F380053
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 196 | 548 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300053125|Ga0500618_001518|Ga0500618_001518_5643_6914 |
| Length | 423 |
| Sequence | MDAFVMARTSQPPMILTLNSGSSSLKFGVYRFDDATPAEGDGGGXXDAGIDKRHLLVEGSATGIGTPNGALRIRSSDGRVDVHIDHLAESQTDALKKIGAVLHEHGYGTPDAVGHRIVHGGPNLTTHQRLTDDVRRHLHDAVHFAPLHIPAALALIDKATTIFDKAEHFVCFDTAFHQTMPPRAATLPIPARYAAHGVRRYGFHGLSYESLVSRLGAALPERMVFAHLGNGSSLCAVHEGKSIDTSMGLTPTGGIPMSTRSGDLDPGVLLYMMRADQQDADGLEKMLNRDSGLRGLMSHDGHDGGAGDMQVLLEKSIEGDQDAALAVDVFVTSIRKQIGAYAALMGGLDCIVFTGGIGEHSAEIRKRICSGLAFMGVVVDGGEDADDKTAVNAGASAVPGKVHVMNAAEEWQIAVHCHDLYRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 23 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 24 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 25 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 28 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 38 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 39 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 40 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 41 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 49 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 67 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 68 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 69 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 70 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 71 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 72 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 73 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 74 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 75 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 76 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 77 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 78 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 79 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 80 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 81 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 82 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 83 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 84 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 85 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 144 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 145 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 146 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 147 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 148 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 149 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 150 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 151 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 154 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 155 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 156 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 157 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 158 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 159 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 160 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 168 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 169 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 170 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 171 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 172 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 173 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 174 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 175 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 176 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 177 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 178 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 179 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 180 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 181 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 182 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 183 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 184 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 185 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 186 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 187 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 188 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 189 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 190 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 191 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 192 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 193 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 194 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 195 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 196 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.78 |
| Metatranscriptomes | 0.36 |
| Isolates | 9.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.39 |
| Nodule | 3.65 |
| Rhizoplane | 5.47 |
| Rhizosphere | 67.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500618_001518 | 3300053125 | Bacteria | 10218 |
| 2 | LJNas_1001032 | 3300000546 | Bacteria | 4413 |
| 3 | JGI24740J21852_10007147 | 3300001979 | Bacteria | 4561 |
| 4 | JGI24739J22299_10005482 | 3300001989 | Bacteria | 4817 |
| 5 | JGI24735J21928_10015134 | 3300002067 | Bacteria | 2410 |
| 6 | JGI24738J21930_10003579 | 3300002075 | Bacteria | 3897 |
| 7 | JGI25156J39149_1000424 | 3300002705 | Bacteria | 26249 |
| 8 | JGI25156J39149_1000438 | 3300002705 | Bacteria | 25648 |
| 9 | JGI25156J39149_1000595 | 3300002705 | Bacteria | 20109 |
| 10 | JGI25165J46597_1000842 | 3300003214 | Bacteria | 22522 |
| 11 | Ga0055533_1000088 | 3300003756 | Bacteria | 122346 |
| 12 | Ga0055533_1000934 | 3300003756 | Bacteria | 8673 |
| 13 | Ga0055532_1000036 | 3300003758 | Bacteria | 208233 |
| 14 | Ga0055527_1000022 | 3300003760 | Bacteria | 208676 |
| 15 | Ga0055535_1000026 | 3300003761 | Bacteria | 208676 |
| 16 | Ga0055542_1000042 | 3300003762 | Bacteria | 208676 |
| 17 | Ga0055529_1000048 | 3300003763 | Bacteria | 208676 |
| 18 | Ga0070658_10038733 | 3300005327 | Bacteria | 3844 |
| 19 | Ga0070708_100005581 | 3300005445 | Bacteria | 9969 |
| 20 | Ga0070708_100037624 | 3300005445 | Bacteria | 4223 |
| 21 | Ga0070706_100003243 | 3300005467 | Bacteria | 16072 |
| 22 | Ga0070706_100036408 | 3300005467 | Bacteria | 4545 |
| 23 | Ga0070707_100006289 | 3300005468 | Bacteria | 11044 |
| 24 | Ga0070707_100216402 | 3300005468 | Bacteria | 1867 |
| 25 | Ga0070698_100031971 | 3300005471 | Bacteria | 5453 |
| 26 | Ga0070698_100127754 | 3300005471 | Bacteria | 2499 |
| 27 | Ga0070699_100002858 | 3300005518 | Bacteria | 15397 |
| 28 | Ga0070697_100000079 | 3300005536 | Bacteria | 77838 |
| 29 | Ga0070697_100029522 | 3300005536 | Bacteria | 4397 |
| 30 | Ga0068861_100171585 | 3300005719 | Bacteria | 1798 |
| 31 | Ga0068858_100001652 | 3300005842 | Bacteria | 22782 |
| 32 | Ga0068858_100078759 | 3300005842 | Bacteria | 3062 |
| 33 | Ga0081540_1062703 | 3300005983 | Bacteria | 1764 |
| 34 | Ga0070717_10143847 | 3300006028 | Unclassified | 2058 |
| 35 | Ga0070716_100005948 | 3300006173 | Bacteria | 5935 |
| 36 | Ga0075430_100056198 | 3300006846 | Bacteria | 3309 |
| 37 | Ga0105251_10000153 | 3300009011 | Bacteria | 70284 |
| 38 | Ga0105240_10370145 | 3300009093 | Bacteria | 1620 |
| 39 | Ga0105237_10124430 | 3300009545 | Bacteria | 2573 |
| 40 | Ga0105238_10065524 | 3300009551 | Bacteria | 3634 |
| 41 | Ga0105239_10078719 | 3300010375 | Bacteria | 3627 |
| 42 | Ga0157369_10101579 | 3300013105 | Bacteria | 3065 |
| 43 | Ga0163162_10003159 | 3300013306 | Bacteria | 15737 |
| 44 | Ga0157372_10055354 | 3300013307 | Bacteria | 4430 |
| 45 | Ga0157375_10001416 | 3300013308 | Bacteria | 20626 |
| 46 | Ga0157375_10103253 | 3300013308 | Bacteria | 2937 |
| 47 | Ga0182006_1023651 | 3300015261 | Bacteria | 2543 |
| 48 | Ga0182007_10003457 | 3300015262 | Bacteria | 7440 |
| 49 | Ga0213876_10002347 | 3300021384 | Bacteria | 11155 |
| 50 | Ga0224572_1003377 | 3300024225 | Bacteria | 2689 |
| 51 | Ga0209674_100011 | 3300025226 | Bacteria | 997175 |
| 52 | Ga0209674_100048 | 3300025226 | Bacteria | 353032 |
| 53 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 54 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 55 | Ga0209563_100374 | 3300025230 | Bacteria | 16384 |
| 56 | Ga0207427_101255 | 3300025231 | Bacteria | 9729 |
| 57 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 58 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 59 | Ga0209759_1000002 | 3300025256 | Bacteria | 1027596 |
| 60 | Ga0209759_1000009 | 3300025256 | Bacteria | 446623 |
| 61 | Ga0209759_1000032 | 3300025256 | Bacteria | 278697 |
| 62 | Ga0209759_1018785 | 3300025256 | Bacteria | 1662 |
| 63 | Ga0209233_1000033 | 3300025261 | Bacteria | 596094 |
| 64 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 65 | Ga0209455_1000556 | 3300025272 | Bacteria | 25238 |
| 66 | Ga0207713_1000189 | 3300025735 | Bacteria | 86382 |
| 67 | Ga0207647_10020611 | 3300025904 | Bacteria | 4417 |
| 68 | Ga0207647_10100746 | 3300025904 | Bacteria | 1714 |
| 69 | Ga0207699_10064952 | 3300025906 | Bacteria | 2210 |
| 70 | Ga0207699_10206733 | 3300025906 | Bacteria | 1333 |
| 71 | Ga0207684_10000528 | 3300025910 | Bacteria | 47296 |
| 72 | Ga0207684_10000613 | 3300025910 | Bacteria | 42494 |
| 73 | Ga0207684_10002553 | 3300025910 | Bacteria | 18283 |
| 74 | Ga0207663_10016689 | 3300025916 | Bacteria | 4078 |
| 75 | Ga0207646_10001671 | 3300025922 | Bacteria | 27085 |
| 76 | Ga0207694_10002325 | 3300025924 | Bacteria | 15539 |
| 77 | Ga0207664_10034936 | 3300025929 | Bacteria | 3875 |
| 78 | Ga0207665_10070206 | 3300025939 | Unclassified | 2390 |
| 79 | Ga0207689_10002133 | 3300025942 | Bacteria | 18617 |
| 80 | Ga0207677_10196264 | 3300026023 | Bacteria | 1600 |
| 81 | Ga0207703_10009376 | 3300026035 | Bacteria | 7693 |
| 82 | Ga0207703_10126026 | 3300026035 | Bacteria | 2205 |
| 83 | Ga0207678_10142540 | 3300026067 | Bacteria | 2045 |
| 84 | Ga0207675_100090657 | 3300026118 | Bacteria | 2874 |
| 85 | Ga0209371_1011422 | 3300027312 | Bacteria | 2638 |
| 86 | Ga0265338_10001332 | 3300028800 | Bacteria | 40295 |
| 87 | Ga0268256_1014177 | 3300030500 | Bacteria | 2379 |
| 88 | Ga0265760_10018210 | 3300031090 | Bacteria | 2021 |
| 89 | Ga0265330_10014817 | 3300031235 | Bacteria | 3616 |
| 90 | Ga0265330_10030647 | 3300031235 | Bacteria | 2414 |
| 91 | Ga0265332_10023433 | 3300031238 | Bacteria | 2722 |
| 92 | Ga0307508_10000045 | 3300031616 | Bacteria | 142824 |
| 93 | Ga0265314_10101293 | 3300031711 | Bacteria | 1851 |
| 94 | Ga0265342_10064029 | 3300031712 | Bacteria | 2159 |
| 95 | Ga0307412_10000015 | 3300031911 | Bacteria | 333589 |
| 96 | Ga0307412_10011475 | 3300031911 | Bacteria | 5136 |
| 97 | Ga0307411_10027948 | 3300032005 | Bacteria | 3422 |
| 98 | Ga0307510_10053385 | 3300033180 | Bacteria | 4249 |
| 99 | Ga0373935_0035422 | 3300035692 | Bacteria | 3115 |
| 100 | Ga0373927_0035781 | 3300035695 | Bacteria | 3229 |
| 101 | Ga0373925_0005961 | 3300037068 | Bacteria | 9030 |
| 102 | Ga0395905_0077639 | 3300037471 | Unclassified | 3112 |
| 103 | Ga0436364_0462076 | 3300037853 | Bacteria | 12982 |
| 104 | Ga0436365_1530220 | 3300039437 | Bacteria | 21377 |
| 105 | Ga0436363_0227802 | 3300039450 | Bacteria | 1409 |
| 106 | Ga0436363_1547126 | 3300039450 | Bacteria | 2446 |
| 107 | Ga0436362_1018893 | 3300039453 | Bacteria | 2622 |
| 108 | Ga0495592_0000939 | 3300046454 | Bacteria | 20267 |
| 109 | Ga0495592_0009978 | 3300046454 | Bacteria | 7150 |
| 110 | Ga0495592_0116596 | 3300046454 | Bacteria | 1884 |
| 111 | Ga0495603_0025390 | 3300046455 | Bacteria | 3583 |
| 112 | Ga0495629_0000036 | 3300046459 | Bacteria | 117795 |
| 113 | Ga0495629_0001310 | 3300046459 | Bacteria | 19583 |
| 114 | Ga0495651_0006710 | 3300046462 | Bacteria | 8797 |
| 115 | Ga0495653_0000490 | 3300046463 | Bacteria | 30564 |
| 116 | Ga0495650_0005761 | 3300046471 | Bacteria | 7910 |
| 117 | Ga0495650_0006536 | 3300046471 | Bacteria | 7244 |
| 118 | Ga0495650_0016668 | 3300046471 | Bacteria | 3711 |
| 119 | Ga0495580_0000081 | 3300046472 | Bacteria | 61240 |
| 120 | Ga0495580_0006376 | 3300046472 | Bacteria | 9624 |
| 121 | Ga0495582_0007600 | 3300046473 | Bacteria | 5997 |
| 122 | Ga0495582_0009799 | 3300046473 | Bacteria | 5278 |
| 123 | Ga0495605_0013577 | 3300046474 | Bacteria | 4483 |
| 124 | Ga0495662_0012328 | 3300046476 | Bacteria | 4171 |
| 125 | Ga0495664_0017642 | 3300046477 | Bacteria | 4082 |
| 126 | Ga0495596_0002480 | 3300046500 | Bacteria | 9896 |
| 127 | Ga0495596_0029008 | 3300046500 | Bacteria | 2220 |
| 128 | Ga0495606_0029079 | 3300046507 | Bacteria | 3887 |
| 129 | Ga0495608_0002054 | 3300046511 | Bacteria | 14479 |
| 130 | Ga0495610_0000917 | 3300046512 | Bacteria | 27377 |
| 131 | Ga0495618_0012738 | 3300046514 | Bacteria | 5111 |
| 132 | Ga0495628_0004460 | 3300046516 | Bacteria | 12414 |
| 133 | Ga0495628_0068049 | 3300046516 | Bacteria | 2779 |
| 134 | Ga0495628_0137549 | 3300046516 | Bacteria | 1866 |
| 135 | Ga0495628_0219920 | 3300046516 | Bacteria | 1426 |
| 136 | Ga0495630_0006484 | 3300046517 | Bacteria | 8330 |
| 137 | Ga0495630_0028439 | 3300046517 | Bacteria | 4153 |
| 138 | Ga0495630_0089408 | 3300046517 | Bacteria | 2326 |
| 139 | Ga0495648_0012563 | 3300046524 | Bacteria | 6305 |
| 140 | Ga0495666_0006218 | 3300046526 | Bacteria | 6012 |
| 141 | Ga0495666_0015803 | 3300046526 | Bacteria | 3761 |
| 142 | Ga0495666_0026402 | 3300046526 | Bacteria | 2862 |
| 143 | Ga0495666_0126028 | 3300046526 | Bacteria | 1197 |
| 144 | Ga0495652_0035873 | 3300046529 | Bacteria | 4314 |
| 145 | Ga0495652_0051210 | 3300046529 | Bacteria | 3527 |
| 146 | Ga0495665_0004207 | 3300046531 | Bacteria | 7768 |
| 147 | Ga0495665_0009761 | 3300046531 | Bacteria | 5197 |
| 148 | Ga0495640_0007297 | 3300046533 | Bacteria | 8709 |
| 149 | Ga0495586_0008987 | 3300046535 | Bacteria | 5317 |
| 150 | Ga0495587_0027810 | 3300046536 | Bacteria | 3442 |
| 151 | Ga0495621_0010488 | 3300046539 | Bacteria | 2837 |
| 152 | Ga0495645_0045454 | 3300046543 | Bacteria | 3204 |
| 153 | Ga0495622_0000233 | 3300046557 | Bacteria | 43922 |
| 154 | Ga0495634_0008627 | 3300046642 | Bacteria | 7565 |
| 155 | Ga0495634_0078820 | 3300046642 | Bacteria | 2157 |
| 156 | Ga0495611_0009192 | 3300046648 | Bacteria | 4172 |
| 157 | Ga0495635_0010220 | 3300046663 | Bacteria | 6563 |
| 158 | Ga0495635_0011888 | 3300046663 | Bacteria | 6102 |
| 159 | Ga0495599_0005932 | 3300046678 | Bacteria | 7346 |
| 160 | Ga0495599_0009339 | 3300046678 | Bacteria | 5990 |
| 161 | Ga0495599_0038740 | 3300046678 | Bacteria | 2995 |
| 162 | Ga0495623_0003297 | 3300046679 | Bacteria | 10661 |
| 163 | Ga0495623_0017222 | 3300046679 | Bacteria | 4667 |
| 164 | Ga0495623_0132536 | 3300046679 | Bacteria | 1490 |
| 165 | Ga0495646_0009621 | 3300046680 | Bacteria | 6135 |
| 166 | Ga0495646_0041555 | 3300046680 | Bacteria | 2824 |
| 167 | Ga0495658_0015631 | 3300046683 | Bacteria | 3895 |
| 168 | Ga0495669_0039948 | 3300046684 | Bacteria | 2079 |
| 169 | Ga0495613_0014969 | 3300046689 | Bacteria | 5757 |
| 170 | Ga0495624_0000291 | 3300046690 | Bacteria | 39781 |
| 171 | Ga0495624_0002539 | 3300046690 | Bacteria | 13825 |
| 172 | Ga0495624_0038907 | 3300046690 | Bacteria | 3052 |
| 173 | Ga0495624_0127171 | 3300046690 | Bacteria | 1563 |
| 174 | Ga0495671_0017759 | 3300046692 | Bacteria | 3784 |
| 175 | Ga0495649_0007438 | 3300046694 | Bacteria | 6672 |
| 176 | Ga0495649_0040855 | 3300046694 | Bacteria | 2537 |
| 177 | Ga0495600_0011804 | 3300046809 | Bacteria | 5454 |
| 178 | Ga0495660_0083694 | 3300046810 | Bacteria | 1669 |
| 179 | Ga0495581_0005188 | 3300047315 | Bacteria | 7537 |
| 180 | Ga0495604_0010019 | 3300047317 | Bacteria | 7504 |
| 181 | Ga0495604_0078594 | 3300047317 | Bacteria | 2475 |
| 182 | Ga0495674_0003405 | 3300047319 | Bacteria | 15455 |
| 183 | Ga0495674_0085296 | 3300047319 | Bacteria | 2705 |
| 184 | Ga0495674_0164410 | 3300047319 | Bacteria | 1855 |
| 185 | Ga0495674_0167284 | 3300047319 | Bacteria | 1836 |
| 186 | Ga0495676_0012132 | 3300047321 | Bacteria | 7773 |
| 187 | Ga0495676_0049812 | 3300047321 | Bacteria | 3364 |
| 188 | Ga0495680_0015136 | 3300047322 | Bacteria | 6661 |
| 189 | Ga0495680_0016352 | 3300047322 | Bacteria | 6377 |
| 190 | Ga0495680_0035257 | 3300047322 | Bacteria | 4031 |
| 191 | Ga0495683_0003533 | 3300047323 | Bacteria | 9097 |
| 192 | Ga0495683_0014281 | 3300047323 | Bacteria | 4137 |
| 193 | Ga0495683_0102276 | 3300047323 | Bacteria | 1376 |
| 194 | Ga0495683_0106420 | 3300047323 | Bacteria | 1343 |
| 195 | Ga0495687_004245 | 3300047443 | Bacteria | 9823 |
| 196 | Ga0495675_0000521 | 3300047444 | Bacteria | 24971 |
| 197 | Ga0495675_0014652 | 3300047444 | Bacteria | 4954 |
| 198 | Ga0495679_000013 | 3300047446 | Bacteria | 313222 |
| 199 | Ga0495679_013669 | 3300047446 | Bacteria | 3035 |
| 200 | Ga0495673_0009244 | 3300047469 | Bacteria | 5469 |
| 201 | Ga0495684_0225144 | 3300047471 | Bacteria | 1374 |
| 202 | Ga0495593_0015280 | 3300047673 | Bacteria | 4351 |
| 203 | Ga0495593_0016422 | 3300047673 | Bacteria | 4176 |
| 204 | Ga0495593_0049019 | 3300047673 | Bacteria | 2242 |
| 205 | Ga0495602_0112775 | 3300048088 | Bacteria | 2205 |
| 206 | Ga0495614_0037331 | 3300048089 | Bacteria | 2084 |
| 207 | Ga0495626_0028964 | 3300048091 | Bacteria | 2682 |
| 208 | Ga0496101_0034314 | 3300048904 | Bacteria | 3583 |
| 209 | Ga0496102_0205458 | 3300048905 | Bacteria | 1857 |
| 210 | Ga0496103_0003130 | 3300048906 | Bacteria | 10177 |
| 211 | Ga0496104_0000042 | 3300048907 | Bacteria | 155859 |
| 212 | Ga0496104_0008453 | 3300048907 | Bacteria | 9152 |
| 213 | Ga0496105_0000046 | 3300048908 | Bacteria | 101134 |
| 214 | Ga0496105_0003021 | 3300048908 | Bacteria | 12362 |
| 215 | Ga0496105_0024583 | 3300048908 | Bacteria | 4895 |
| 216 | Ga0496110_0008479 | 3300048913 | Bacteria | 8275 |
| 217 | Ga0496111_0042679 | 3300048914 | Bacteria | 3257 |
| 218 | Ga0496112_0035092 | 3300048915 | Bacteria | 4881 |
| 219 | Ga0496113_0043450 | 3300048916 | Bacteria | 3326 |
| 220 | Ga0496114_0017262 | 3300048917 | Bacteria | 5823 |
| 221 | Ga0496115_0104584 | 3300048918 | Bacteria | 2323 |
| 222 | Ga0496117_0002438 | 3300048920 | Bacteria | 23455 |
| 223 | Ga0496117_0079085 | 3300048920 | Bacteria | 2168 |
| 224 | Ga0496118_0000387 | 3300048921 | Bacteria | 74400 |
| 225 | Ga0496118_0002230 | 3300048921 | Bacteria | 26735 |
| 226 | Ga0496118_0034046 | 3300048921 | Bacteria | 4166 |
| 227 | Ga0496119_0000343 | 3300048922 | Bacteria | 65175 |
| 228 | Ga0496121_0001003 | 3300048924 | Bacteria | 50494 |
| 229 | Ga0496121_0010979 | 3300048924 | Bacteria | 10114 |
| 230 | Ga0496122_0079228 | 3300048925 | Bacteria | 2297 |
| 231 | Ga0496125_0090967 | 3300048928 | Bacteria | 2288 |
| 232 | Ga0496126_0000191 | 3300048929 | Bacteria | 137108 |
| 233 | Ga0496126_0000239 | 3300048929 | Bacteria | 118024 |
| 234 | Ga0496126_0003418 | 3300048929 | Bacteria | 20062 |
| 235 | Ga0496126_0011238 | 3300048929 | Bacteria | 9289 |
| 236 | Ga0496126_0019186 | 3300048929 | Bacteria | 6742 |
| 237 | Ga0496126_0047433 | 3300048929 | Bacteria | 3933 |
| 238 | Ga0495678_003693 | 3300049459 | Bacteria | 9264 |
| 239 | Ga0501033_0018909 | 3300049570 | Bacteria | 5208 |
| 240 | Ga0501039_0138533 | 3300049575 | Bacteria | 1911 |
| 241 | Ga0501043_0123885 | 3300049579 | Bacteria | 2027 |
| 242 | Ga0501047_0014307 | 3300049581 | Bacteria | 7546 |
| 243 | Ga0501035_0002546 | 3300049822 | Bacteria | 17826 |
| 244 | Ga0501044_0002569 | 3300049823 | Bacteria | 20676 |
| 245 | Ga0500635_0006919 | 3300053080 | Bacteria | 3051 |
| 246 | Ga0500554_009738 | 3300053102 | Bacteria | 2312 |
| 247 | Ga0500590_105106 | 3300053148 | Bacteria | 1349 |
| 248 | 2509132326 | 2508501125 | Bacteria | 7208311 |
| 249 | 2510249369 | 2510065045 | Bacteria | 7761063 |
| 250 | 2513958971 | 2513237151 | Bacteria | 6309801 |
| 251 | 2527076250 | 2526164713 | Bacteria | 6780608 |
| 252 | 2719642222 | 2718217991 | Bacteria | 7829542 |
| 253 | 2738822872 | 2738541296 | Bacteria | 7285013 |
| 254 | 2738835079 | 2738541298 | Bacteria | 7286732 |
| 255 | 2738876558 | 2738541306 | Bacteria | 7284992 |
| 256 | 2739188502 | 2738543002 | Bacteria | 7284546 |
| 257 | 2739223154 | 2738543008 | Bacteria | 7282815 |
| 258 | 2819621595 | 2818991450 | Bacteria | 6962147 |
| 259 | 2842332628 | 2842324504 | Bacteria | 9364110 |
| 260 | 2842355959 | 2842348783 | Bacteria | 9002918 |
| 261 | 2842460985 | 2842454564 | Bacteria | 8730687 |
| 262 | 2885277505 | 2885270888 | Bacteria | 9831543 |
| 263 | 2900640910 | 2900634093 | Bacteria | 10263517 |
| 264 | 2904486131 | 2904483920 | Bacteria | 7545285 |
| 265 | 2919527470 | 2919527303 | Bacteria | 7718827 |
| 266 | 2928112125 | 2928108538 | Bacteria | 7360024 |
| 267 | 2928139331 | 2928135762 | Bacteria | 7259641 |
| 268 | 2928508590 | 2928503688 | Bacteria | 7268108 |
| 269 | 2945939139 | 2945934425 | Bacteria | 7444609 |
| 270 | 2990709142 | 2990703756 | Bacteria | 7715990 |
| 271 | 642421372 | 641736151 | Bacteria | 7477263 |
| 272 | 642616358 | 642555113 | Bacteria | 8214658 |
| 273 | 8055269801 | 8055266321 | Bacteria | 7999742 |
| 274 | 8055305881 | 8055301274 | Bacteria | 8587385 |
| 275 | Ga0500618_001518 | |||
| 276 | LJNas_1001032 | |||
| 277 | JGI24740J21852_10007147 | |||
| 278 | JGI24739J22299_10005482 | |||
| 279 | JGI24735J21928_10015134 | |||
| 280 | JGI24738J21930_10003579 | |||
| 281 | JGI25156J39149_1000424 | |||
| 282 | JGI25156J39149_1000438 | |||
| 283 | JGI25156J39149_1000595 | |||
| 284 | JGI25165J46597_1000842 | |||
| 285 | Ga0055533_1000088 | |||
| 286 | Ga0055533_1000934 | |||
| 287 | Ga0055532_1000036 | |||
| 288 | Ga0055527_1000022 | |||
| 289 | Ga0055535_1000026 | |||
| 290 | Ga0055542_1000042 | |||
| 291 | Ga0055529_1000048 | |||
| 292 | Ga0070658_10038733 | |||
| 293 | Ga0070708_100005581 | |||
| 294 | Ga0070708_100037624 | |||
| 295 | Ga0070706_100003243 | |||
| 296 | Ga0070706_100036408 | |||
| 297 | Ga0070707_100006289 | |||
| 298 | Ga0070707_100216402 | |||
| 299 | Ga0070698_100031971 | |||
| 300 | Ga0070698_100127754 | |||
| 301 | Ga0070699_100002858 | |||
| 302 | Ga0070697_100000079 | |||
| 303 | Ga0070697_100029522 | |||
| 304 | Ga0068861_100171585 | |||
| 305 | Ga0068858_100001652 | |||
| 306 | Ga0068858_100078759 | |||
| 307 | Ga0081540_1062703 | |||
| 308 | Ga0070717_10143847 | |||
| 309 | Ga0070716_100005948 | |||
| 310 | Ga0075430_100056198 | |||
| 311 | Ga0105251_10000153 | |||
| 312 | Ga0105240_10370145 | |||
| 313 | Ga0105237_10124430 | |||
| 314 | Ga0105238_10065524 | |||
| 315 | Ga0105239_10078719 | |||
| 316 | Ga0157369_10101579 | |||
| 317 | Ga0163162_10003159 | |||
| 318 | Ga0157372_10055354 | |||
| 319 | Ga0157375_10001416 | |||
| 320 | Ga0157375_10103253 | |||
| 321 | Ga0182006_1023651 | |||
| 322 | Ga0182007_10003457 | |||
| 323 | Ga0213876_10002347 | |||
| 324 | Ga0224572_1003377 | |||
| 325 | Ga0209674_100011 | |||
| 326 | Ga0209674_100048 | |||
| 327 | Ga0209672_100002 | |||
| 328 | Ga0209147_100003 | |||
| 329 | Ga0209563_100374 | |||
| 330 | Ga0207427_101255 | |||
| 331 | Ga0209258_100005 | |||
| 332 | Ga0209148_1000006 | |||
| 333 | Ga0209759_1000002 | |||
| 334 | Ga0209759_1000009 | |||
| 335 | Ga0209759_1000032 | |||
| 336 | Ga0209759_1018785 | |||
| 337 | Ga0209233_1000033 | |||
| 338 | Ga0209455_1000003 | |||
| 339 | Ga0209455_1000556 | |||
| 340 | Ga0207713_1000189 | |||
| 341 | Ga0207647_10020611 | |||
| 342 | Ga0207647_10100746 | |||
| 343 | Ga0207699_10064952 | |||
| 344 | Ga0207699_10206733 | |||
| 345 | Ga0207684_10000528 | |||
| 346 | Ga0207684_10000613 | |||
| 347 | Ga0207684_10002553 | |||
| 348 | Ga0207663_10016689 | |||
| 349 | Ga0207646_10001671 | |||
| 350 | Ga0207694_10002325 | |||
| 351 | Ga0207664_10034936 | |||
| 352 | Ga0207665_10070206 | |||
| 353 | Ga0207689_10002133 | |||
| 354 | Ga0207677_10196264 | |||
| 355 | Ga0207703_10009376 | |||
| 356 | Ga0207703_10126026 | |||
| 357 | Ga0207678_10142540 | |||
| 358 | Ga0207675_100090657 | |||
| 359 | Ga0209371_1011422 | |||
| 360 | Ga0265338_10001332 | |||
| 361 | Ga0268256_1014177 | |||
| 362 | Ga0265760_10018210 | |||
| 363 | Ga0265330_10014817 | |||
| 364 | Ga0265330_10030647 | |||
| 365 | Ga0265332_10023433 | |||
| 366 | Ga0307508_10000045 | |||
| 367 | Ga0265314_10101293 | |||
| 368 | Ga0265342_10064029 | |||
| 369 | Ga0307412_10000015 | |||
| 370 | Ga0307412_10011475 | |||
| 371 | Ga0307411_10027948 | |||
| 372 | Ga0307510_10053385 | |||
| 373 | Ga0373935_0035422 | |||
| 374 | Ga0373927_0035781 | |||
| 375 | Ga0373925_0005961 | |||
| 376 | Ga0395905_0077639 | |||
| 377 | Ga0436364_0462076 | |||
| 378 | Ga0436365_1530220 | |||
| 379 | Ga0436363_0227802 | |||
| 380 | Ga0436363_1547126 | |||
| 381 | Ga0436362_1018893 | |||
| 382 | Ga0495592_0000939 | |||
| 383 | Ga0495592_0009978 | |||
| 384 | Ga0495592_0116596 | |||
| 385 | Ga0495603_0025390 | |||
| 386 | Ga0495629_0000036 | |||
| 387 | Ga0495629_0001310 | |||
| 388 | Ga0495651_0006710 | |||
| 389 | Ga0495653_0000490 | |||
| 390 | Ga0495650_0005761 | |||
| 391 | Ga0495650_0006536 | |||
| 392 | Ga0495650_0016668 | |||
| 393 | Ga0495580_0000081 | |||
| 394 | Ga0495580_0006376 | |||
| 395 | Ga0495582_0007600 | |||
| 396 | Ga0495582_0009799 | |||
| 397 | Ga0495605_0013577 | |||
| 398 | Ga0495662_0012328 | |||
| 399 | Ga0495664_0017642 | |||
| 400 | Ga0495596_0002480 | |||
| 401 | Ga0495596_0029008 | |||
| 402 | Ga0495606_0029079 | |||
| 403 | Ga0495608_0002054 | |||
| 404 | Ga0495610_0000917 | |||
| 405 | Ga0495618_0012738 | |||
| 406 | Ga0495628_0004460 | |||
| 407 | Ga0495628_0068049 | |||
| 408 | Ga0495628_0137549 | |||
| 409 | Ga0495628_0219920 | |||
| 410 | Ga0495630_0006484 | |||
| 411 | Ga0495630_0028439 | |||
| 412 | Ga0495630_0089408 | |||
| 413 | Ga0495648_0012563 | |||
| 414 | Ga0495666_0006218 | |||
| 415 | Ga0495666_0015803 | |||
| 416 | Ga0495666_0026402 | |||
| 417 | Ga0495666_0126028 | |||
| 418 | Ga0495652_0035873 | |||
| 419 | Ga0495652_0051210 | |||
| 420 | Ga0495665_0004207 | |||
| 421 | Ga0495665_0009761 | |||
| 422 | Ga0495640_0007297 | |||
| 423 | Ga0495586_0008987 | |||
| 424 | Ga0495587_0027810 | |||
| 425 | Ga0495621_0010488 | |||
| 426 | Ga0495645_0045454 | |||
| 427 | Ga0495622_0000233 | |||
| 428 | Ga0495634_0008627 | |||
| 429 | Ga0495634_0078820 | |||
| 430 | Ga0495611_0009192 | |||
| 431 | Ga0495635_0010220 | |||
| 432 | Ga0495635_0011888 | |||
| 433 | Ga0495599_0005932 | |||
| 434 | Ga0495599_0009339 | |||
| 435 | Ga0495599_0038740 | |||
| 436 | Ga0495623_0003297 | |||
| 437 | Ga0495623_0017222 | |||
| 438 | Ga0495623_0132536 | |||
| 439 | Ga0495646_0009621 | |||
| 440 | Ga0495646_0041555 | |||
| 441 | Ga0495658_0015631 | |||
| 442 | Ga0495669_0039948 | |||
| 443 | Ga0495613_0014969 | |||
| 444 | Ga0495624_0000291 | |||
| 445 | Ga0495624_0002539 | |||
| 446 | Ga0495624_0038907 | |||
| 447 | Ga0495624_0127171 | |||
| 448 | Ga0495671_0017759 | |||
| 449 | Ga0495649_0007438 | |||
| 450 | Ga0495649_0040855 | |||
| 451 | Ga0495600_0011804 | |||
| 452 | Ga0495660_0083694 | |||
| 453 | Ga0495581_0005188 | |||
| 454 | Ga0495604_0010019 | |||
| 455 | Ga0495604_0078594 | |||
| 456 | Ga0495674_0003405 | |||
| 457 | Ga0495674_0085296 | |||
| 458 | Ga0495674_0164410 | |||
| 459 | Ga0495674_0167284 | |||
| 460 | Ga0495676_0012132 | |||
| 461 | Ga0495676_0049812 | |||
| 462 | Ga0495680_0015136 | |||
| 463 | Ga0495680_0016352 | |||
| 464 | Ga0495680_0035257 | |||
| 465 | Ga0495683_0003533 | |||
| 466 | Ga0495683_0014281 | |||
| 467 | Ga0495683_0102276 | |||
| 468 | Ga0495683_0106420 | |||
| 469 | Ga0495687_004245 | |||
| 470 | Ga0495675_0000521 | |||
| 471 | Ga0495675_0014652 | |||
| 472 | Ga0495679_000013 | |||
| 473 | Ga0495679_013669 | |||
| 474 | Ga0495673_0009244 | |||
| 475 | Ga0495684_0225144 | |||
| 476 | Ga0495593_0015280 | |||
| 477 | Ga0495593_0016422 | |||
| 478 | Ga0495593_0049019 | |||
| 479 | Ga0495602_0112775 | |||
| 480 | Ga0495614_0037331 | |||
| 481 | Ga0495626_0028964 | |||
| 482 | Ga0496101_0034314 | |||
| 483 | Ga0496102_0205458 | |||
| 484 | Ga0496103_0003130 | |||
| 485 | Ga0496104_0000042 | |||
| 486 | Ga0496104_0008453 | |||
| 487 | Ga0496105_0000046 | |||
| 488 | Ga0496105_0003021 | |||
| 489 | Ga0496105_0024583 | |||
| 490 | Ga0496110_0008479 | |||
| 491 | Ga0496111_0042679 | |||
| 492 | Ga0496112_0035092 | |||
| 493 | Ga0496113_0043450 | |||
| 494 | Ga0496114_0017262 | |||
| 495 | Ga0496115_0104584 | |||
| 496 | Ga0496117_0002438 | |||
| 497 | Ga0496117_0079085 | |||
| 498 | Ga0496118_0000387 | |||
| 499 | Ga0496118_0002230 | |||
| 500 | Ga0496118_0034046 | |||
| 501 | Ga0496119_0000343 | |||
| 502 | Ga0496121_0001003 | |||
| 503 | Ga0496121_0010979 | |||
| 504 | Ga0496122_0079228 | |||
| 505 | Ga0496125_0090967 | |||
| 506 | Ga0496126_0000191 | |||
| 507 | Ga0496126_0000239 | |||
| 508 | Ga0496126_0003418 | |||
| 509 | Ga0496126_0011238 | |||
| 510 | Ga0496126_0019186 | |||
| 511 | Ga0496126_0047433 | |||
| 512 | Ga0495678_003693 | |||
| 513 | Ga0501033_0018909 | |||
| 514 | Ga0501039_0138533 | |||
| 515 | Ga0501043_0123885 | |||
| 516 | Ga0501047_0014307 | |||
| 517 | Ga0501035_0002546 | |||
| 518 | Ga0501044_0002569 | |||
| 519 | Ga0500635_0006919 | |||
| 520 | Ga0500554_009738 | |||
| 521 | Ga0500590_105106 | |||
| 522 | 2509132326 | |||
| 523 | 2510249369 | |||
| 524 | 2513958971 | |||
| 525 | 2527076250 | |||
| 526 | 2719642222 | |||
| 527 | 2738822872 | |||
| 528 | 2738835079 | |||
| 529 | 2738876558 | |||
| 530 | 2739188502 | |||
| 531 | 2739223154 | |||
| 532 | 2819621595 | |||
| 533 | 2842332628 | |||
| 534 | 2842355959 | |||
| 535 | 2842460985 | |||
| 536 | 2885277505 | |||
| 537 | 2900640910 | |||
| 538 | 2904486131 | |||
| 539 | 2919527470 | |||
| 540 | 2928112125 | |||
| 541 | 2928139331 | |||
| 542 | 2928508590 | |||
| 543 | 2945939139 | |||
| 544 | 2990709142 | |||
| 545 | 642421372 | |||
| 546 | 642616358 | |||
| 547 | 8055269801 | |||
| 548 | 8055305881 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3khy-assembly1.cif.gz_B | crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 | 0.906 | 15 | 375 |
| 6ioy-assembly2.cif.gz_C | crystal structure of porphyromonas gingivalis acetate kinase | 0.8984 | 15 | 380 |
| 4ijn-assembly1.cif.gz_B | crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate | 0.8861 | 16 | 377 |
| 7fjb-assembly1.cif.gz_A | kpacka (pduw) with amppnp, sodium acetate complex structure | 0.8806 | 15 | 384 |
| 7fj7-assembly1.cif.gz_B | kpacka (pduw) native structure | 0.8782 | 15 | 384 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2iirA02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9359 | 208 | 381 | 3.30.420.40 |
| 1x3mA02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.934 | 207 | 380 | 3.30.420.40 |
| 4h0oB02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9012 | 207 | 382 | 3.30.420.40 |
| 3khyB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8756 | 16 | 206 | 3.30.420.40 |
| 4dq8B01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8718 | 16 | 206 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H4L0M5-F1-model_v4 | Acetate kinase (EC 2.7.2.1) (Acetokinase) | 0.9787 | 14 | 380 |
GO:0000287
GO:0005524 GO:0005737 GO:0006083 GO:0006085 GO:0008776 |
| AF-T0YVP5-F1-model_v4 | Acetate and butyrate kinase | 0.9695 | 210 | 345 |
GO:0005524
GO:0005829 GO:0006083 GO:0008776 |
| AF-R7MXD9-F1-model_v4 | butyrate kinase (EC 2.7.2.7) | 0.9692 | 208 | 336 |
GO:0005524
GO:0006083 GO:0008776 GO:0047761 |
| AF-A0A4R2S2N8-F1-model_v4 | Acetate kinase (EC 2.7.2.1) (Acetokinase) | 0.9683 | 15 | 380 |
GO:0000287
GO:0005524 GO:0005829 GO:0006083 GO:0006085 GO:0008776 |
| AF-A0A7V5YSR5-F1-model_v4 | Acetate kinase | 0.9668 | 211 | 383 |
GO:0000287
GO:0005524 GO:0005737 GO:0006083 GO:0006085 GO:0008776 |