F379882

General Info

Members Datasets Scaffolds Average Seq Length
274 110 548 136

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1562608|Ga0436364_1562608_656_1156
Length 166
Sequence MSPDGEALDTRPLVSALGPAVHQDAYGRIAGRMDPSRKRAIRLTVALAAALLLATALIYTSFTAGREELTAAKLLRTAHPGHSYILAGTVLDGSVRREGNALLFRVRDPTEKVSVPVRYTGVVPDPFAPGRGVLVTVHEQGSQFVGEQDSLTTKCPSKYQAAKASY

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
13 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
26 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
27 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
28 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
29 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
43 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
44 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
45 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
46 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
47 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
48 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
49 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
50 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
51 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
52 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
53 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
60 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
61 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
62 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
63 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
71 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
72 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
73 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
77 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
78 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
79 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
80 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
85 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
108 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
109 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
110 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.2
Rhizosphere 77.74
Stem 0
Stem Tuber 0
Unclassified 19.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1562608 3300037853 Bacteria 1639
2 Ga0070714_100224371 3300005435 Bacteria 1728
3 Ga0070714_100251087 3300005435 Bacteria 1636
4 Ga0070714_100256809 3300005435 Bacteria 1617
5 Ga0070714_100341864 3300005435 Bacteria 1404
6 Ga0070713_100053097 3300005436 Bacteria 3357
7 Ga0070713_100068372 3300005436 Bacteria 2993
8 Ga0070713_100190789 3300005436 Bacteria 1846
9 Ga0070713_100222790 3300005436 Bacteria 1711
10 Ga0070713_100683653 3300005436 Bacteria 979
11 Ga0070711_100094709 3300005439 Bacteria 2159
12 Ga0070711_100499416 3300005439 Bacteria 1003
13 Ga0070705_100089363 3300005440 Bacteria 1915
14 Ga0070694_100101484 3300005444 Bacteria 2036
15 Ga0070678_100691815 3300005456 Bacteria 918
16 Ga0068867_100470018 3300005459 Bacteria 1075
17 Ga0070702_100159482 3300005615 Bacteria 1457
18 Ga0068864_100612912 3300005618 Unclassified 1057
19 Ga0070717_10136839 3300006028 Bacteria 2110
20 Ga0070717_10440353 3300006028 Bacteria 1174
21 Ga0070717_10470085 3300006028 Bacteria 1135
22 Ga0070717_10503650 3300006028 Bacteria 1094
23 Ga0070717_10862514 3300006028 Unclassified 824
24 Ga0070716_100409286 3300006173 Bacteria 977
25 Ga0070712_100152405 3300006175 Bacteria 1776
26 Ga0070712_100244156 3300006175 Bacteria 1432
27 Ga0111539_12076763 3300009094 Bacteria 659
28 Ga0105245_10114306 3300009098 Bacteria 2514
29 Ga0105245_10931296 3300009098 Bacteria 911
30 Ga0105243_10099958 3300009148 Bacteria 2406
31 Ga0105242_10764539 3300009176 Bacteria 953
32 Ga0105249_10309999 3300009553 Bacteria 1586
33 Ga0105249_10771012 3300009553 Bacteria 1025
34 Ga0105239_11614157 3300010375 Bacteria 750
35 Ga0157378_10551401 3300013297 Bacteria 1158
36 Ga0157372_11839490 3300013307 Bacteria 696
37 Ga0157375_10131493 3300013308 Bacteria 2622
38 Ga0197907_10502194 3300020069 Bacteria 850
39 Ga0206353_10548726 3300020082 Bacteria 795
40 Ga0213873_10006532 3300021358 Bacteria 2299
41 Ga0213874_10000932 3300021377 Bacteria 5965
42 Ga0213874_10173572 3300021377 Bacteria 764
43 Ga0213876_10087823 3300021384 Bacteria 1646
44 Ga0213876_10546983 3300021384 Unclassified 616
45 Ga0213875_10000126 3300021388 Bacteria 84171
46 Ga0213875_10020534 3300021388 Bacteria 3169
47 Ga0213875_10033501 3300021388 Bacteria 2427
48 Ga0213875_10074384 3300021388 Bacteria 1585
49 Ga0213875_10091048 3300021388 Bacteria 1422
50 Ga0207692_10023933 3300025898 Bacteria 2832
51 Ga0207692_10398969 3300025898 Bacteria 857
52 Ga0207671_10021403 3300025914 Bacteria 4906
53 Ga0207693_10002269 3300025915 Bacteria 16727
54 Ga0207693_10581650 3300025915 Bacteria 872
55 Ga0207663_10061826 3300025916 Bacteria 2378
56 Ga0207687_10214145 3300025927 Bacteria 1513
57 Ga0207687_10294959 3300025927 Bacteria 1304
58 Ga0207700_10022724 3300025928 Bacteria 4307
59 Ga0207700_10071094 3300025928 Bacteria 2678
60 Ga0207700_10322572 3300025928 Bacteria 1339
61 Ga0207700_10567066 3300025928 Bacteria 1009
62 Ga0207700_11311143 3300025928 Bacteria 645
63 Ga0207664_10036062 3300025929 Bacteria 3821
64 Ga0207664_10182246 3300025929 Bacteria 1803
65 Ga0207664_10192273 3300025929 Unclassified 1757
66 Ga0207664_10218843 3300025929 Bacteria 1651
67 Ga0207664_10251965 3300025929 Bacteria 1541
68 Ga0207664_10579525 3300025929 Bacteria 1007
69 Ga0207664_10983893 3300025929 Unclassified 756
70 Ga0207709_10644054 3300025935 Bacteria 843
71 Ga0207704_10432176 3300025938 Bacteria 1046
72 Ga0207704_10831621 3300025938 Bacteria 773
73 Ga0207665_10550542 3300025939 Bacteria 896
74 Ga0207712_10393878 3300025961 Bacteria 1162
75 Ga0207702_10432064 3300026078 Bacteria 1275
76 Ga0207648_11107570 3300026089 Bacteria 743
77 Ga0265318_10279131 3300028577 Unclassified 609
78 Ga0265322_10175196 3300028654 Unclassified 614
79 Ga0373956_0214571 3300035119 Bacteria 913
80 Ga0373957_0446118 3300035120 Unclassified 560
81 Ga0373955_0074264 3300035172 Bacteria 1908
82 Ga0373933_0003365 3300035724 Bacteria 8914
83 Ga0373937_0025965 3300036401 Bacteria 5290
84 Ga0373937_1891484 3300036401 Unclassified 543
85 Ga0436364_0010687 3300037853 Bacteria 23927
86 Ga0436364_0072848 3300037853 Bacteria 133330
87 Ga0436364_0077549 3300037853 Unclassified 1445
88 Ga0436364_0079572 3300037853 Unclassified 843
89 Ga0436364_0325815 3300037853 Bacteria 3639
90 Ga0436364_0397395 3300037853 Bacteria 30067
91 Ga0436364_1002489 3300037853 Bacteria 550
92 Ga0436364_1112996 3300037853 Unclassified 748
93 Ga0436364_1319074 3300037853 Unclassified 1894
94 Ga0436364_1516155 3300037853 Bacteria 813
95 Ga0395901_2128119 3300038443 Bacteria 506
96 Ga0436365_0003642 3300039437 Bacteria 4400
97 Ga0436365_0029305 3300039437 Bacteria 1136
98 Ga0436365_0033729 3300039437 Bacteria 2120
99 Ga0436365_0095078 3300039437 Bacteria 7298
100 Ga0436365_0124357 3300039437 Bacteria 1702
101 Ga0436365_0219233 3300039437 Bacteria 1540
102 Ga0436365_0248508 3300039437 Bacteria 47975
103 Ga0436365_0261317 3300039437 Unclassified 781
104 Ga0436365_0310984 3300039437 Bacteria 517
105 Ga0436365_0585511 3300039437 Bacteria 1095
106 Ga0436365_0851584 3300039437 Bacteria 16779
107 Ga0436365_0922624 3300039437 Bacteria 1252
108 Ga0436365_1024886 3300039437 Unclassified 2556
109 Ga0436365_1290465 3300039437 Bacteria 1821
110 Ga0436365_1477572 3300039437 Unclassified 803
111 Ga0436360_0133895 3300039438 Bacteria 672
112 Ga0436363_0039811 3300039450 Bacteria 1548
113 Ga0436363_0198760 3300039450 Bacteria 34031
114 Ga0436363_0213304 3300039450 Bacteria 642
115 Ga0436363_0333797 3300039450 Unclassified 879
116 Ga0436363_0660184 3300039450 Bacteria 1429
117 Ga0436363_0829385 3300039450 Bacteria 2004
118 Ga0436363_1175559 3300039450 Bacteria 1292
119 Ga0436363_1255244 3300039450 Bacteria 1492
120 Ga0436363_1643533 3300039450 Bacteria 2266
121 Ga0436362_0135332 3300039453 Bacteria 8828
122 Ga0436362_0623635 3300039453 Bacteria 1392
123 Ga0436362_0651024 3300039453 Unclassified 805
124 Ga0436362_0702594 3300039453 Bacteria 3483
125 Ga0436362_0890637 3300039453 Unclassified 639
126 Ga0436362_1273823 3300039453 Bacteria 2272
127 Ga0466969_0410887 3300044656 Bacteria 615
128 Ga0466965_0191148 3300044683 Unclassified 1083
129 Ga0466965_0406789 3300044683 Bacteria 753
130 Ga0466965_0515381 3300044683 Unclassified 672
131 Ga0466965_0559734 3300044683 Bacteria 646
132 Ga0466966_0119326 3300044684 Bacteria 1621
133 Ga0466966_0123501 3300044684 Bacteria 1589
134 Ga0466966_0250806 3300044684 Archaea 1066
135 Ga0466966_0315185 3300044684 Unclassified 940
136 Ga0466966_0409014 3300044684 Bacteria 815
137 Ga0466966_0509820 3300044684 Unclassified 724
138 Ga0466966_0602732 3300044684 Bacteria 661
139 Ga0466966_0689741 3300044684 Unclassified 615
140 Ga0466961_0047292 3300044693 Bacteria 2751
141 Ga0466961_0085332 3300044693 Bacteria 1997
142 Ga0466961_0158396 3300044693 Bacteria 1412
143 Ga0466961_0271572 3300044693 Bacteria 1039
144 Ga0466961_0279191 3300044693 Bacteria 1022
145 Ga0466961_0704534 3300044693 Bacteria 605
146 Ga0466963_0002226 3300044694 Bacteria 10745
147 Ga0466963_0003564 3300044694 Bacteria 8940
148 Ga0466963_0004977 3300044694 Bacteria 7754
149 Ga0466963_0045630 3300044694 Unclassified 2887
150 Ga0466963_0179766 3300044694 Unclassified 1476
151 Ga0466963_0596617 3300044694 Unclassified 780
152 Ga0466971_0026335 3300044719 Bacteria 2598
153 Ga0466971_0088726 3300044719 Bacteria 1415
154 Ga0466971_0170842 3300044719 Bacteria 1020
155 Ga0466971_0208841 3300044719 Bacteria 923
156 Ga0466971_0615589 3300044719 Bacteria 542
157 Ga0466968_0034130 3300044735 Bacteria 2122
158 Ga0466968_0035364 3300044735 Bacteria 2090
159 Ga0466968_0050102 3300044735 Bacteria 1781
160 Ga0466968_0200909 3300044735 Unclassified 934
161 Ga0466968_0436633 3300044735 Unclassified 646
162 Ga0466970_0108916 3300044765 Bacteria 1512
163 Ga0466970_0232158 3300044765 Bacteria 1031
164 Ga0466970_0290580 3300044765 Bacteria 920
165 Ga0466957_0067561 3300044842 Bacteria 2205
166 Ga0466957_0104415 3300044842 Bacteria 1790
167 Ga0466957_0199137 3300044842 Bacteria 1315
168 Ga0466957_0450055 3300044842 Unclassified 887
169 Ga0466957_0555442 3300044842 Unclassified 800
170 Ga0466960_0070233 3300044901 Bacteria 1742
171 Ga0466960_0313637 3300044901 Bacteria 887
172 Ga0466959_0066636 3300045049 Bacteria 2612
173 Ga0466959_0072178 3300045049 Bacteria 2499
174 Ga0466959_0097587 3300045049 Bacteria 2106
175 Ga0466959_0188565 3300045049 Bacteria 1440
176 Ga0466959_0204866 3300045049 Bacteria 1372
177 Ga0466959_0294659 3300045049 Bacteria 1112
178 Ga0466959_0412333 3300045049 Unclassified 917
179 Ga0466959_0440864 3300045049 Unclassified 883
180 Ga0466959_0467941 3300045049 Unclassified 854
181 Ga0466959_0480695 3300045049 Bacteria 841
182 Ga0466959_0841694 3300045049 Unclassified 613
183 Ga0466959_0923071 3300045049 Bacteria 582
184 Ga0466958_0008838 3300045836 Bacteria 5598
185 Ga0466958_0010653 3300045836 Bacteria 5156
186 Ga0466958_0022425 3300045836 Bacteria 3699
187 Ga0466958_0066074 3300045836 Bacteria 2208
188 Ga0466958_0072058 3300045836 Bacteria 2116
189 Ga0466958_0172960 3300045836 Unclassified 1368
190 Ga0466958_0264894 3300045836 Bacteria 1100
191 Ga0466958_0273686 3300045836 Unclassified 1082
192 Ga0466958_0311448 3300045836 Unclassified 1011
193 Ga0466958_0367627 3300045836 Bacteria 927
194 Ga0466958_0386626 3300045836 Bacteria 903
195 Ga0466958_0515227 3300045836 Unclassified 776
196 Ga0466958_0644988 3300045836 Bacteria 689
197 Ga0466958_0651043 3300045836 Unclassified 686
198 Ga0466967_0074324 3300045976 Bacteria 3052
199 Ga0466967_0215794 3300045976 Bacteria 1821
200 Ga0466967_1460993 3300045976 Unclassified 681
201 Ga0466967_1864501 3300045976 Bacteria 598
202 Ga0495592_0027062 3300046454 Bacteria 4347
203 Ga0495592_0566242 3300046454 Unclassified 697
204 Ga0495629_0109236 3300046459 Bacteria 1929
205 Ga0495653_0016674 3300046463 Bacteria 5978
206 Ga0495653_0582067 3300046463 Bacteria 690
207 Ga0495582_0707961 3300046473 Bacteria 583
208 Ga0495664_0000007 3300046477 Bacteria 386710
209 Ga0495664_0199921 3300046477 Bacteria 1211
210 Ga0495664_0333184 3300046477 Bacteria 915
211 Ga0495664_0368100 3300046477 Bacteria 865
212 Ga0495594_0817506 3300046499 Bacteria 525
213 Ga0495608_0003493 3300046511 Bacteria 11263
214 Ga0495618_0089953 3300046514 Bacteria 1963
215 Ga0495628_0114138 3300046516 Bacteria 2076
216 Ga0495652_0049822 3300046529 Bacteria 3583
217 Ga0495652_0121960 3300046529 Bacteria 2077
218 Ga0495652_0605574 3300046529 Bacteria 747
219 Ga0495665_0386491 3300046531 Bacteria 711
220 Ga0495640_0046215 3300046533 Bacteria 3017
221 Ga0495640_0529329 3300046533 Bacteria 716
222 Ga0495587_0338118 3300046536 Bacteria 840
223 Ga0495587_0601737 3300046536 Bacteria 605
224 Ga0495645_0618306 3300046543 Bacteria 665
225 Ga0495645_0790124 3300046543 Bacteria 570
226 Ga0495667_0005278 3300046559 Bacteria 8738
227 Ga0495667_0527715 3300046559 Unclassified 738
228 Ga0495635_0035831 3300046663 Bacteria 3440
229 Ga0495657_0005165 3300046675 Bacteria 10340
230 Ga0495657_0872038 3300046675 Unclassified 512
231 Ga0495599_0116324 3300046678 Unclassified 1663
232 Ga0495646_0043053 3300046680 Unclassified 2767
233 Ga0495613_0381957 3300046689 Bacteria 963
234 Ga0495600_0003175 3300046809 Bacteria 9614
235 Ga0495581_0380537 3300047315 Unclassified 824
236 Ga0495604_0279518 3300047317 Bacteria 1128
237 Ga0495674_0176119 3300047319 Bacteria 1782
238 Ga0495674_0497638 3300047319 Bacteria 975
239 Ga0495680_0003217 3300047322 Bacteria 16231
240 Ga0495680_0341719 3300047322 Bacteria 1044
241 Ga0495675_0025580 3300047444 Bacteria 3762
242 Ga0495684_0010331 3300047471 Bacteria 7220
243 Ga0495593_0043689 3300047673 Bacteria 2400
244 Ga0495602_0255697 3300048088 Unclassified 1302
245 Ga0495602_0565713 3300048088 Bacteria 786
246 Ga0496101_0272687 3300048904 Bacteria 1321
247 Ga0496102_0124334 3300048905 Bacteria 2411
248 Ga0496102_0264940 3300048905 Bacteria 1620
249 Ga0496104_0194326 3300048907 Bacteria 1941
250 Ga0496104_0574060 3300048907 Bacteria 1038
251 Ga0496105_0034997 3300048908 Bacteria 4133
252 Ga0496105_0184394 3300048908 Bacteria 1708
253 Ga0496109_0108760 3300048912 Bacteria 2577
254 Ga0496109_0691685 3300048912 Unclassified 957
255 Ga0496110_0159879 3300048913 Bacteria 2042
256 Ga0496111_0482673 3300048914 Unclassified 913
257 Ga0496112_0038018 3300048915 Bacteria 4699
258 Ga0496112_0177731 3300048915 Bacteria 2093
259 Ga0496113_0076554 3300048916 Bacteria 2556
260 Ga0496113_0826801 3300048916 Unclassified 735
261 Ga0496113_0964373 3300048916 Bacteria 673
262 Ga0496115_0243442 3300048918 Bacteria 1482
263 nmdc:mga08y16_1983801_c1 3300050511 Bacteria 531
264 Ga0495601_0003037 3300053077 Bacteria 9567
265 Ga0495601_0051850 3300053077 Unclassified 2590
266 Ga0495612_0069299 3300053078 Bacteria 1469
267 Ga0495612_0152041 3300053078 Bacteria 1008
268 Ga0495612_0433264 3300053078 Bacteria 600
269 Ga0495595_0023458 3300053084 Bacteria 2716
270 Ga0495595_0588606 3300053084 Unclassified 569
271 Ga0466962_0040797 3300061719 Bacteria 2221
272 Ga0466962_0162745 3300061719 Bacteria 1085
273 Ga0466962_0365299 3300061719 Unclassified 720
274 Ga0466962_0431950 3300061719 Bacteria 662
275 Ga0436364_1562608
276 Ga0070714_100224371
277 Ga0070714_100251087
278 Ga0070714_100256809
279 Ga0070714_100341864
280 Ga0070713_100053097
281 Ga0070713_100068372
282 Ga0070713_100190789
283 Ga0070713_100222790
284 Ga0070713_100683653
285 Ga0070711_100094709
286 Ga0070711_100499416
287 Ga0070705_100089363
288 Ga0070694_100101484
289 Ga0070678_100691815
290 Ga0068867_100470018
291 Ga0070702_100159482
292 Ga0068864_100612912
293 Ga0070717_10136839
294 Ga0070717_10440353
295 Ga0070717_10470085
296 Ga0070717_10503650
297 Ga0070717_10862514
298 Ga0070716_100409286
299 Ga0070712_100152405
300 Ga0070712_100244156
301 Ga0111539_12076763
302 Ga0105245_10114306
303 Ga0105245_10931296
304 Ga0105243_10099958
305 Ga0105242_10764539
306 Ga0105249_10309999
307 Ga0105249_10771012
308 Ga0105239_11614157
309 Ga0157378_10551401
310 Ga0157372_11839490
311 Ga0157375_10131493
312 Ga0197907_10502194
313 Ga0206353_10548726
314 Ga0213873_10006532
315 Ga0213874_10000932
316 Ga0213874_10173572
317 Ga0213876_10087823
318 Ga0213876_10546983
319 Ga0213875_10000126
320 Ga0213875_10020534
321 Ga0213875_10033501
322 Ga0213875_10074384
323 Ga0213875_10091048
324 Ga0207692_10023933
325 Ga0207692_10398969
326 Ga0207671_10021403
327 Ga0207693_10002269
328 Ga0207693_10581650
329 Ga0207663_10061826
330 Ga0207687_10214145
331 Ga0207687_10294959
332 Ga0207700_10022724
333 Ga0207700_10071094
334 Ga0207700_10322572
335 Ga0207700_10567066
336 Ga0207700_11311143
337 Ga0207664_10036062
338 Ga0207664_10182246
339 Ga0207664_10192273
340 Ga0207664_10218843
341 Ga0207664_10251965
342 Ga0207664_10579525
343 Ga0207664_10983893
344 Ga0207709_10644054
345 Ga0207704_10432176
346 Ga0207704_10831621
347 Ga0207665_10550542
348 Ga0207712_10393878
349 Ga0207702_10432064
350 Ga0207648_11107570
351 Ga0265318_10279131
352 Ga0265322_10175196
353 Ga0373956_0214571
354 Ga0373957_0446118
355 Ga0373955_0074264
356 Ga0373933_0003365
357 Ga0373937_0025965
358 Ga0373937_1891484
359 Ga0436364_0010687
360 Ga0436364_0072848
361 Ga0436364_0077549
362 Ga0436364_0079572
363 Ga0436364_0325815
364 Ga0436364_0397395
365 Ga0436364_1002489
366 Ga0436364_1112996
367 Ga0436364_1319074
368 Ga0436364_1516155
369 Ga0395901_2128119
370 Ga0436365_0003642
371 Ga0436365_0029305
372 Ga0436365_0033729
373 Ga0436365_0095078
374 Ga0436365_0124357
375 Ga0436365_0219233
376 Ga0436365_0248508
377 Ga0436365_0261317
378 Ga0436365_0310984
379 Ga0436365_0585511
380 Ga0436365_0851584
381 Ga0436365_0922624
382 Ga0436365_1024886
383 Ga0436365_1290465
384 Ga0436365_1477572
385 Ga0436360_0133895
386 Ga0436363_0039811
387 Ga0436363_0198760
388 Ga0436363_0213304
389 Ga0436363_0333797
390 Ga0436363_0660184
391 Ga0436363_0829385
392 Ga0436363_1175559
393 Ga0436363_1255244
394 Ga0436363_1643533
395 Ga0436362_0135332
396 Ga0436362_0623635
397 Ga0436362_0651024
398 Ga0436362_0702594
399 Ga0436362_0890637
400 Ga0436362_1273823
401 Ga0466969_0410887
402 Ga0466965_0191148
403 Ga0466965_0406789
404 Ga0466965_0515381
405 Ga0466965_0559734
406 Ga0466966_0119326
407 Ga0466966_0123501
408 Ga0466966_0250806
409 Ga0466966_0315185
410 Ga0466966_0409014
411 Ga0466966_0509820
412 Ga0466966_0602732
413 Ga0466966_0689741
414 Ga0466961_0047292
415 Ga0466961_0085332
416 Ga0466961_0158396
417 Ga0466961_0271572
418 Ga0466961_0279191
419 Ga0466961_0704534
420 Ga0466963_0002226
421 Ga0466963_0003564
422 Ga0466963_0004977
423 Ga0466963_0045630
424 Ga0466963_0179766
425 Ga0466963_0596617
426 Ga0466971_0026335
427 Ga0466971_0088726
428 Ga0466971_0170842
429 Ga0466971_0208841
430 Ga0466971_0615589
431 Ga0466968_0034130
432 Ga0466968_0035364
433 Ga0466968_0050102
434 Ga0466968_0200909
435 Ga0466968_0436633
436 Ga0466970_0108916
437 Ga0466970_0232158
438 Ga0466970_0290580
439 Ga0466957_0067561
440 Ga0466957_0104415
441 Ga0466957_0199137
442 Ga0466957_0450055
443 Ga0466957_0555442
444 Ga0466960_0070233
445 Ga0466960_0313637
446 Ga0466959_0066636
447 Ga0466959_0072178
448 Ga0466959_0097587
449 Ga0466959_0188565
450 Ga0466959_0204866
451 Ga0466959_0294659
452 Ga0466959_0412333
453 Ga0466959_0440864
454 Ga0466959_0467941
455 Ga0466959_0480695
456 Ga0466959_0841694
457 Ga0466959_0923071
458 Ga0466958_0008838
459 Ga0466958_0010653
460 Ga0466958_0022425
461 Ga0466958_0066074
462 Ga0466958_0072058
463 Ga0466958_0172960
464 Ga0466958_0264894
465 Ga0466958_0273686
466 Ga0466958_0311448
467 Ga0466958_0367627
468 Ga0466958_0386626
469 Ga0466958_0515227
470 Ga0466958_0644988
471 Ga0466958_0651043
472 Ga0466967_0074324
473 Ga0466967_0215794
474 Ga0466967_1460993
475 Ga0466967_1864501
476 Ga0495592_0027062
477 Ga0495592_0566242
478 Ga0495629_0109236
479 Ga0495653_0016674
480 Ga0495653_0582067
481 Ga0495582_0707961
482 Ga0495664_0000007
483 Ga0495664_0199921
484 Ga0495664_0333184
485 Ga0495664_0368100
486 Ga0495594_0817506
487 Ga0495608_0003493
488 Ga0495618_0089953
489 Ga0495628_0114138
490 Ga0495652_0049822
491 Ga0495652_0121960
492 Ga0495652_0605574
493 Ga0495665_0386491
494 Ga0495640_0046215
495 Ga0495640_0529329
496 Ga0495587_0338118
497 Ga0495587_0601737
498 Ga0495645_0618306
499 Ga0495645_0790124
500 Ga0495667_0005278
501 Ga0495667_0527715
502 Ga0495635_0035831
503 Ga0495657_0005165
504 Ga0495657_0872038
505 Ga0495599_0116324
506 Ga0495646_0043053
507 Ga0495613_0381957
508 Ga0495600_0003175
509 Ga0495581_0380537
510 Ga0495604_0279518
511 Ga0495674_0176119
512 Ga0495674_0497638
513 Ga0495680_0003217
514 Ga0495680_0341719
515 Ga0495675_0025580
516 Ga0495684_0010331
517 Ga0495593_0043689
518 Ga0495602_0255697
519 Ga0495602_0565713
520 Ga0496101_0272687
521 Ga0496102_0124334
522 Ga0496102_0264940
523 Ga0496104_0194326
524 Ga0496104_0574060
525 Ga0496105_0034997
526 Ga0496105_0184394
527 Ga0496109_0108760
528 Ga0496109_0691685
529 Ga0496110_0159879
530 Ga0496111_0482673
531 Ga0496112_0038018
532 Ga0496112_0177731
533 Ga0496113_0076554
534 Ga0496113_0826801
535 Ga0496113_0964373
536 Ga0496115_0243442
537 nmdc:mga08y16_1983801_c1
538 Ga0495601_0003037
539 Ga0495601_0051850
540 Ga0495612_0069299
541 Ga0495612_0152041
542 Ga0495612_0433264
543 Ga0495595_0023458
544 Ga0495595_0588606
545 Ga0466962_0040797
546 Ga0466962_0162745
547 Ga0466962_0365299
548 Ga0466962_0431950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

36

162

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8227 42 128
3k0x-assembly1.cif.gz_A crystal structure of telomere capping protein ten1 from saccharomyces pombe 0.7783 37 126
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.7733 57 104
2awo-assembly2.cif.gz_C crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.7729 57 104
4ywk-assembly3.cif.gz_A pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted 0.765 39 110
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8227 42 128 2.40.50.140
af_Q9GUC9_20_312_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7803 60 90 3.60.10.10
af_K7VHZ3_96_226_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7794 38 132 2.40.50.140
3k0xA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7783 37 126 2.40.50.140
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7733 57 104 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0M8WI27-F1-model_v4 Cytochrome C biogenesis protein 0.8926 36 128 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A259GXA6-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.8836 37 132 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A2E6RGQ1-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.8775 5 132 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A7V9H927-F1-model_v4 Cytochrome c maturation protein CcmE 0.8712 18 138 GO:0005886
GO:0017004
GO:0020037
AF-A0A0Q7S1M6-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.8704 21 132 GO:0005886
GO:0017004
GO:0020037
GO:0046872

Map