505
205 Ga0495674_0574674 3300047319 Bacteria 895
206 Ga0495676_0319839 3300047321 Bacteria 1043
207 Ga0495680_0204660 3300047322 Bacteria 1415
208 Ga0495677_0139448 3300047445 Unclassified 931
209 Ga0496100_0007714 3300048903 Bacteria 5957
210 Ga0496101_0197201 3300048904 Bacteria 1555
211 Ga0496103_0067473 3300048906 Bacteria 2234
212 Ga0496104_0024581 3300048907 Bacteria 5542
213 Ga0496105_0001378 3300048908 Bacteria 17065
214 Ga0496105_1160121 3300048908 Unclassified 571
215 Ga0496106_0007242 3300048909 Bacteria 8195
216 Ga0496107_0003801 3300048910 Bacteria 10137
217 Ga0496108_0637982 3300048911 Bacteria 926
218 Ga0496110_0954370 3300048913 Bacteria 764
219 Ga0496111_0049977 3300048914 Bacteria 3015
220 Ga0496111_0117288 3300048914 Bacteria 1964
221 Ga0496114_0223133 3300048917 Bacteria 1654
222 Ga0496114_0457128 3300048917 Bacteria 1130
223 Ga0496115_0619644 3300048918 Bacteria 858
224 Ga0501032_0084921 3300049569 Bacteria 2105
225 Ga0501038_0564945 3300049574 Bacteria 864
226 Ga0501041_0035087 3300049577 Bacteria 3039
227 Ga0501041_0757707 3300049577 Unclassified 622
228 Ga0501042_0017545 3300049578 Bacteria 4938
229 Ga0501048_0032923 3300049582 Bacteria 3746
230 Ga0501067_0004329 3300049583 Bacteria 7818
231 Ga0501067_0056487 3300049583 Bacteria 2174
232 Ga0501068_0075246 3300049584 Bacteria 2065
233 Ga0501069_0014678 3300049585 Bacteria 4190
234 Ga0501069_0031518 3300049585 Bacteria 2916
235 Ga0501069_0993463 3300049585 Bacteria 512
236 Ga0501070_0136490 3300049586 Bacteria 2025
237 Ga0501071_0028506 3300049587 Bacteria 3937
238 Ga0501071_0207238 3300049587 Bacteria 1474
239 Ga0501072_0159888 3300049588 Bacteria 1797
240 Ga0501075_0048452 3300049591 Bacteria 3193
241 Ga0501075_0606496 3300049591 Unclassified 835
242 Ga0501075_0777192 3300049591 Bacteria 729
243 Ga0501076_0093807 3300049592 Bacteria 2416
244 Ga0501079_0372723 3300049741 Bacteria 1119
245 Ga0501081_0194912 3300049743 Bacteria 1468
246 Ga0501035_1057720 3300049822 Bacteria 636
247 nmdc:mga00v17_69397_c1 3300050491 Bacteria 2181
248 nmdc:mga0yw44_190006_c1 3300050492 Bacteria 1354
249 nmdc:mga0k408_427377_c1 3300050493 Bacteria 787
250 nmdc:mga05p37_1006598_c1 3300050507 Unclassified 884
251 nmdc:mga05p37_165691_c1 3300050507 Bacteria 2697
252 nmdc:mga05p37_87322_c1 3300050507 Bacteria 3844
253 nmdc:mga09592_112512_c1 3300050508 Bacteria 2336
254 nmdc:mga09592_405224_c1 3300050508 Bacteria 1179
255 nmdc:mga0qj67_91873_c1 3300050509 Bacteria 2440
256 nmdc:mga06r32_1189101_c1 3300050510 Unclassified 709
257 nmdc:mga06r32_157468_c1 3300050510 Bacteria 2253
258 nmdc:mga06r32_256996_c1 3300050510 Bacteria 1735
259 nmdc:mga06r32_454941_c1 3300050510 Bacteria 1260
260 nmdc:mga06r32_797772_c1 3300050510 Bacteria 905
261 nmdc:mga08y16_151933_c1 3300050511 Bacteria 2406
262 nmdc:mga08y16_469939_c1 3300050511 Bacteria 1281
263 nmdc:mga0n895_24861_c1 3300050512 Bacteria 5651
264 nmdc:mga0n895_640688_c1 3300050512 Bacteria 1062
265 nmdc:mga0rr50_1267_c1 3300050513 Bacteria 13743
266 nmdc:mga0rr50_904297_c1 3300050513 Bacteria 753
267 nmdc:mga08x19_137711_c1 3300050514 Bacteria 1647
268 nmdc:mga08x19_587995_c1 3300050514 Unclassified 789
269 Ga0495655_0199379 3300053083 Bacteria 654
270 Ga0495595_0343657 3300053084 Unclassified 753
271 Ga0495619_1095189 3300053085 Bacteria 530
272 Ga0501082_0921323 3300060353 Bacteria 764
273 Ga0501082_1232407 3300060353 Bacteria 654
274 Ga0530510_0048895 3300061734 Bacteria 3056
275 Ga0530510_0749518 3300061734 Bacteria 745
276 Ga0114129_12080459
277 JGI25407J50210_10167560
278 Ga0070683_101166644
279 Ga0070690_100133127
280 Ga0070680_100009402
281 Ga0070682_100247546
282 Ga0068868_101359920
283 Ga0070691_10103493
284 Ga0070674_100456257
285 Ga0070667_100235213
286 Ga0070703_10280516
287 Ga0070714_100165398
288 Ga0070713_100275349
289 Ga0070713_101545973
290 Ga0070710_10086963
291 Ga0070710_10245374
292 Ga0070711_100487357
293 Ga0070711_100761537
294 Ga0070705_100012239
295 Ga0070705_100179617
296 Ga0070705_100352432
297 Ga0070705_100386492
298 Ga0070694_100029636
299 Ga0070694_100497556
300 Ga0070708_100140583
301 Ga0070663_100530722
302 Ga0070678_100002181
303 Ga0070678_101523344
304 Ga0070678_102226691
305 Ga0070678_102273572
306 Ga0070706_100061227
307 Ga0070706_100070520
308 Ga0070706_100813751
309 Ga0070706_101132099
310 Ga0070707_100095767
311 Ga0070698_100029817
312 Ga0070698_100179456
313 Ga0070698_102136550
314 Ga0070699_100028569
315 Ga0070699_100109317
316 Ga0070699_100524926
317 Ga0070699_100634724
318 Ga0070699_100908445
319 Ga0070679_100660916
320 Ga0070684_100099184
321 Ga0070697_100449857
322 Ga0070672_102154040
323 Ga0070686_100013091
324 Ga0070686_100690798
325 Ga0070696_100054961
326 Ga0070693_100280333
327 Ga0070704_100064487
328 Ga0070704_100072570
329 Ga0070704_100487426
330 Ga0068857_100045104
331 Ga0068854_101176180
332 Ga0070702_100005529
333 Ga0068864_102133938
334 Ga0068866_10017126
335 Ga0068866_10978663
336 Ga0068860_100074455
337 Ga0081455_10046101
338 Ga0081538_10021467
339 Ga0070717_10504362
340 Ga0075365_10009695
341 Ga0075432_10038851
342 Ga0070715_10036159
343 Ga0070712_100039640
344 Ga0075362_10238300
345 Ga0075366_10445057
346 Ga0097621_100011611
347 Ga0075428_100386013
348 Ga0075430_101542384
349 Ga0075431_100896250
350 Ga0075434_100065852
351 Ga0068865_100043971
352 Ga0068865_100432154
353 Ga0075436_100224595
354 Ga0075436_100900264
355 Ga0111539_10076588
356 Ga0111539_10078427
357 Ga0111539_10447652
358 Ga0105245_11083536
359 Ga0105247_10005276
360 Ga0114129_10164619
361 Ga0114129_10313861
362 Ga0114129_10626210
363 Ga0114129_10712462
364 Ga0114129_11405755
365 Ga0105243_11506775
366 Ga0105243_12095945
367 Ga0105241_10333362
368 Ga0105248_10050050
369 Ga0105249_11166000
370 Ga0157374_11383793
371 Ga0157378_10073563
372 Ga0157375_10024525
373 Ga0163163_12832870
374 Ga0182008_10667486
375 Ga0157379_10167889
376 Ga0157376_10022008
377 Ga0157376_11079833
378 Ga0213875_10023280
379 Ga0207653_10109436
380 Ga0207653_10383433
381 Ga0207692_10071135
382 Ga0207642_10268044
383 Ga0207642_10711069
384 Ga0207710_10003335
385 Ga0207699_10230943
386 Ga0207684_10122334
387 Ga0207684_10173519
388 Ga0207654_10138359
389 Ga0207693_10008721
390 Ga0207663_10231923
391 Ga0207660_10091033
392 Ga0207660_10565420
393 Ga0207652_10787426
394 Ga0207646_10457599
395 Ga0207700_11443222
396 Ga0207664_10323902
397 Ga0207686_10052996
398 Ga0207709_10034468
399 Ga0207669_10403730
400 Ga0207704_10274872
401 Ga0207704_10363693
402 Ga0207665_10014513
403 Ga0207691_10266216
404 Ga0207668_10610769
405 Ga0207677_11032598
406 Ga0207703_11576586
407 Ga0207678_10164491
408 Ga0207678_10183739
409 Ga0207708_10021333
410 Ga0207648_11621613
411 Ga0207676_11976071
412 Ga0207674_10078595
413 Ga0207674_10079972
414 Ga0207683_10000903
415 Ga0207683_10829032
416 Ga0207428_10091529
417 Ga0207428_10361873
418 Ga0268266_11272263
419 Ga0307408_100357342
420 Ga0307405_10179168
421 Ga0307406_10168856
422 Ga0307416_100501552
423 Ga0373946_0149031
424 Ga0395900_0216443
425 Ga0436364_0069531
426 Ga0436365_0181186
427 Ga0439448_0019149
428 Ga0439459_0147212
429 Ga0439460_0242923
430 Ga0450893_0040674
431 Ga0453683_0397442
432 Ga0466961_0293779
433 Ga0466960_0714543
434 Ga0466959_0256272
435 Ga0451576_0209510
436 Ga0451576_0453978
437 Ga0495603_0021324
438 Ga0495590_0019499
439 Ga0495629_1093284
440 Ga0495641_0283027
441 Ga0495641_0415036
442 Ga0495653_0645926
443 Ga0495582_0433188
444 Ga0495582_0443588
445 Ga0495582_0573794
446 Ga0495605_0414942
447 Ga0495639_0317006
448 Ga0495584_0320169
449 Ga0495585_0108250
450 Ga0495585_0371483
451 Ga0495594_0762675
452 Ga0495596_0246746
453 Ga0495596_0352610
454 Ga0495607_0264485
455 Ga0495583_0283647
456 Ga0495620_0347953
457 Ga0495637_0344912
458 Ga0495644_0250407
459 Ga0495663_0039172
460 Ga0495663_0280037
461 Ga0495642_0013039
462 Ga0495642_0147272
463 Ga0495654_0300326
464 Ga0495598_0078767
465 Ga0495609_0110805
466 Ga0495609_0161168
467 Ga0495621_0019702
468 Ga0495621_0070960
469 Ga0495611_0129172
470 Ga0495635_0285574
471 Ga0495659_0060741
472 Ga0495658_0065234
473 Ga0495669_0220021
474 Ga0495670_0060551
475 Ga0495670_0357261
476 Ga0495600_0516431
477 Ga0495636_0153929
478 Ga0495636_0503394
479 Ga0495636_0684669
480 Ga0495674_0574674
481 Ga0495676_0319839
482 Ga0495680_0204660
483 Ga0495677_0139448
484 Ga0496100_0007714
485 Ga0496101_0197201
486 Ga0496103_0067473
487 Ga0496104_0024581
488 Ga0496105_0001378
489 Ga0496105_1160121
490 Ga0496106_0007242
491 Ga0496107_0003801
492 Ga0496108_0637982
493 Ga0496110_0954370
494 Ga0496111_0049977
495 Ga0496111_0117288
496 Ga0496114_0223133
497 Ga0496114_0457128
498 Ga0496115_0619644
499 Ga0501032_0084921
500 Ga0501038_0564945
501 Ga0501041_0035087
502 Ga0501041_0757707
503 Ga0501042_0017545
504 Ga0501048_0032923
505 Ga0501067_0004329
506 Ga0501067_0056487
507 Ga0501068_0075246
508 Ga0501069_0014678
509 Ga0501069_0031518
510 Ga0501069_0993463
511 Ga0501070_0136490
512 Ga0501071_0028506
513 Ga0501071_0207238
514 Ga0501072_0159888
515 Ga0501075_0048452
516 Ga0501075_0606496
517 Ga0501075_0777192
518 Ga0501076_0093807
519 Ga0501079_0372723
520 Ga0501081_0194912
521 Ga0501035_1057720
522 nmdc:mga00v17_69397_c1
523 nmdc:mga0yw44_190006_c1
524 nmdc:mga0k408_427377_c1
525 nmdc:mga05p37_1006598_c1
526 nmdc:mga05p37_165691_c1
527 nmdc:mga05p37_87322_c1
528 nmdc:mga09592_112512_c1
529 nmdc:mga09592_405224_c1
530 nmdc:mga0qj67_91873_c1
531 nmdc:mga06r32_1189101_c1
532 nmdc:mga06r32_157468_c1
533 nmdc:mga06r32_256996_c1
534 nmdc:mga06r32_454941_c1
535 nmdc:mga06r32_797772_c1
536 nmdc:mga08y16_151933_c1
537 nmdc:mga08y16_469939_c1
538 nmdc:mga0n895_24861_c1
539 nmdc:mga0n895_640688_c1
540 nmdc:mga0rr50_1267_c1
541 nmdc:mga0rr50_904297_c1
542 nmdc:mga08x19_137711_c1
543 nmdc:mga08x19_587995_c1
544 Ga0495655_0199379
545 Ga0495595_0343657
546 Ga0495619_1095189
547 Ga0501082_0921323
548 Ga0501082_1232407
549 Ga0530510_0048895
550 Ga0530510_0749518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00576

Transthyretin

HIUase/Transthyretin family

9

118

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2flm-assembly1.cif.gz_B-2 human transthyretin (ttr) complexed with bivalant amyloid inhibitor (6 carbon linker) 0.9358 8 99
5cr1-assembly1.cif.gz_B-2 crystal structure of ttr/resveratrol/t4 complex 0.9344 8 99
3gs4-assembly1.cif.gz_B human transthyretin (ttr) complexed with 3-(9h-fluoren-9-ylideneaminooxy)propanoic acid (inhibitor 15) 0.9342 8 99
4hiq-assembly1.cif.gz_B-2 the structure of v122i mutant transthyretin in complex with ag10 0.9339 8 99
6imy-assembly1.cif.gz_B-2 crystal structure of v30m mutated transthyretin in complex with 4'-caroboxybenzo-18-crown-6 0.9337 8 99
ID Description Score Start End Superfamily
2gpzC00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9223 7 100 2.60.40.180
af_O44578_18_134_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9139 7 98 2.60.40.180
3qvaD00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9127 7 100 2.60.40.180
af_A1Z8C9_1_111_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9044 5 98 2.60.40.180
2qpfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9031 8 99 2.60.40.180
ID Description Score Start End GO Terms
AF-A0A7V9UZ10-F1-model_v4 Hydroxyisourate hydrolase 0.9982 6 100 GO:0006144
GO:0016787
AF-A0A538DYX6-F1-model_v4 Hydroxyisourate hydrolase 0.9962 5 100 GO:0006144
GO:0016787
AF-A0A538ITE4-F1-model_v4 Hydroxyisourate hydrolase 0.9876 5 100 GO:0006144
GO:0016787
AF-A0A7V9UZ10-F1-model_v4 Hydroxyisourate hydrolase 0.9777 6 100 GO:0006144
GO:0016787
AF-A0A538GA99-F1-model_v4 Hydroxyisourate hydrolase 0.9763 4 76 GO:0016787

Map