F379911

General Info

Members Datasets Scaffolds Average Seq Length
274 194 548 177

Family's Representative Sequence

Representative Sequence 3300042993|Ga0439440_0109531|Ga0439440_0109531_58_702
Length 214
Sequence MGWWATLRQDGLSSHLFRTLIRDSQMTHVCNHRRFEGGTLMKRLTCLLVAVVALAGVVASMAPGTGQAGQEAAPIFVTEIPPGYRDWRLISVAHEAGDLNDIRAILGNDVAIKAYREGTRPFPDGTIIARLAWSYDPSEENNKVFGRPQSFVAGPPKNGVQFMVKDAKKYASTGGWGFAHFNDGKPADEAVLKTCFPCHQAIKDRDLVFTRYAP

Samples

Sample ID Description Type Environment
1 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
123 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
124 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
190 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
191 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 0
Rhizoplane 2.55
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439440_0109531 3300042993 Bacteria 759
2 Ga0070658_10000132 3300005327 Bacteria 66111
3 Ga0070690_100048172 3300005330 Bacteria 2713
4 Ga0068868_100000941 3300005338 Bacteria 19766
5 Ga0070689_100167489 3300005340 Bacteria 1779
6 Ga0070668_100521559 3300005347 Bacteria 1031
7 Ga0070671_100008535 3300005355 Bacteria 8213
8 Ga0070674_100855031 3300005356 Bacteria 789
9 Ga0070673_100009608 3300005364 Bacteria 6503
10 Ga0070667_100305639 3300005367 Bacteria 1433
11 Ga0070703_10001639 3300005406 Bacteria 6652
12 Ga0070713_100510465 3300005436 Bacteria 1135
13 Ga0070701_10032103 3300005438 Bacteria 2612
14 Ga0070705_100002254 3300005440 Bacteria 9766
15 Ga0070700_100002914 3300005441 Bacteria 8778
16 Ga0070694_100000560 3300005444 Bacteria 20537
17 Ga0070708_100064494 3300005445 Bacteria 3282
18 Ga0070708_100283457 3300005445 Bacteria 1559
19 Ga0070663_100024840 3300005455 Bacteria 4038
20 Ga0070662_100593541 3300005457 Bacteria 931
21 Ga0070706_100204011 3300005467 Bacteria 1847
22 Ga0070707_100069800 3300005468 Bacteria 3384
23 Ga0070707_100893330 3300005468 Bacteria 853
24 Ga0070698_100085166 3300005471 Bacteria 3148
25 Ga0070699_100004947 3300005518 Bacteria 11755
26 Ga0070699_100005777 3300005518 Bacteria 10824
27 Ga0070699_100751808 3300005518 Bacteria 892
28 Ga0070697_100022219 3300005536 Bacteria 5034
29 Ga0070672_100982511 3300005543 Unclassified 748
30 Ga0070695_100002057 3300005545 Bacteria 11505
31 Ga0070695_100012882 3300005545 Bacteria 5020
32 Ga0070696_100000955 3300005546 Bacteria 18738
33 Ga0070665_100137448 3300005548 Bacteria 2447
34 Ga0070704_100000293 3300005549 Bacteria 21969
35 Ga0068857_100018531 3300005577 Bacteria 6106
36 Ga0070702_100140966 3300005615 Bacteria 1535
37 Ga0068852_101671095 3300005616 Bacteria 659
38 Ga0068859_100002626 3300005617 Bacteria 18286
39 Ga0068859_100003882 3300005617 Bacteria 15261
40 Ga0068864_100000198 3300005618 Bacteria 54959
41 Ga0068864_100098235 3300005618 Bacteria 2593
42 Ga0068864_100139675 3300005618 Bacteria 2184
43 Ga0068858_100020252 3300005842 Bacteria 6221
44 Ga0068860_100013202 3300005843 Bacteria 8104
45 Ga0068860_100014663 3300005843 Bacteria 7669
46 Ga0068860_100420345 3300005843 Bacteria 1325
47 Ga0068862_100004543 3300005844 Bacteria 11698
48 Ga0081455_10003105 3300005937 Bacteria 19325
49 Ga0081455_10021693 3300005937 Bacteria 6017
50 Ga0081538_10006100 3300005981 Bacteria 10708
51 Ga0081538_10009356 3300005981 Bacteria 8190
52 Ga0070712_100020008 3300006175 Bacteria 4376
53 Ga0075367_10050849 3300006178 Bacteria 2448
54 Ga0097621_100024131 3300006237 Bacteria 4745
55 Ga0097621_100245790 3300006237 Bacteria 1565
56 Ga0075370_10174046 3300006353 Bacteria 1266
57 Ga0068871_100123464 3300006358 Bacteria 2190
58 Ga0068871_100205989 3300006358 Bacteria 1700
59 Ga0068871_100253695 3300006358 Bacteria 1533
60 Ga0075428_100671455 3300006844 Bacteria 1104
61 Ga0075430_100328179 3300006846 Bacteria 1265
62 Ga0075431_100535154 3300006847 Bacteria 1160
63 Ga0075434_100315519 3300006871 Bacteria 1584
64 Ga0075436_100004884 3300006914 Bacteria 9211
65 Ga0075436_100301809 3300006914 Bacteria 1148
66 Ga0097620_100002626 3300006931 Bacteria 18286
67 Ga0097620_100003882 3300006931 Bacteria 15261
68 Ga0075435_100465710 3300007076 Bacteria 1091
69 Ga0105245_10002193 3300009098 Bacteria 17695
70 Ga0105247_10006424 3300009101 Bacteria 7279
71 Ga0105243_10495799 3300009148 Bacteria 1156
72 Ga0105242_10013172 3300009176 Bacteria 6382
73 Ga0105242_10169896 3300009176 Bacteria 1915
74 Ga0105248_10062611 3300009177 Bacteria 4177
75 Ga0105248_10548498 3300009177 Bacteria 1304
76 Ga0105248_10841524 3300009177 Unclassified 1035
77 Ga0105237_10004499 3300009545 Bacteria 16112
78 Ga0105238_10027464 3300009551 Bacteria 5801
79 Ga0105249_10008453 3300009553 Bacteria 8969
80 Ga0105239_11509385 3300010375 Unclassified 776
81 Ga0105246_10236782 3300011119 Bacteria 1441
82 Ga0157374_10001284 3300013296 Bacteria 21379
83 Ga0157378_10035731 3300013297 Bacteria 4397
84 Ga0157378_10109022 3300013297 Bacteria 2536
85 Ga0163162_10064372 3300013306 Bacteria 3712
86 Ga0163162_10801054 3300013306 Bacteria 1060
87 Ga0157375_10020904 3300013308 Bacteria 5991
88 Ga0157375_10020914 3300013308 Bacteria 5989
89 Ga0157375_11193030 3300013308 Bacteria 893
90 Ga0163163_10115377 3300014325 Bacteria 2717
91 Ga0163163_10723654 3300014325 Bacteria 1059
92 Ga0157379_10555865 3300014968 Bacteria 1068
93 Ga0207653_10000399 3300025885 Bacteria 19222
94 Ga0207710_10251647 3300025900 Bacteria 883
95 Ga0207710_10313794 3300025900 Bacteria 794
96 Ga0207705_10000421 3300025909 Bacteria 37107
97 Ga0207684_10171696 3300025910 Bacteria 1869
98 Ga0207654_10372437 3300025911 Bacteria 987
99 Ga0207671_10001570 3300025914 Bacteria 26087
100 Ga0207693_10003442 3300025915 Bacteria 13505
101 Ga0207693_10099166 3300025915 Bacteria 2284
102 Ga0207663_10000031 3300025916 Bacteria 96659
103 Ga0207660_10448893 3300025917 Bacteria 1043
104 Ga0207646_10694685 3300025922 Bacteria 910
105 Ga0207694_10054832 3300025924 Unclassified 3094
106 Ga0207687_10000941 3300025927 Bacteria 19857
107 Ga0207700_10487410 3300025928 Bacteria 1090
108 Ga0207644_10132320 3300025931 Bacteria 1911
109 Ga0207706_10316912 3300025933 Bacteria 1357
110 Ga0207686_10103062 3300025934 Bacteria 1909
111 Ga0207686_10105652 3300025934 Bacteria 1889
112 Ga0207670_10360298 3300025936 Bacteria 1154
113 Ga0207691_10480821 3300025940 Bacteria 1055
114 Ga0207711_10022156 3300025941 Bacteria 5311
115 Ga0207711_10485852 3300025941 Unclassified 1151
116 Ga0207711_10580079 3300025941 Bacteria 1046
117 Ga0207712_10041792 3300025961 Bacteria 3153
118 Ga0207668_10268624 3300025972 Bacteria 1393
119 Ga0207658_10515908 3300025986 Bacteria 1066
120 Ga0207677_10000486 3300026023 Bacteria 25874
121 Ga0207703_10058776 3300026035 Bacteria 3139
122 Ga0207708_10008927 3300026075 Bacteria 7420
123 Ga0207641_10008437 3300026088 Bacteria 8518
124 Ga0207641_10013057 3300026088 Bacteria 6813
125 Ga0207676_10000996 3300026095 Bacteria 21831
126 Ga0207676_10056677 3300026095 Bacteria 3082
127 Ga0207676_10065356 3300026095 Bacteria 2896
128 Ga0207674_10634551 3300026116 Bacteria 1031
129 Ga0268266_10111476 3300028379 Bacteria 2424
130 Ga0268265_10000937 3300028380 Bacteria 26824
131 Ga0268264_10002087 3300028381 Bacteria 17845
132 Ga0268264_10485738 3300028381 Bacteria 1202
133 Ga0265338_10215117 3300028800 Bacteria 1440
134 Ga0265760_10134286 3300031090 Unclassified 802
135 Ga0265332_10139287 3300031238 Bacteria 1017
136 Ga0307513_10017944 3300031456 Bacteria 8472
137 Ga0265314_10014284 3300031711 Bacteria 6365
138 Ga0265342_10049433 3300031712 Bacteria 2516
139 Ga0307410_10695345 3300031852 Bacteria 857
140 Ga0307406_10413822 3300031901 Bacteria 1072
141 Ga0307409_100191686 3300031995 Bacteria 1820
142 Ga0307409_101315629 3300031995 Bacteria 748
143 Ga0373923_0043524 3300035111 Bacteria 1859
144 Ga0373936_0045594 3300035113 Bacteria 1766
145 Ga0373945_0001972 3300035116 Bacteria 6373
146 Ga0373953_0053759 3300035117 Bacteria 1633
147 Ga0373954_0293215 3300035118 Unclassified 802
148 Ga0373943_0000971 3300035170 Bacteria 12734
149 Ga0373943_0004346 3300035170 Bacteria 6429
150 Ga0373943_0023515 3300035170 Bacteria 2866
151 Ga0373946_0010339 3300035171 Bacteria 3451
152 Ga0373946_0212305 3300035171 Bacteria 931
153 Ga0373924_0113460 3300035410 Bacteria 1173
154 Ga0373935_0019259 3300035692 Bacteria 4162
155 Ga0373935_0126424 3300035692 Bacteria 1713
156 Ga0373935_0263484 3300035692 Bacteria 1209
157 Ga0373927_0001848 3300035695 Bacteria 15707
158 Ga0373927_0011749 3300035695 Bacteria 5829
159 Ga0373927_0043367 3300035695 Bacteria 2912
160 Ga0373947_0001913 3300035725 Bacteria 12733
161 Ga0373947_0017698 3300035725 Bacteria 4099
162 Ga0373947_0042247 3300035725 Bacteria 2721
163 Ga0373947_0058551 3300035725 Bacteria 2335
164 Ga0373947_0664642 3300035725 Bacteria 711
165 Ga0373925_0004588 3300037068 Bacteria 10436
166 Ga0373925_0007679 3300037068 Bacteria 7857
167 Ga0373925_0035240 3300037068 Bacteria 3691
168 Ga0373925_0565979 3300037068 Bacteria 935
169 Ga0373925_0926599 3300037068 Bacteria 718
170 Ga0395905_0034389 3300037471 Bacteria 4759
171 Ga0436360_0896101 3300039438 Bacteria 561
172 Ga0439450_129883 3300042008 Bacteria 653
173 Ga0450923_100031 3300042125 Bacteria 668
174 Ga0439444_0106953 3300042437 Bacteria 640
175 Ga0451577_1324570 3300042876 Bacteria 640
176 Ga0439440_0090974 3300042993 Bacteria 819
177 Ga0453684_0229879 3300044712 Bacteria 2142
178 Ga0451576_0423262 3300045051 Unclassified 1397
179 Ga0451576_0497712 3300045051 Bacteria 1280
180 Ga0495603_0013779 3300046455 Bacteria 4892
181 Ga0495629_0044735 3300046459 Bacteria 3107
182 Ga0495641_0011199 3300046461 Bacteria 5132
183 Ga0495653_0064148 3300046463 Bacteria 2768
184 Ga0495580_0043251 3300046472 Bacteria 3206
185 Ga0495580_0473552 3300046472 Bacteria 838
186 Ga0495639_0047402 3300046475 Bacteria 1946
187 Ga0495662_0000090 3300046476 Bacteria 32519
188 Ga0495662_0061782 3300046476 Bacteria 1810
189 Ga0495664_0000146 3300046477 Bacteria 35506
190 Ga0495585_0060870 3300046492 Bacteria 2077
191 Ga0495585_0363034 3300046492 Bacteria 702
192 Ga0495594_0011821 3300046499 Bacteria 4540
193 Ga0495630_0022831 3300046517 Bacteria 4621
194 Ga0495644_0146803 3300046523 Bacteria 902
195 Ga0495666_0037339 3300046526 Bacteria 2363
196 Ga0495666_0061415 3300046526 Bacteria 1796
197 Ga0495652_0237441 3300046529 Bacteria 1359
198 Ga0495665_0044335 3300046531 Bacteria 2363
199 Ga0495665_0196853 3300046531 Bacteria 1045
200 Ga0495640_0000406 3300046533 Bacteria 31017
201 Ga0495640_0015545 3300046533 Bacteria 5725
202 Ga0495586_0114950 3300046535 Bacteria 1500
203 Ga0495598_0017442 3300046537 Bacteria 1850
204 Ga0495645_0047921 3300046543 Bacteria 3113
205 Ga0495633_0411520 3300046558 Bacteria 611
206 Ga0495656_0008478 3300046615 Bacteria 3671
207 Ga0495656_0098782 3300046615 Bacteria 1347
208 Ga0495656_0157936 3300046615 Bacteria 1100
209 Ga0495634_0202106 3300046642 Bacteria 1234
210 Ga0495635_0002945 3300046663 Bacteria 11681
211 Ga0495635_0037283 3300046663 Bacteria 3366
212 Ga0495647_0010349 3300046681 Bacteria 3173
213 Ga0495647_0263140 3300046681 Bacteria 770
214 Ga0495658_0005378 3300046683 Bacteria 6294
215 Ga0495658_0035758 3300046683 Bacteria 2736
216 Ga0495613_0029060 3300046689 Bacteria 4110
217 Ga0495624_0013100 3300046690 Bacteria 5656
218 Ga0495624_0021798 3300046690 Bacteria 4245
219 Ga0495671_0056738 3300046692 Bacteria 1939
220 Ga0495589_0332409 3300046794 Bacteria 701
221 Ga0495600_0458527 3300046809 Bacteria 787
222 Ga0495581_0013817 3300047315 Bacteria 4679
223 Ga0495581_0031710 3300047315 Bacteria 3062
224 Ga0495636_0339197 3300047318 Bacteria 708
225 Ga0495674_0010462 3300047319 Bacteria 8782
226 Ga0495676_0011178 3300047321 Bacteria 8113
227 Ga0495676_0075153 3300047321 Bacteria 2585
228 Ga0495684_0018625 3300047471 Bacteria 5349
229 Ga0495684_0029548 3300047471 Bacteria 4207
230 Ga0496102_0008684 3300048905 Bacteria 8722
231 Ga0496103_0013715 3300048906 Bacteria 4809
232 Ga0496106_0000212 3300048909 Bacteria 40609
233 Ga0496107_0020592 3300048910 Bacteria 4660
234 Ga0496109_0303655 3300048912 Bacteria 1505
235 Ga0496112_0100937 3300048915 Bacteria 2855
236 Ga0496115_0459197 3300048918 Bacteria 1028
237 Ga0496126_0036836 3300048929 Bacteria 4571
238 Ga0501039_0897282 3300049575 Unclassified 690
239 Ga0501041_0118082 3300049577 Bacteria 1647
240 Ga0501046_0192841 3300049580 Bacteria 1519
241 Ga0501046_0213280 3300049580 Bacteria 1432
242 Ga0501072_0471071 3300049588 Bacteria 994
243 Ga0501074_0539908 3300049590 Bacteria 826
244 Ga0501076_0244898 3300049592 Bacteria 1467
245 Ga0501076_0588171 3300049592 Bacteria 918
246 Ga0501079_0146701 3300049741 Bacteria 1839
247 Ga0501079_0239427 3300049741 Bacteria 1418
248 Ga0501081_0072686 3300049743 Bacteria 2398
249 Ga0501081_0129726 3300049743 Bacteria 1801
250 nmdc:mga0yw44_373569_c1 3300050492 Bacteria 962
251 nmdc:mga07m45_76016_c1 3300050496 Bacteria 1266
252 nmdc:mga05p37_490034_c1 3300050507 Bacteria 1413
253 nmdc:mga05p37_826664_c1 3300050507 Bacteria 1009
254 nmdc:mga0qj67_138687_c1 3300050509 Bacteria 1971
255 nmdc:mga0n895_4979_c1 3300050512 Bacteria 11025
256 nmdc:mga0n895_613052_c1 3300050512 Bacteria 1090
257 nmdc:mga0rr50_444423_c1 3300050513 Bacteria 1099
258 nmdc:mga08x19_104175_c1 3300050514 Bacteria 1885
259 nmdc:mga08x19_7_c1 3300050514 Bacteria 437351
260 nmdc:mga0a205_10300_c2 3300050515 Bacteria 6763
261 nmdc:mga0a205_163855_c1 3300050515 Bacteria 2119
262 Ga0495601_0292543 3300053077 Bacteria 1061
263 Ga0495619_0000764 3300053085 Bacteria 20984
264 Ga0495619_0300748 3300053085 Bacteria 1111
265 Ga0495619_0406278 3300053085 Bacteria 940
266 Ga0500646_0027874 3300053090 Bacteria 1539
267 Ga0500556_0006901 3300053104 Bacteria 3233
268 Ga0500588_0099100 3300053146 Bacteria 1002
269 Ga0501084_0117220 3300054114 Bacteria 2239
270 Ga0501084_0704233 3300054114 Bacteria 852
271 Ga0501082_0064178 3300060353 Bacteria 3163
272 Ga0501082_0513854 3300060353 Bacteria 1047
273 Ga0501082_1580207 3300060353 Unclassified 573
274 Ga0530510_0017303 3300061734 Bacteria 5107
275 Ga0439440_0109531
276 Ga0070658_10000132
277 Ga0070690_100048172
278 Ga0068868_100000941
279 Ga0070689_100167489
280 Ga0070668_100521559
281 Ga0070671_100008535
282 Ga0070674_100855031
283 Ga0070673_100009608
284 Ga0070667_100305639
285 Ga0070703_10001639
286 Ga0070713_100510465
287 Ga0070701_10032103
288 Ga0070705_100002254
289 Ga0070700_100002914
290 Ga0070694_100000560
291 Ga0070708_100064494
292 Ga0070708_100283457
293 Ga0070663_100024840
294 Ga0070662_100593541
295 Ga0070706_100204011
296 Ga0070707_100069800
297 Ga0070707_100893330
298 Ga0070698_100085166
299 Ga0070699_100004947
300 Ga0070699_100005777
301 Ga0070699_100751808
302 Ga0070697_100022219
303 Ga0070672_100982511
304 Ga0070695_100002057
305 Ga0070695_100012882
306 Ga0070696_100000955
307 Ga0070665_100137448
308 Ga0070704_100000293
309 Ga0068857_100018531
310 Ga0070702_100140966
311 Ga0068852_101671095
312 Ga0068859_100002626
313 Ga0068859_100003882
314 Ga0068864_100000198
315 Ga0068864_100098235
316 Ga0068864_100139675
317 Ga0068858_100020252
318 Ga0068860_100013202
319 Ga0068860_100014663
320 Ga0068860_100420345
321 Ga0068862_100004543
322 Ga0081455_10003105
323 Ga0081455_10021693
324 Ga0081538_10006100
325 Ga0081538_10009356
326 Ga0070712_100020008
327 Ga0075367_10050849
328 Ga0097621_100024131
329 Ga0097621_100245790
330 Ga0075370_10174046
331 Ga0068871_100123464
332 Ga0068871_100205989
333 Ga0068871_100253695
334 Ga0075428_100671455
335 Ga0075430_100328179
336 Ga0075431_100535154
337 Ga0075434_100315519
338 Ga0075436_100004884
339 Ga0075436_100301809
340 Ga0097620_100002626
341 Ga0097620_100003882
342 Ga0075435_100465710
343 Ga0105245_10002193
344 Ga0105247_10006424
345 Ga0105243_10495799
346 Ga0105242_10013172
347 Ga0105242_10169896
348 Ga0105248_10062611
349 Ga0105248_10548498
350 Ga0105248_10841524
351 Ga0105237_10004499
352 Ga0105238_10027464
353 Ga0105249_10008453
354 Ga0105239_11509385
355 Ga0105246_10236782
356 Ga0157374_10001284
357 Ga0157378_10035731
358 Ga0157378_10109022
359 Ga0163162_10064372
360 Ga0163162_10801054
361 Ga0157375_10020904
362 Ga0157375_10020914
363 Ga0157375_11193030
364 Ga0163163_10115377
365 Ga0163163_10723654
366 Ga0157379_10555865
367 Ga0207653_10000399
368 Ga0207710_10251647
369 Ga0207710_10313794
370 Ga0207705_10000421
371 Ga0207684_10171696
372 Ga0207654_10372437
373 Ga0207671_10001570
374 Ga0207693_10003442
375 Ga0207693_10099166
376 Ga0207663_10000031
377 Ga0207660_10448893
378 Ga0207646_10694685
379 Ga0207694_10054832
380 Ga0207687_10000941
381 Ga0207700_10487410
382 Ga0207644_10132320
383 Ga0207706_10316912
384 Ga0207686_10103062
385 Ga0207686_10105652
386 Ga0207670_10360298
387 Ga0207691_10480821
388 Ga0207711_10022156
389 Ga0207711_10485852
390 Ga0207711_10580079
391 Ga0207712_10041792
392 Ga0207668_10268624
393 Ga0207658_10515908
394 Ga0207677_10000486
395 Ga0207703_10058776
396 Ga0207708_10008927
397 Ga0207641_10008437
398 Ga0207641_10013057
399 Ga0207676_10000996
400 Ga0207676_10056677
401 Ga0207676_10065356
402 Ga0207674_10634551
403 Ga0268266_10111476
404 Ga0268265_10000937
405 Ga0268264_10002087
406 Ga0268264_10485738
407 Ga0265338_10215117
408 Ga0265760_10134286
409 Ga0265332_10139287
410 Ga0307513_10017944
411 Ga0265314_10014284
412 Ga0265342_10049433
413 Ga0307410_10695345
414 Ga0307406_10413822
415 Ga0307409_100191686
416 Ga0307409_101315629
417 Ga0373923_0043524
418 Ga0373936_0045594
419 Ga0373945_0001972
420 Ga0373953_0053759
421 Ga0373954_0293215
422 Ga0373943_0000971
423 Ga0373943_0004346
424 Ga0373943_0023515
425 Ga0373946_0010339
426 Ga0373946_0212305
427 Ga0373924_0113460
428 Ga0373935_0019259
429 Ga0373935_0126424
430 Ga0373935_0263484
431 Ga0373927_0001848
432 Ga0373927_0011749
433 Ga0373927_0043367
434 Ga0373947_0001913
435 Ga0373947_0017698
436 Ga0373947_0042247
437 Ga0373947_0058551
438 Ga0373947_0664642
439 Ga0373925_0004588
440 Ga0373925_0007679
441 Ga0373925_0035240
442 Ga0373925_0565979
443 Ga0373925_0926599
444 Ga0395905_0034389
445 Ga0436360_0896101
446 Ga0439450_129883
447 Ga0450923_100031
448 Ga0439444_0106953
449 Ga0451577_1324570
450 Ga0439440_0090974
451 Ga0453684_0229879
452 Ga0451576_0423262
453 Ga0451576_0497712
454 Ga0495603_0013779
455 Ga0495629_0044735
456 Ga0495641_0011199
457 Ga0495653_0064148
458 Ga0495580_0043251
459 Ga0495580_0473552
460 Ga0495639_0047402
461 Ga0495662_0000090
462 Ga0495662_0061782
463 Ga0495664_0000146
464 Ga0495585_0060870
465 Ga0495585_0363034
466 Ga0495594_0011821
467 Ga0495630_0022831
468 Ga0495644_0146803
469 Ga0495666_0037339
470 Ga0495666_0061415
471 Ga0495652_0237441
472 Ga0495665_0044335
473 Ga0495665_0196853
474 Ga0495640_0000406
475 Ga0495640_0015545
476 Ga0495586_0114950
477 Ga0495598_0017442
478 Ga0495645_0047921
479 Ga0495633_0411520
480 Ga0495656_0008478
481 Ga0495656_0098782
482 Ga0495656_0157936
483 Ga0495634_0202106
484 Ga0495635_0002945
485 Ga0495635_0037283
486 Ga0495647_0010349
487 Ga0495647_0263140
488 Ga0495658_0005378
489 Ga0495658_0035758
490 Ga0495613_0029060
491 Ga0495624_0013100
492 Ga0495624_0021798
493 Ga0495671_0056738
494 Ga0495589_0332409
495 Ga0495600_0458527
496 Ga0495581_0013817
497 Ga0495581_0031710
498 Ga0495636_0339197
499 Ga0495674_0010462
500 Ga0495676_0011178
501 Ga0495676_0075153
502 Ga0495684_0018625
503 Ga0495684_0029548
504 Ga0496102_0008684
505 Ga0496103_0013715
506 Ga0496106_0000212
507 Ga0496107_0020592
508 Ga0496109_0303655
509 Ga0496112_0100937
510 Ga0496115_0459197
511 Ga0496126_0036836
512 Ga0501039_0897282
513 Ga0501041_0118082
514 Ga0501046_0192841
515 Ga0501046_0213280
516 Ga0501072_0471071
517 Ga0501074_0539908
518 Ga0501076_0244898
519 Ga0501076_0588171
520 Ga0501079_0146701
521 Ga0501079_0239427
522 Ga0501081_0072686
523 Ga0501081_0129726
524 nmdc:mga0yw44_373569_c1
525 nmdc:mga07m45_76016_c1
526 nmdc:mga05p37_490034_c1
527 nmdc:mga05p37_826664_c1
528 nmdc:mga0qj67_138687_c1
529 nmdc:mga0n895_4979_c1
530 nmdc:mga0n895_613052_c1
531 nmdc:mga0rr50_444423_c1
532 nmdc:mga08x19_104175_c1
533 nmdc:mga08x19_7_c1
534 nmdc:mga0a205_10300_c2
535 nmdc:mga0a205_163855_c1
536 Ga0495601_0292543
537 Ga0495619_0000764
538 Ga0495619_0300748
539 Ga0495619_0406278
540 Ga0500646_0027874
541 Ga0500556_0006901
542 Ga0500588_0099100
543 Ga0501084_0117220
544 Ga0501084_0704233
545 Ga0501082_0064178
546 Ga0501082_0513854
547 Ga0501082_1580207
548 Ga0530510_0017303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16694

Cytochrome_P460

Cytochrome P460

81

210

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.8077 40 174
8brk-assembly1.cif.gz_A room temperature crystal structure of cytochrome c' from thermus thermophilus 0.7964 41 174
8brk-assembly1.cif.gz_A room temperature crystal structure of cytochrome c' from thermus thermophilus 0.7698 41 174
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.746 40 174
7zs4-assembly1.cif.gz_A f32v cytochrome c prime beta from methylococcus capsulatus (bath) 0.7367 39 160
ID Description Score Start End Superfamily
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.7318 39 170 3.50.70.20
af_D4A5Q1_319_486_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6293 83 126 2.60.40.150
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.6029 39 170 3.50.70.20
af_Q9SFC7_66_239_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.4858 86 145 2.130.10.10
af_Q94JK5_91_392_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.4432 61 128 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A533JDV7-F1-model_v4 deleted 0.8988 38 174
AF-A0A031JTP0-F1-model_v4 Cytochrome P460 0.8817 35 166
AF-A0A1G8KSS3-F1-model_v4 Cytochrome P460 0.8753 31 138
AF-A0A853QX88-F1-model_v4 deleted 0.8698 40 174
AF-A0A7R7Y3Q4-F1-model_v4 deleted 0.8603 33 174

Map