F379875

General Info

Members Datasets Scaffolds Average Seq Length
274 173 548 125

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0000336|Ga0395905_0000336_41384_41824
Length 146
Sequence MGKGYPPAIPDDLCDNRPMPVFNFVGIVVRSIEESLAFYRLLGIEVGEPDGGPHHQVALPNGMNLAWDTVALMRELDGEWHEPTGHRMGLGFQCESPAEVDRVYAEVTGAGYTGKKAPWDAFWGQRYAQLTDPDGNTVDLFATLPA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
78 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
79 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
80 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
81 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
82 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
93 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 9.12
Rhizosphere 89.42
Stem 0
Stem Tuber 0
Unclassified 6.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0000336 3300037471 Bacteria 67199
2 Ga0070658_10361040 3300005327 Bacteria 1244
3 Ga0070682_100399390 3300005337 Bacteria 1039
4 Ga0070675_100898336 3300005354 Bacteria 812
5 Ga0070674_100393105 3300005356 Bacteria 1131
6 Ga0070673_100342940 3300005364 Bacteria 1324
7 Ga0070709_10632404 3300005434 Bacteria 827
8 Ga0070714_100149971 3300005435 Bacteria 2100
9 Ga0070713_100137481 3300005436 Bacteria 2160
10 Ga0070710_10004975 3300005437 Bacteria 6291
11 Ga0070708_100028528 3300005445 Bacteria 4803
12 Ga0070708_100094583 3300005445 Bacteria 2726
13 Ga0070708_100179316 3300005445 Bacteria 1979
14 Ga0070708_100427312 3300005445 Bacteria 1249
15 Ga0070708_100512887 3300005445 Bacteria 1131
16 Ga0070663_100275227 3300005455 Bacteria 1340
17 Ga0070706_100007050 3300005467 Bacteria 10592
18 Ga0070706_100033068 3300005467 Bacteria 4772
19 Ga0070706_100560398 3300005467 Bacteria 1063
20 Ga0070707_100019675 3300005468 Bacteria 6363
21 Ga0070707_100028820 3300005468 Bacteria 5284
22 Ga0070707_100137207 3300005468 Bacteria 2379
23 Ga0070707_100203148 3300005468 Bacteria 1931
24 Ga0070707_100408829 3300005468 Bacteria 1317
25 Ga0070707_100700027 3300005468 Bacteria 976
26 Ga0070707_101237723 3300005468 Bacteria 713
27 Ga0070698_100000615 3300005471 Bacteria 38314
28 Ga0070698_100006887 3300005471 Bacteria 12316
29 Ga0070698_100079040 3300005471 Bacteria 3286
30 Ga0070698_101451725 3300005471 Unclassified 637
31 Ga0070699_100066514 3300005518 Bacteria 3129
32 Ga0070699_100274355 3300005518 Bacteria 1510
33 Ga0070699_100498951 3300005518 Bacteria 1105
34 Ga0070699_101136151 3300005518 Unclassified 717
35 Ga0070697_100426062 3300005536 Bacteria 1153
36 Ga0070697_101025137 3300005536 Unclassified 734
37 Ga0068853_100577756 3300005539 Bacteria 1066
38 Ga0070672_100869550 3300005543 Unclassified 795
39 Ga0070686_101856288 3300005544 Bacteria 514
40 Ga0070695_100063837 3300005545 Bacteria 2395
41 Ga0070695_100362471 3300005545 Bacteria 1089
42 Ga0070695_100695550 3300005545 Bacteria 806
43 Ga0070665_101235605 3300005548 Bacteria 758
44 Ga0068854_102120638 3300005578 Bacteria 519
45 Ga0068856_100145384 3300005614 Bacteria 2379
46 Ga0068859_100664810 3300005617 Bacteria 1133
47 Ga0068864_102620238 3300005618 Bacteria 510
48 Ga0068858_100145810 3300005842 Bacteria 2223
49 Ga0070715_10002018 3300006163 Bacteria 6126
50 Ga0070716_100003623 3300006173 Bacteria 7299
51 Ga0070716_100042864 3300006173 Bacteria 2528
52 Ga0070716_101175931 3300006173 Bacteria 615
53 Ga0070712_100339708 3300006175 Bacteria 1226
54 Ga0070712_101031667 3300006175 Bacteria 712
55 Ga0075433_10030003 3300006852 Bacteria 4636
56 Ga0075434_100058025 3300006871 Bacteria 3847
57 Ga0075434_100190022 3300006871 Bacteria 2074
58 Ga0075434_101364375 3300006871 Bacteria 719
59 Ga0075434_102595959 3300006871 Bacteria 507
60 Ga0075436_100128256 3300006914 Bacteria 1778
61 Ga0075436_101315643 3300006914 Unclassified 547
62 Ga0075435_100108543 3300007076 Bacteria 2306
63 Ga0075435_100477779 3300007076 Bacteria 1076
64 Ga0099794_10000233 3300007265 Bacteria 19966
65 Ga0105245_10097520 3300009098 Bacteria 2715
66 Ga0105245_10494946 3300009098 Bacteria 1238
67 Ga0105247_10085060 3300009101 Bacteria 1999
68 Ga0105247_10640607 3300009101 Bacteria 793
69 Ga0114129_11133401 3300009147 Bacteria 978
70 Ga0105242_10161472 3300009176 Bacteria 1962
71 Ga0105242_10257669 3300009176 Bacteria 1574
72 Ga0105248_10507050 3300009177 Bacteria 1360
73 Ga0105237_10001102 3300009545 Bacteria 36155
74 Ga0105249_13087725 3300009553 Bacteria 535
75 Ga0105239_12618709 3300010375 Archaea 588
76 Ga0157373_10867126 3300013100 Bacteria 668
77 Ga0157373_10905116 3300013100 Bacteria 655
78 Ga0157373_11404682 3300013100 Unclassified 531
79 Ga0157370_10151701 3300013104 Bacteria 2156
80 Ga0157374_10072310 3300013296 Bacteria 3253
81 Ga0157378_10434726 3300013297 Bacteria 1299
82 Ga0157375_11770301 3300013308 Bacteria 732
83 Ga0163163_10722321 3300014325 Bacteria 1060
84 Ga0157380_11428371 3300014326 Bacteria 743
85 Ga0157379_10345959 3300014968 Bacteria 1360
86 Ga0157379_11342848 3300014968 Bacteria 691
87 Ga0157379_11576870 3300014968 Bacteria 640
88 Ga0157376_10194123 3300014969 Bacteria 1864
89 Ga0157376_10227844 3300014969 Bacteria 1730
90 Ga0163161_10347292 3300017792 Unclassified 1178
91 Ga0207692_10094923 3300025898 Bacteria 1625
92 Ga0207710_10333525 3300025900 Bacteria 770
93 Ga0207699_10006811 3300025906 Bacteria 5558
94 Ga0207684_10003812 3300025910 Bacteria 14539
95 Ga0207684_10048820 3300025910 Bacteria 3590
96 Ga0207684_10065785 3300025910 Bacteria 3078
97 Ga0207684_10150552 3300025910 Bacteria 2002
98 Ga0207684_10690836 3300025910 Bacteria 868
99 Ga0207671_10000010 3300025914 Bacteria 568302
100 Ga0207693_10128324 3300025915 Bacteria 1993
101 Ga0207663_10068404 3300025916 Bacteria 2280
102 Ga0207646_10000516 3300025922 Bacteria 51539
103 Ga0207646_10000701 3300025922 Bacteria 43458
104 Ga0207646_10003478 3300025922 Bacteria 17780
105 Ga0207646_10009807 3300025922 Bacteria 9430
106 Ga0207646_10046369 3300025922 Bacteria 3899
107 Ga0207646_10381384 3300025922 Bacteria 1273
108 Ga0207646_11808166 3300025922 Bacteria 522
109 Ga0207687_10170012 3300025927 Bacteria 1680
110 Ga0207664_10133768 3300025929 Bacteria 2090
111 Ga0207686_10518288 3300025934 Bacteria 927
112 Ga0207669_11244015 3300025937 Bacteria 631
113 Ga0207704_10412313 3300025938 Bacteria 1069
114 Ga0207665_10000420 3300025939 Bacteria 29260
115 Ga0207665_10057432 3300025939 Bacteria 2629
116 Ga0207640_10201475 3300025981 Bacteria 1509
117 Ga0207639_10309622 3300026041 Bacteria 1399
118 Ga0207678_10615857 3300026067 Bacteria 952
119 Ga0207678_10660278 3300026067 Bacteria 919
120 Ga0207702_10622462 3300026078 Bacteria 1060
121 Ga0207702_12087330 3300026078 Bacteria 556
122 Ga0207641_10893241 3300026088 Unclassified 882
123 Ga0209588_1000090 3300027671 Bacteria 28620
124 Ga0268266_10739598 3300028379 Bacteria 949
125 Ga0307408_100260042 3300031548 Bacteria 1436
126 Ga0307416_100077088 3300032002 Bacteria 2798
127 Ga0373959_0020159 3300034820 Bacteria 1270
128 Ga0373940_0286800 3300035088 Bacteria 564
129 Ga0373944_0015402 3300035089 Bacteria 2145
130 Ga0373944_0036960 3300035089 Bacteria 1494
131 Ga0373944_0376902 3300035089 Bacteria 544
132 Ga0373951_0061002 3300035091 Bacteria 944
133 Ga0373941_0355540 3300035115 Bacteria 597
134 Ga0373960_0219877 3300035121 Bacteria 679
135 Ga0373943_0005843 3300035170 Bacteria 5527
136 Ga0373943_0259193 3300035170 Bacteria 978
137 Ga0373946_0002458 3300035171 Bacteria 6553
138 Ga0373946_0784079 3300035171 Bacteria 501
139 Ga0373955_0081772 3300035172 Bacteria 1827
140 Ga0373927_0011854 3300035695 Bacteria 5807
141 Ga0373927_0055210 3300035695 Bacteria 2569
142 Ga0373927_0404559 3300035695 Bacteria 900
143 Ga0373937_0009630 3300036401 Bacteria 8414
144 Ga0373925_0095850 3300037068 Bacteria 2273
145 Ga0373925_0825769 3300037068 Bacteria 764
146 Ga0395900_0211994 3300037418 Bacteria 1956
147 Ga0395898_0056689 3300037466 Bacteria 3819
148 Ga0395901_1480985 3300038443 Unclassified 635
149 Ga0451798_0066055 3300041458 Bacteria 608
150 Ga0451839_0194264 3300041496 Unclassified 568
151 Ga0451853_2634641 3300041512 Unclassified 1469
152 Ga0466966_0205646 3300044684 Bacteria 1190
153 Ga0466966_0908046 3300044684 Bacteria 531
154 Ga0466961_0003702 3300044693 Bacteria 9550
155 Ga0466961_0916446 3300044693 Bacteria 522
156 Ga0466963_0004180 3300044694 Bacteria 8359
157 Ga0466963_0008325 3300044694 Bacteria 6212
158 Ga0466963_0019188 3300044694 Bacteria 4284
159 Ga0466963_0102971 3300044694 Bacteria 1955
160 Ga0466963_1190087 3300044694 Bacteria 535
161 Ga0466964_0132462 3300044706 Bacteria 1137
162 Ga0466971_0041711 3300044719 Bacteria 2061
163 Ga0466971_0124101 3300044719 Bacteria 1196
164 Ga0466968_0011357 3300044735 Bacteria 3467
165 Ga0466970_0005859 3300044765 Bacteria 6117
166 Ga0466970_0317694 3300044765 Bacteria 880
167 Ga0466970_0502651 3300044765 Bacteria 698
168 Ga0466957_0011889 3300044842 Bacteria 5030
169 Ga0466957_0054125 3300044842 Bacteria 2448
170 Ga0466957_0201017 3300044842 Bacteria 1309
171 Ga0466959_0015897 3300045049 Bacteria 5491
172 Ga0466958_0005412 3300045836 Bacteria 6865
173 Ga0466958_0012621 3300045836 Bacteria 4788
174 Ga0466958_0017238 3300045836 Bacteria 4171
175 Ga0466958_0255264 3300045836 Bacteria 1122
176 Ga0466958_0644254 3300045836 Bacteria 690
177 Ga0466967_0014686 3300045976 Bacteria 6113
178 Ga0466967_0018838 3300045976 Bacteria 5532
179 Ga0466967_0094423 3300045976 Bacteria 2724
180 Ga0466967_0746564 3300045976 Bacteria 970
181 Ga0466967_0800922 3300045976 Bacteria 935
182 Ga0466967_0987015 3300045976 Bacteria 838
183 Ga0495592_0093926 3300046454 Bacteria 2147
184 Ga0495603_0247231 3300046455 Unclassified 1027
185 Ga0495629_0335569 3300046459 Bacteria 1032
186 Ga0495641_0591386 3300046461 Bacteria 507
187 Ga0495651_0114889 3300046462 Bacteria 1985
188 Ga0495653_0001446 3300046463 Bacteria 18517
189 Ga0495653_0063153 3300046463 Bacteria 2796
190 Ga0495580_0347280 3300046472 Bacteria 1005
191 Ga0495662_0300653 3300046476 Unclassified 789
192 Ga0495664_0521848 3300046477 Unclassified 709
193 Ga0495608_0011699 3300046511 Bacteria 6104
194 Ga0495618_0002172 3300046514 Bacteria 12829
195 Ga0495618_0068675 3300046514 Bacteria 2253
196 Ga0495628_0048490 3300046516 Bacteria 3366
197 Ga0495630_0470931 3300046517 Unclassified 963
198 Ga0495630_1024577 3300046517 Bacteria 627
199 Ga0495644_0138040 3300046523 Bacteria 931
200 Ga0495652_0003999 3300046529 Bacteria 14269
201 Ga0495652_0078916 3300046529 Bacteria 2723
202 Ga0495586_0038808 3300046535 Bacteria 2559
203 Ga0495587_0038983 3300046536 Bacteria 2846
204 Ga0495645_0000046 3300046543 Bacteria 89390
205 Ga0495667_0055648 3300046559 Bacteria 2602
206 Ga0495667_0491559 3300046559 Bacteria 769
207 Ga0495667_0972043 3300046559 Unclassified 519
208 Ga0495668_0738091 3300046616 Bacteria 545
209 Ga0495635_0225825 3300046663 Bacteria 1265
210 Ga0495657_0019726 3300046675 Bacteria 4860
211 Ga0495599_0026957 3300046678 Bacteria 3600
212 Ga0495623_0000251 3300046679 Bacteria 34583
213 Ga0495646_0126692 3300046680 Bacteria 1440
214 Ga0495647_0049410 3300046681 Bacteria 1629
215 Ga0495624_0271939 3300046690 Bacteria 1023
216 Ga0495600_0084946 3300046809 Bacteria 2065
217 Ga0495581_0010257 3300047315 Bacteria 5419
218 Ga0495581_0011521 3300047315 Bacteria 5116
219 Ga0495604_0000060 3300047317 Bacteria 95444
220 Ga0495604_0885361 3300047317 Bacteria 558
221 Ga0495674_0832070 3300047319 Bacteria 716
222 Ga0495676_0055798 3300047321 Bacteria 3129
223 Ga0495680_0003790 3300047322 Bacteria 14700
224 Ga0495680_0072080 3300047322 Bacteria 2628
225 Ga0495675_0005001 3300047444 Bacteria 8067
226 Ga0495602_0014415 3300048088 Bacteria 8023
227 Ga0495614_0006112 3300048089 Bacteria 5414
228 Ga0496100_0002820 3300048903 Bacteria 8910
229 Ga0496101_0015044 3300048904 Bacteria 5207
230 Ga0496101_0432464 3300048904 Bacteria 1038
231 Ga0496102_0008982 3300048905 Bacteria 8576
232 Ga0496103_0054243 3300048906 Bacteria 2485
233 Ga0496104_0346839 3300048907 Bacteria 1397
234 Ga0496105_0059607 3300048908 Bacteria 3149
235 Ga0496105_0511275 3300048908 Unclassified 942
236 Ga0496106_0250135 3300048909 Bacteria 1417
237 Ga0496107_0016421 3300048910 Bacteria 5198
238 Ga0496108_0014661 3300048911 Bacteria 6399
239 Ga0496109_0082582 3300048912 Bacteria 2961
240 Ga0496109_0616075 3300048912 Bacteria 1022
241 Ga0496110_0021072 3300048913 Bacteria 5510
242 Ga0496110_0410235 3300048913 Bacteria 1235
243 Ga0496111_0079770 3300048914 Bacteria 2388
244 Ga0496112_0052634 3300048915 Bacteria 3996
245 Ga0496112_0484324 3300048915 Bacteria 1173
246 Ga0496112_0531246 3300048915 Bacteria 1110
247 Ga0496113_0008647 3300048916 Bacteria 6641
248 Ga0496113_0173193 3300048916 Bacteria 1710
249 Ga0496114_0083112 3300048917 Bacteria 2708
250 Ga0496115_0025146 3300048918 Bacteria 4634
251 Ga0496115_0058718 3300048918 Bacteria 3096
252 Ga0501075_1047051 3300049591 Bacteria 620
253 Ga0501076_0361791 3300049592 Unclassified 1192
254 Ga0501080_1720300 3300049742 Bacteria 529
255 nmdc:mga05p37_403299_c1 3300050507 Bacteria 1596
256 nmdc:mga05p37_888787_c1 3300050507 Bacteria 962
257 nmdc:mga0n895_1149159_c1 3300050512 Bacteria 752
258 nmdc:mga0n895_1209852_c1 3300050512 Bacteria 729
259 nmdc:mga0n895_158113_c1 3300050512 Bacteria 2297
260 nmdc:mga0rr50_60664_c1 3300050513 Bacteria 2846
261 nmdc:mga0a205_1005559_c1 3300050515 Bacteria 681
262 Ga0495601_0000328 3300053077 Bacteria 25250
263 Ga0495601_0155441 3300053077 Bacteria 1493
264 Ga0495612_0001001 3300053078 Bacteria 11620
265 Ga0495595_0046954 3300053084 Bacteria 1991
266 Ga0495619_0001216 3300053085 Bacteria 16868
267 Ga0495619_0247466 3300053085 Unclassified 1235
268 Ga0500566_0317227 3300053094 Bacteria 727
269 Ga0500616_0000052 3300053153 Bacteria 295313
270 Ga0501084_1005002 3300054114 Bacteria 701
271 Ga0590077_160186 3300059426 Bacteria 540
272 Ga0466962_0015369 3300061719 Bacteria 3690
273 Ga0466962_0019954 3300061719 Bacteria 3221
274 Ga0466962_0068201 3300061719 Bacteria 1698
275 Ga0395905_0000336
276 Ga0070658_10361040
277 Ga0070682_100399390
278 Ga0070675_100898336
279 Ga0070674_100393105
280 Ga0070673_100342940
281 Ga0070709_10632404
282 Ga0070714_100149971
283 Ga0070713_100137481
284 Ga0070710_10004975
285 Ga0070708_100028528
286 Ga0070708_100094583
287 Ga0070708_100179316
288 Ga0070708_100427312
289 Ga0070708_100512887
290 Ga0070663_100275227
291 Ga0070706_100007050
292 Ga0070706_100033068
293 Ga0070706_100560398
294 Ga0070707_100019675
295 Ga0070707_100028820
296 Ga0070707_100137207
297 Ga0070707_100203148
298 Ga0070707_100408829
299 Ga0070707_100700027
300 Ga0070707_101237723
301 Ga0070698_100000615
302 Ga0070698_100006887
303 Ga0070698_100079040
304 Ga0070698_101451725
305 Ga0070699_100066514
306 Ga0070699_100274355
307 Ga0070699_100498951
308 Ga0070699_101136151
309 Ga0070697_100426062
310 Ga0070697_101025137
311 Ga0068853_100577756
312 Ga0070672_100869550
313 Ga0070686_101856288
314 Ga0070695_100063837
315 Ga0070695_100362471
316 Ga0070695_100695550
317 Ga0070665_101235605
318 Ga0068854_102120638
319 Ga0068856_100145384
320 Ga0068859_100664810
321 Ga0068864_102620238
322 Ga0068858_100145810
323 Ga0070715_10002018
324 Ga0070716_100003623
325 Ga0070716_100042864
326 Ga0070716_101175931
327 Ga0070712_100339708
328 Ga0070712_101031667
329 Ga0075433_10030003
330 Ga0075434_100058025
331 Ga0075434_100190022
332 Ga0075434_101364375
333 Ga0075434_102595959
334 Ga0075436_100128256
335 Ga0075436_101315643
336 Ga0075435_100108543
337 Ga0075435_100477779
338 Ga0099794_10000233
339 Ga0105245_10097520
340 Ga0105245_10494946
341 Ga0105247_10085060
342 Ga0105247_10640607
343 Ga0114129_11133401
344 Ga0105242_10161472
345 Ga0105242_10257669
346 Ga0105248_10507050
347 Ga0105237_10001102
348 Ga0105249_13087725
349 Ga0105239_12618709
350 Ga0157373_10867126
351 Ga0157373_10905116
352 Ga0157373_11404682
353 Ga0157370_10151701
354 Ga0157374_10072310
355 Ga0157378_10434726
356 Ga0157375_11770301
357 Ga0163163_10722321
358 Ga0157380_11428371
359 Ga0157379_10345959
360 Ga0157379_11342848
361 Ga0157379_11576870
362 Ga0157376_10194123
363 Ga0157376_10227844
364 Ga0163161_10347292
365 Ga0207692_10094923
366 Ga0207710_10333525
367 Ga0207699_10006811
368 Ga0207684_10003812
369 Ga0207684_10048820
370 Ga0207684_10065785
371 Ga0207684_10150552
372 Ga0207684_10690836
373 Ga0207671_10000010
374 Ga0207693_10128324
375 Ga0207663_10068404
376 Ga0207646_10000516
377 Ga0207646_10000701
378 Ga0207646_10003478
379 Ga0207646_10009807
380 Ga0207646_10046369
381 Ga0207646_10381384
382 Ga0207646_11808166
383 Ga0207687_10170012
384 Ga0207664_10133768
385 Ga0207686_10518288
386 Ga0207669_11244015
387 Ga0207704_10412313
388 Ga0207665_10000420
389 Ga0207665_10057432
390 Ga0207640_10201475
391 Ga0207639_10309622
392 Ga0207678_10615857
393 Ga0207678_10660278
394 Ga0207702_10622462
395 Ga0207702_12087330
396 Ga0207641_10893241
397 Ga0209588_1000090
398 Ga0268266_10739598
399 Ga0307408_100260042
400 Ga0307416_100077088
401 Ga0373959_0020159
402 Ga0373940_0286800
403 Ga0373944_0015402
404 Ga0373944_0036960
405 Ga0373944_0376902
406 Ga0373951_0061002
407 Ga0373941_0355540
408 Ga0373960_0219877
409 Ga0373943_0005843
410 Ga0373943_0259193
411 Ga0373946_0002458
412 Ga0373946_0784079
413 Ga0373955_0081772
414 Ga0373927_0011854
415 Ga0373927_0055210
416 Ga0373927_0404559
417 Ga0373937_0009630
418 Ga0373925_0095850
419 Ga0373925_0825769
420 Ga0395900_0211994
421 Ga0395898_0056689
422 Ga0395901_1480985
423 Ga0451798_0066055
424 Ga0451839_0194264
425 Ga0451853_2634641
426 Ga0466966_0205646
427 Ga0466966_0908046
428 Ga0466961_0003702
429 Ga0466961_0916446
430 Ga0466963_0004180
431 Ga0466963_0008325
432 Ga0466963_0019188
433 Ga0466963_0102971
434 Ga0466963_1190087
435 Ga0466964_0132462
436 Ga0466971_0041711
437 Ga0466971_0124101
438 Ga0466968_0011357
439 Ga0466970_0005859
440 Ga0466970_0317694
441 Ga0466970_0502651
442 Ga0466957_0011889
443 Ga0466957_0054125
444 Ga0466957_0201017
445 Ga0466959_0015897
446 Ga0466958_0005412
447 Ga0466958_0012621
448 Ga0466958_0017238
449 Ga0466958_0255264
450 Ga0466958_0644254
451 Ga0466967_0014686
452 Ga0466967_0018838
453 Ga0466967_0094423
454 Ga0466967_0746564
455 Ga0466967_0800922
456 Ga0466967_0987015
457 Ga0495592_0093926
458 Ga0495603_0247231
459 Ga0495629_0335569
460 Ga0495641_0591386
461 Ga0495651_0114889
462 Ga0495653_0001446
463 Ga0495653_0063153
464 Ga0495580_0347280
465 Ga0495662_0300653
466 Ga0495664_0521848
467 Ga0495608_0011699
468 Ga0495618_0002172
469 Ga0495618_0068675
470 Ga0495628_0048490
471 Ga0495630_0470931
472 Ga0495630_1024577
473 Ga0495644_0138040
474 Ga0495652_0003999
475 Ga0495652_0078916
476 Ga0495586_0038808
477 Ga0495587_0038983
478 Ga0495645_0000046
479 Ga0495667_0055648
480 Ga0495667_0491559
481 Ga0495667_0972043
482 Ga0495668_0738091
483 Ga0495635_0225825
484 Ga0495657_0019726
485 Ga0495599_0026957
486 Ga0495623_0000251
487 Ga0495646_0126692
488 Ga0495647_0049410
489 Ga0495624_0271939
490 Ga0495600_0084946
491 Ga0495581_0010257
492 Ga0495581_0011521
493 Ga0495604_0000060
494 Ga0495604_0885361
495 Ga0495674_0832070
496 Ga0495676_0055798
497 Ga0495680_0003790
498 Ga0495680_0072080
499 Ga0495675_0005001
500 Ga0495602_0014415
501 Ga0495614_0006112
502 Ga0496100_0002820
503 Ga0496101_0015044
504 Ga0496101_0432464
505 Ga0496102_0008982
506 Ga0496103_0054243
507 Ga0496104_0346839
508 Ga0496105_0059607
509 Ga0496105_0511275
510 Ga0496106_0250135
511 Ga0496107_0016421
512 Ga0496108_0014661
513 Ga0496109_0082582
514 Ga0496109_0616075
515 Ga0496110_0021072
516 Ga0496110_0410235
517 Ga0496111_0079770
518 Ga0496112_0052634
519 Ga0496112_0484324
520 Ga0496112_0531246
521 Ga0496113_0008647
522 Ga0496113_0173193
523 Ga0496114_0083112
524 Ga0496115_0025146
525 Ga0496115_0058718
526 Ga0501075_1047051
527 Ga0501076_0361791
528 Ga0501080_1720300
529 nmdc:mga05p37_403299_c1
530 nmdc:mga05p37_888787_c1
531 nmdc:mga0n895_1149159_c1
532 nmdc:mga0n895_1209852_c1
533 nmdc:mga0n895_158113_c1
534 nmdc:mga0rr50_60664_c1
535 nmdc:mga0a205_1005559_c1
536 Ga0495601_0000328
537 Ga0495601_0155441
538 Ga0495612_0001001
539 Ga0495595_0046954
540 Ga0495619_0001216
541 Ga0495619_0247466
542 Ga0500566_0317227
543 Ga0500616_0000052
544 Ga0501084_1005002
545 Ga0590077_160186
546 Ga0466962_0015369
547 Ga0466962_0019954
548 Ga0466962_0068201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

140

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a4x-assembly1.cif.gz_B crystal structure of mitomycin c-binding protein complexed with metal-free bleomycin a2 0.9468 1 126
1kll-assembly1.cif.gz_A-2 molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.9448 2 126
2a4x-assembly1.cif.gz_B crystal structure of mitomycin c-binding protein complexed with metal-free bleomycin a2 0.9397 1 126
1kll-assembly1.cif.gz_A-2 molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.9306 2 126
3bqx-assembly1.cif.gz_A-2 high resolution crystal structure of a glyoxalase-related enzyme from fulvimarina pelagi 0.8578 1 124
ID Description Score Start End Superfamily
2a4xB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9468 1 126 3.10.180.10
2a4xB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9397 1 126 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8972 70 122 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8971 70 126 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8873 71 123 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A535JZ30-F1-model_v4 Glyoxalase 0.9741 1 126
AF-A0A1Q3MS16-F1-model_v4 Glyoxalase 0.9723 1 126
AF-A0A535RUY1-F1-model_v4 Glyoxalase 0.9719 1 126
AF-A0A535H5H0-F1-model_v4 Glyoxalase 0.9703 14 126
AF-A0A1C5GSY7-F1-model_v4 Glyoxalase-like domain-containing protein 0.9685 1 126

Map