F380053

General Info

Members Datasets Scaffolds Average Seq Length
274 196 548 383

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_001518|Ga0500618_001518_5643_6914
Length 423
Sequence MDAFVMARTSQPPMILTLNSGSSSLKFGVYRFDDATPAEGDGGGXXDAGIDKRHLLVEGSATGIGTPNGALRIRSSDGRVDVHIDHLAESQTDALKKIGAVLHEHGYGTPDAVGHRIVHGGPNLTTHQRLTDDVRRHLHDAVHFAPLHIPAALALIDKATTIFDKAEHFVCFDTAFHQTMPPRAATLPIPARYAAHGVRRYGFHGLSYESLVSRLGAALPERMVFAHLGNGSSLCAVHEGKSIDTSMGLTPTGGIPMSTRSGDLDPGVLLYMMRADQQDADGLEKMLNRDSGLRGLMSHDGHDGGAGDMQVLLEKSIEGDQDAALAVDVFVTSIRKQIGAYAALMGGLDCIVFTGGIGEHSAEIRKRICSGLAFMGVVVDGGEDADDKTAVNAGASAVPGKVHVMNAAEEWQIAVHCHDLYRA

Samples

Sample ID Description Type Environment
1 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
41 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
68 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
168 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
169 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
170 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
171 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
172 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
173 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
174 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
175 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
176 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
177 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
178 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
179 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
180 2818991450 Burkholderia sp. 604 Isolate Unclassified
181 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
182 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
183 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
184 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
185 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
186 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
187 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
188 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
189 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
190 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
191 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
192 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
193 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
194 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
195 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
196 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.78
Metatranscriptomes 0.36
Isolates 9.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.39
Nodule 3.65
Rhizoplane 5.47
Rhizosphere 67.15
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500618_001518 3300053125 Bacteria 10218
2 LJNas_1001032 3300000546 Bacteria 4413
3 JGI24740J21852_10007147 3300001979 Bacteria 4561
4 JGI24739J22299_10005482 3300001989 Bacteria 4817
5 JGI24735J21928_10015134 3300002067 Bacteria 2410
6 JGI24738J21930_10003579 3300002075 Bacteria 3897
7 JGI25156J39149_1000424 3300002705 Bacteria 26249
8 JGI25156J39149_1000438 3300002705 Bacteria 25648
9 JGI25156J39149_1000595 3300002705 Bacteria 20109
10 JGI25165J46597_1000842 3300003214 Bacteria 22522
11 Ga0055533_1000088 3300003756 Bacteria 122346
12 Ga0055533_1000934 3300003756 Bacteria 8673
13 Ga0055532_1000036 3300003758 Bacteria 208233
14 Ga0055527_1000022 3300003760 Bacteria 208676
15 Ga0055535_1000026 3300003761 Bacteria 208676
16 Ga0055542_1000042 3300003762 Bacteria 208676
17 Ga0055529_1000048 3300003763 Bacteria 208676
18 Ga0070658_10038733 3300005327 Bacteria 3844
19 Ga0070708_100005581 3300005445 Bacteria 9969
20 Ga0070708_100037624 3300005445 Bacteria 4223
21 Ga0070706_100003243 3300005467 Bacteria 16072
22 Ga0070706_100036408 3300005467 Bacteria 4545
23 Ga0070707_100006289 3300005468 Bacteria 11044
24 Ga0070707_100216402 3300005468 Bacteria 1867
25 Ga0070698_100031971 3300005471 Bacteria 5453
26 Ga0070698_100127754 3300005471 Bacteria 2499
27 Ga0070699_100002858 3300005518 Bacteria 15397
28 Ga0070697_100000079 3300005536 Bacteria 77838
29 Ga0070697_100029522 3300005536 Bacteria 4397
30 Ga0068861_100171585 3300005719 Bacteria 1798
31 Ga0068858_100001652 3300005842 Bacteria 22782
32 Ga0068858_100078759 3300005842 Bacteria 3062
33 Ga0081540_1062703 3300005983 Bacteria 1764
34 Ga0070717_10143847 3300006028 Unclassified 2058
35 Ga0070716_100005948 3300006173 Bacteria 5935
36 Ga0075430_100056198 3300006846 Bacteria 3309
37 Ga0105251_10000153 3300009011 Bacteria 70284
38 Ga0105240_10370145 3300009093 Bacteria 1620
39 Ga0105237_10124430 3300009545 Bacteria 2573
40 Ga0105238_10065524 3300009551 Bacteria 3634
41 Ga0105239_10078719 3300010375 Bacteria 3627
42 Ga0157369_10101579 3300013105 Bacteria 3065
43 Ga0163162_10003159 3300013306 Bacteria 15737
44 Ga0157372_10055354 3300013307 Bacteria 4430
45 Ga0157375_10001416 3300013308 Bacteria 20626
46 Ga0157375_10103253 3300013308 Bacteria 2937
47 Ga0182006_1023651 3300015261 Bacteria 2543
48 Ga0182007_10003457 3300015262 Bacteria 7440
49 Ga0213876_10002347 3300021384 Bacteria 11155
50 Ga0224572_1003377 3300024225 Bacteria 2689
51 Ga0209674_100011 3300025226 Bacteria 997175
52 Ga0209674_100048 3300025226 Bacteria 353032
53 Ga0209672_100002 3300025228 Bacteria 1733325
54 Ga0209147_100003 3300025229 Bacteria 1733325
55 Ga0209563_100374 3300025230 Bacteria 16384
56 Ga0207427_101255 3300025231 Bacteria 9729
57 Ga0209258_100005 3300025242 Bacteria 1087938
58 Ga0209148_1000006 3300025254 Bacteria 1733325
59 Ga0209759_1000002 3300025256 Bacteria 1027596
60 Ga0209759_1000009 3300025256 Bacteria 446623
61 Ga0209759_1000032 3300025256 Bacteria 278697
62 Ga0209759_1018785 3300025256 Bacteria 1662
63 Ga0209233_1000033 3300025261 Bacteria 596094
64 Ga0209455_1000003 3300025272 Bacteria 1471893
65 Ga0209455_1000556 3300025272 Bacteria 25238
66 Ga0207713_1000189 3300025735 Bacteria 86382
67 Ga0207647_10020611 3300025904 Bacteria 4417
68 Ga0207647_10100746 3300025904 Bacteria 1714
69 Ga0207699_10064952 3300025906 Bacteria 2210
70 Ga0207699_10206733 3300025906 Bacteria 1333
71 Ga0207684_10000528 3300025910 Bacteria 47296
72 Ga0207684_10000613 3300025910 Bacteria 42494
73 Ga0207684_10002553 3300025910 Bacteria 18283
74 Ga0207663_10016689 3300025916 Bacteria 4078
75 Ga0207646_10001671 3300025922 Bacteria 27085
76 Ga0207694_10002325 3300025924 Bacteria 15539
77 Ga0207664_10034936 3300025929 Bacteria 3875
78 Ga0207665_10070206 3300025939 Unclassified 2390
79 Ga0207689_10002133 3300025942 Bacteria 18617
80 Ga0207677_10196264 3300026023 Bacteria 1600
81 Ga0207703_10009376 3300026035 Bacteria 7693
82 Ga0207703_10126026 3300026035 Bacteria 2205
83 Ga0207678_10142540 3300026067 Bacteria 2045
84 Ga0207675_100090657 3300026118 Bacteria 2874
85 Ga0209371_1011422 3300027312 Bacteria 2638
86 Ga0265338_10001332 3300028800 Bacteria 40295
87 Ga0268256_1014177 3300030500 Bacteria 2379
88 Ga0265760_10018210 3300031090 Bacteria 2021
89 Ga0265330_10014817 3300031235 Bacteria 3616
90 Ga0265330_10030647 3300031235 Bacteria 2414
91 Ga0265332_10023433 3300031238 Bacteria 2722
92 Ga0307508_10000045 3300031616 Bacteria 142824
93 Ga0265314_10101293 3300031711 Bacteria 1851
94 Ga0265342_10064029 3300031712 Bacteria 2159
95 Ga0307412_10000015 3300031911 Bacteria 333589
96 Ga0307412_10011475 3300031911 Bacteria 5136
97 Ga0307411_10027948 3300032005 Bacteria 3422
98 Ga0307510_10053385 3300033180 Bacteria 4249
99 Ga0373935_0035422 3300035692 Bacteria 3115
100 Ga0373927_0035781 3300035695 Bacteria 3229
101 Ga0373925_0005961 3300037068 Bacteria 9030
102 Ga0395905_0077639 3300037471 Unclassified 3112
103 Ga0436364_0462076 3300037853 Bacteria 12982
104 Ga0436365_1530220 3300039437 Bacteria 21377
105 Ga0436363_0227802 3300039450 Bacteria 1409
106 Ga0436363_1547126 3300039450 Bacteria 2446
107 Ga0436362_1018893 3300039453 Bacteria 2622
108 Ga0495592_0000939 3300046454 Bacteria 20267
109 Ga0495592_0009978 3300046454 Bacteria 7150
110 Ga0495592_0116596 3300046454 Bacteria 1884
111 Ga0495603_0025390 3300046455 Bacteria 3583
112 Ga0495629_0000036 3300046459 Bacteria 117795
113 Ga0495629_0001310 3300046459 Bacteria 19583
114 Ga0495651_0006710 3300046462 Bacteria 8797
115 Ga0495653_0000490 3300046463 Bacteria 30564
116 Ga0495650_0005761 3300046471 Bacteria 7910
117 Ga0495650_0006536 3300046471 Bacteria 7244
118 Ga0495650_0016668 3300046471 Bacteria 3711
119 Ga0495580_0000081 3300046472 Bacteria 61240
120 Ga0495580_0006376 3300046472 Bacteria 9624
121 Ga0495582_0007600 3300046473 Bacteria 5997
122 Ga0495582_0009799 3300046473 Bacteria 5278
123 Ga0495605_0013577 3300046474 Bacteria 4483
124 Ga0495662_0012328 3300046476 Bacteria 4171
125 Ga0495664_0017642 3300046477 Bacteria 4082
126 Ga0495596_0002480 3300046500 Bacteria 9896
127 Ga0495596_0029008 3300046500 Bacteria 2220
128 Ga0495606_0029079 3300046507 Bacteria 3887
129 Ga0495608_0002054 3300046511 Bacteria 14479
130 Ga0495610_0000917 3300046512 Bacteria 27377
131 Ga0495618_0012738 3300046514 Bacteria 5111
132 Ga0495628_0004460 3300046516 Bacteria 12414
133 Ga0495628_0068049 3300046516 Bacteria 2779
134 Ga0495628_0137549 3300046516 Bacteria 1866
135 Ga0495628_0219920 3300046516 Bacteria 1426
136 Ga0495630_0006484 3300046517 Bacteria 8330
137 Ga0495630_0028439 3300046517 Bacteria 4153
138 Ga0495630_0089408 3300046517 Bacteria 2326
139 Ga0495648_0012563 3300046524 Bacteria 6305
140 Ga0495666_0006218 3300046526 Bacteria 6012
141 Ga0495666_0015803 3300046526 Bacteria 3761
142 Ga0495666_0026402 3300046526 Bacteria 2862
143 Ga0495666_0126028 3300046526 Bacteria 1197
144 Ga0495652_0035873 3300046529 Bacteria 4314
145 Ga0495652_0051210 3300046529 Bacteria 3527
146 Ga0495665_0004207 3300046531 Bacteria 7768
147 Ga0495665_0009761 3300046531 Bacteria 5197
148 Ga0495640_0007297 3300046533 Bacteria 8709
149 Ga0495586_0008987 3300046535 Bacteria 5317
150 Ga0495587_0027810 3300046536 Bacteria 3442
151 Ga0495621_0010488 3300046539 Bacteria 2837
152 Ga0495645_0045454 3300046543 Bacteria 3204
153 Ga0495622_0000233 3300046557 Bacteria 43922
154 Ga0495634_0008627 3300046642 Bacteria 7565
155 Ga0495634_0078820 3300046642 Bacteria 2157
156 Ga0495611_0009192 3300046648 Bacteria 4172
157 Ga0495635_0010220 3300046663 Bacteria 6563
158 Ga0495635_0011888 3300046663 Bacteria 6102
159 Ga0495599_0005932 3300046678 Bacteria 7346
160 Ga0495599_0009339 3300046678 Bacteria 5990
161 Ga0495599_0038740 3300046678 Bacteria 2995
162 Ga0495623_0003297 3300046679 Bacteria 10661
163 Ga0495623_0017222 3300046679 Bacteria 4667
164 Ga0495623_0132536 3300046679 Bacteria 1490
165 Ga0495646_0009621 3300046680 Bacteria 6135
166 Ga0495646_0041555 3300046680 Bacteria 2824
167 Ga0495658_0015631 3300046683 Bacteria 3895
168 Ga0495669_0039948 3300046684 Bacteria 2079
169 Ga0495613_0014969 3300046689 Bacteria 5757
170 Ga0495624_0000291 3300046690 Bacteria 39781
171 Ga0495624_0002539 3300046690 Bacteria 13825
172 Ga0495624_0038907 3300046690 Bacteria 3052
173 Ga0495624_0127171 3300046690 Bacteria 1563
174 Ga0495671_0017759 3300046692 Bacteria 3784
175 Ga0495649_0007438 3300046694 Bacteria 6672
176 Ga0495649_0040855 3300046694 Bacteria 2537
177 Ga0495600_0011804 3300046809 Bacteria 5454
178 Ga0495660_0083694 3300046810 Bacteria 1669
179 Ga0495581_0005188 3300047315 Bacteria 7537
180 Ga0495604_0010019 3300047317 Bacteria 7504
181 Ga0495604_0078594 3300047317 Bacteria 2475
182 Ga0495674_0003405 3300047319 Bacteria 15455
183 Ga0495674_0085296 3300047319 Bacteria 2705
184 Ga0495674_0164410 3300047319 Bacteria 1855
185 Ga0495674_0167284 3300047319 Bacteria 1836
186 Ga0495676_0012132 3300047321 Bacteria 7773
187 Ga0495676_0049812 3300047321 Bacteria 3364
188 Ga0495680_0015136 3300047322 Bacteria 6661
189 Ga0495680_0016352 3300047322 Bacteria 6377
190 Ga0495680_0035257 3300047322 Bacteria 4031
191 Ga0495683_0003533 3300047323 Bacteria 9097
192 Ga0495683_0014281 3300047323 Bacteria 4137
193 Ga0495683_0102276 3300047323 Bacteria 1376
194 Ga0495683_0106420 3300047323 Bacteria 1343
195 Ga0495687_004245 3300047443 Bacteria 9823
196 Ga0495675_0000521 3300047444 Bacteria 24971
197 Ga0495675_0014652 3300047444 Bacteria 4954
198 Ga0495679_000013 3300047446 Bacteria 313222
199 Ga0495679_013669 3300047446 Bacteria 3035
200 Ga0495673_0009244 3300047469 Bacteria 5469
201 Ga0495684_0225144 3300047471 Bacteria 1374
202 Ga0495593_0015280 3300047673 Bacteria 4351
203 Ga0495593_0016422 3300047673 Bacteria 4176
204 Ga0495593_0049019 3300047673 Bacteria 2242
205 Ga0495602_0112775 3300048088 Bacteria 2205
206 Ga0495614_0037331 3300048089 Bacteria 2084
207 Ga0495626_0028964 3300048091 Bacteria 2682
208 Ga0496101_0034314 3300048904 Bacteria 3583
209 Ga0496102_0205458 3300048905 Bacteria 1857
210 Ga0496103_0003130 3300048906 Bacteria 10177
211 Ga0496104_0000042 3300048907 Bacteria 155859
212 Ga0496104_0008453 3300048907 Bacteria 9152
213 Ga0496105_0000046 3300048908 Bacteria 101134
214 Ga0496105_0003021 3300048908 Bacteria 12362
215 Ga0496105_0024583 3300048908 Bacteria 4895
216 Ga0496110_0008479 3300048913 Bacteria 8275
217 Ga0496111_0042679 3300048914 Bacteria 3257
218 Ga0496112_0035092 3300048915 Bacteria 4881
219 Ga0496113_0043450 3300048916 Bacteria 3326
220 Ga0496114_0017262 3300048917 Bacteria 5823
221 Ga0496115_0104584 3300048918 Bacteria 2323
222 Ga0496117_0002438 3300048920 Bacteria 23455
223 Ga0496117_0079085 3300048920 Bacteria 2168
224 Ga0496118_0000387 3300048921 Bacteria 74400
225 Ga0496118_0002230 3300048921 Bacteria 26735
226 Ga0496118_0034046 3300048921 Bacteria 4166
227 Ga0496119_0000343 3300048922 Bacteria 65175
228 Ga0496121_0001003 3300048924 Bacteria 50494
229 Ga0496121_0010979 3300048924 Bacteria 10114
230 Ga0496122_0079228 3300048925 Bacteria 2297
231 Ga0496125_0090967 3300048928 Bacteria 2288
232 Ga0496126_0000191 3300048929 Bacteria 137108
233 Ga0496126_0000239 3300048929 Bacteria 118024
234 Ga0496126_0003418 3300048929 Bacteria 20062
235 Ga0496126_0011238 3300048929 Bacteria 9289
236 Ga0496126_0019186 3300048929 Bacteria 6742
237 Ga0496126_0047433 3300048929 Bacteria 3933
238 Ga0495678_003693 3300049459 Bacteria 9264
239 Ga0501033_0018909 3300049570 Bacteria 5208
240 Ga0501039_0138533 3300049575 Bacteria 1911
241 Ga0501043_0123885 3300049579 Bacteria 2027
242 Ga0501047_0014307 3300049581 Bacteria 7546
243 Ga0501035_0002546 3300049822 Bacteria 17826
244 Ga0501044_0002569 3300049823 Bacteria 20676
245 Ga0500635_0006919 3300053080 Bacteria 3051
246 Ga0500554_009738 3300053102 Bacteria 2312
247 Ga0500590_105106 3300053148 Bacteria 1349
248 2509132326 2508501125 Bacteria 7208311
249 2510249369 2510065045 Bacteria 7761063
250 2513958971 2513237151 Bacteria 6309801
251 2527076250 2526164713 Bacteria 6780608
252 2719642222 2718217991 Bacteria 7829542
253 2738822872 2738541296 Bacteria 7285013
254 2738835079 2738541298 Bacteria 7286732
255 2738876558 2738541306 Bacteria 7284992
256 2739188502 2738543002 Bacteria 7284546
257 2739223154 2738543008 Bacteria 7282815
258 2819621595 2818991450 Bacteria 6962147
259 2842332628 2842324504 Bacteria 9364110
260 2842355959 2842348783 Bacteria 9002918
261 2842460985 2842454564 Bacteria 8730687
262 2885277505 2885270888 Bacteria 9831543
263 2900640910 2900634093 Bacteria 10263517
264 2904486131 2904483920 Bacteria 7545285
265 2919527470 2919527303 Bacteria 7718827
266 2928112125 2928108538 Bacteria 7360024
267 2928139331 2928135762 Bacteria 7259641
268 2928508590 2928503688 Bacteria 7268108
269 2945939139 2945934425 Bacteria 7444609
270 2990709142 2990703756 Bacteria 7715990
271 642421372 641736151 Bacteria 7477263
272 642616358 642555113 Bacteria 8214658
273 8055269801 8055266321 Bacteria 7999742
274 8055305881 8055301274 Bacteria 8587385
275 Ga0500618_001518
276 LJNas_1001032
277 JGI24740J21852_10007147
278 JGI24739J22299_10005482
279 JGI24735J21928_10015134
280 JGI24738J21930_10003579
281 JGI25156J39149_1000424
282 JGI25156J39149_1000438
283 JGI25156J39149_1000595
284 JGI25165J46597_1000842
285 Ga0055533_1000088
286 Ga0055533_1000934
287 Ga0055532_1000036
288 Ga0055527_1000022
289 Ga0055535_1000026
290 Ga0055542_1000042
291 Ga0055529_1000048
292 Ga0070658_10038733
293 Ga0070708_100005581
294 Ga0070708_100037624
295 Ga0070706_100003243
296 Ga0070706_100036408
297 Ga0070707_100006289
298 Ga0070707_100216402
299 Ga0070698_100031971
300 Ga0070698_100127754
301 Ga0070699_100002858
302 Ga0070697_100000079
303 Ga0070697_100029522
304 Ga0068861_100171585
305 Ga0068858_100001652
306 Ga0068858_100078759
307 Ga0081540_1062703
308 Ga0070717_10143847
309 Ga0070716_100005948
310 Ga0075430_100056198
311 Ga0105251_10000153
312 Ga0105240_10370145
313 Ga0105237_10124430
314 Ga0105238_10065524
315 Ga0105239_10078719
316 Ga0157369_10101579
317 Ga0163162_10003159
318 Ga0157372_10055354
319 Ga0157375_10001416
320 Ga0157375_10103253
321 Ga0182006_1023651
322 Ga0182007_10003457
323 Ga0213876_10002347
324 Ga0224572_1003377
325 Ga0209674_100011
326 Ga0209674_100048
327 Ga0209672_100002
328 Ga0209147_100003
329 Ga0209563_100374
330 Ga0207427_101255
331 Ga0209258_100005
332 Ga0209148_1000006
333 Ga0209759_1000002
334 Ga0209759_1000009
335 Ga0209759_1000032
336 Ga0209759_1018785
337 Ga0209233_1000033
338 Ga0209455_1000003
339 Ga0209455_1000556
340 Ga0207713_1000189
341 Ga0207647_10020611
342 Ga0207647_10100746
343 Ga0207699_10064952
344 Ga0207699_10206733
345 Ga0207684_10000528
346 Ga0207684_10000613
347 Ga0207684_10002553
348 Ga0207663_10016689
349 Ga0207646_10001671
350 Ga0207694_10002325
351 Ga0207664_10034936
352 Ga0207665_10070206
353 Ga0207689_10002133
354 Ga0207677_10196264
355 Ga0207703_10009376
356 Ga0207703_10126026
357 Ga0207678_10142540
358 Ga0207675_100090657
359 Ga0209371_1011422
360 Ga0265338_10001332
361 Ga0268256_1014177
362 Ga0265760_10018210
363 Ga0265330_10014817
364 Ga0265330_10030647
365 Ga0265332_10023433
366 Ga0307508_10000045
367 Ga0265314_10101293
368 Ga0265342_10064029
369 Ga0307412_10000015
370 Ga0307412_10011475
371 Ga0307411_10027948
372 Ga0307510_10053385
373 Ga0373935_0035422
374 Ga0373927_0035781
375 Ga0373925_0005961
376 Ga0395905_0077639
377 Ga0436364_0462076
378 Ga0436365_1530220
379 Ga0436363_0227802
380 Ga0436363_1547126
381 Ga0436362_1018893
382 Ga0495592_0000939
383 Ga0495592_0009978
384 Ga0495592_0116596
385 Ga0495603_0025390
386 Ga0495629_0000036
387 Ga0495629_0001310
388 Ga0495651_0006710
389 Ga0495653_0000490
390 Ga0495650_0005761
391 Ga0495650_0006536
392 Ga0495650_0016668
393 Ga0495580_0000081
394 Ga0495580_0006376
395 Ga0495582_0007600
396 Ga0495582_0009799
397 Ga0495605_0013577
398 Ga0495662_0012328
399 Ga0495664_0017642
400 Ga0495596_0002480
401 Ga0495596_0029008
402 Ga0495606_0029079
403 Ga0495608_0002054
404 Ga0495610_0000917
405 Ga0495618_0012738
406 Ga0495628_0004460
407 Ga0495628_0068049
408 Ga0495628_0137549
409 Ga0495628_0219920
410 Ga0495630_0006484
411 Ga0495630_0028439
412 Ga0495630_0089408
413 Ga0495648_0012563
414 Ga0495666_0006218
415 Ga0495666_0015803
416 Ga0495666_0026402
417 Ga0495666_0126028
418 Ga0495652_0035873
419 Ga0495652_0051210
420 Ga0495665_0004207
421 Ga0495665_0009761
422 Ga0495640_0007297
423 Ga0495586_0008987
424 Ga0495587_0027810
425 Ga0495621_0010488
426 Ga0495645_0045454
427 Ga0495622_0000233
428 Ga0495634_0008627
429 Ga0495634_0078820
430 Ga0495611_0009192
431 Ga0495635_0010220
432 Ga0495635_0011888
433 Ga0495599_0005932
434 Ga0495599_0009339
435 Ga0495599_0038740
436 Ga0495623_0003297
437 Ga0495623_0017222
438 Ga0495623_0132536
439 Ga0495646_0009621
440 Ga0495646_0041555
441 Ga0495658_0015631
442 Ga0495669_0039948
443 Ga0495613_0014969
444 Ga0495624_0000291
445 Ga0495624_0002539
446 Ga0495624_0038907
447 Ga0495624_0127171
448 Ga0495671_0017759
449 Ga0495649_0007438
450 Ga0495649_0040855
451 Ga0495600_0011804
452 Ga0495660_0083694
453 Ga0495581_0005188
454 Ga0495604_0010019
455 Ga0495604_0078594
456 Ga0495674_0003405
457 Ga0495674_0085296
458 Ga0495674_0164410
459 Ga0495674_0167284
460 Ga0495676_0012132
461 Ga0495676_0049812
462 Ga0495680_0015136
463 Ga0495680_0016352
464 Ga0495680_0035257
465 Ga0495683_0003533
466 Ga0495683_0014281
467 Ga0495683_0102276
468 Ga0495683_0106420
469 Ga0495687_004245
470 Ga0495675_0000521
471 Ga0495675_0014652
472 Ga0495679_000013
473 Ga0495679_013669
474 Ga0495673_0009244
475 Ga0495684_0225144
476 Ga0495593_0015280
477 Ga0495593_0016422
478 Ga0495593_0049019
479 Ga0495602_0112775
480 Ga0495614_0037331
481 Ga0495626_0028964
482 Ga0496101_0034314
483 Ga0496102_0205458
484 Ga0496103_0003130
485 Ga0496104_0000042
486 Ga0496104_0008453
487 Ga0496105_0000046
488 Ga0496105_0003021
489 Ga0496105_0024583
490 Ga0496110_0008479
491 Ga0496111_0042679
492 Ga0496112_0035092
493 Ga0496113_0043450
494 Ga0496114_0017262
495 Ga0496115_0104584
496 Ga0496117_0002438
497 Ga0496117_0079085
498 Ga0496118_0000387
499 Ga0496118_0002230
500 Ga0496118_0034046
501 Ga0496119_0000343
502 Ga0496121_0001003
503 Ga0496121_0010979
504 Ga0496122_0079228
505 Ga0496125_0090967
506 Ga0496126_0000191
507 Ga0496126_0000239
508 Ga0496126_0003418
509 Ga0496126_0011238
510 Ga0496126_0019186
511 Ga0496126_0047433
512 Ga0495678_003693
513 Ga0501033_0018909
514 Ga0501039_0138533
515 Ga0501043_0123885
516 Ga0501047_0014307
517 Ga0501035_0002546
518 Ga0501044_0002569
519 Ga0500635_0006919
520 Ga0500554_009738
521 Ga0500590_105106
522 2509132326
523 2510249369
524 2513958971
525 2527076250
526 2719642222
527 2738822872
528 2738835079
529 2738876558
530 2739188502
531 2739223154
532 2819621595
533 2842332628
534 2842355959
535 2842460985
536 2885277505
537 2900640910
538 2904486131
539 2919527470
540 2928112125
541 2928139331
542 2928508590
543 2945939139
544 2990709142
545 642421372
546 642616358
547 8055269801
548 8055305881

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00871

Acetate_kinase

Acetokinase family

14

415

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3khy-assembly1.cif.gz_B crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 0.906 15 375
6ioy-assembly2.cif.gz_C crystal structure of porphyromonas gingivalis acetate kinase 0.8984 15 380
4ijn-assembly1.cif.gz_B crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate 0.8861 16 377
7fjb-assembly1.cif.gz_A kpacka (pduw) with amppnp, sodium acetate complex structure 0.8806 15 384
7fj7-assembly1.cif.gz_B kpacka (pduw) native structure 0.8782 15 384
ID Description Score Start End Superfamily
2iirA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9359 208 381 3.30.420.40
1x3mA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.934 207 380 3.30.420.40
4h0oB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9012 207 382 3.30.420.40
3khyB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8756 16 206 3.30.420.40
4dq8B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8718 16 206 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A1H4L0M5-F1-model_v4 Acetate kinase (EC 2.7.2.1) (Acetokinase) 0.9787 14 380 GO:0000287
GO:0005524
GO:0005737
GO:0006083
GO:0006085
GO:0008776
AF-T0YVP5-F1-model_v4 Acetate and butyrate kinase 0.9695 210 345 GO:0005524
GO:0005829
GO:0006083
GO:0008776
AF-R7MXD9-F1-model_v4 butyrate kinase (EC 2.7.2.7) 0.9692 208 336 GO:0005524
GO:0006083
GO:0008776
GO:0047761
AF-A0A4R2S2N8-F1-model_v4 Acetate kinase (EC 2.7.2.1) (Acetokinase) 0.9683 15 380 GO:0000287
GO:0005524
GO:0005829
GO:0006083
GO:0006085
GO:0008776
AF-A0A7V5YSR5-F1-model_v4 Acetate kinase 0.9668 211 383 GO:0000287
GO:0005524
GO:0005737
GO:0006083
GO:0006085
GO:0008776

Map