F379740

General Info

Members Datasets Scaffolds Average Seq Length
274 218 548 387

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10240018|Ga0163163_102400182
Length 449
Sequence VAGARARSLPWRYARQHPTDRNRASYPLVGCRCLTFLLSPATGNGHAGIFVRSALSGRFLRRERRTTMNVDQTVRTFLDFYRERGHQLVPEHSLVPPPGDPVLFTTSGMHPLTPYLSGRTHPQGPRLVNLQRCLRTTDLDEVGDDTHLTVFQMLGSWSLGSYPGVQSLTWGYELMRDGFGIGSDRLHVTVHQDDLESLRTWERIGVPVERTRDENWWSNGPTGPCGPDSEIFVWTGDTPPRGTPTTDPRWTEVWNHVMMRYLRHEDGSLEPVEPERVDTGMGVERILTILQRKRSVFETDVFRPWSLGKLWPLDERSRRVLTDHLRSSVVVIGDGVRPSPNGRGYVLRRLIXXXXTRLWRVDQEWTLGDLPTEPIEFTIDHFGQRLEVGPVREVLLTEEDRFRGLVKRGRPVVSRRRSRGPLTDDDFSYLHDTYGLPRDLVVDLLEEPA

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
92 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
93 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
112 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
175 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
176 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
177 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
178 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
179 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
180 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
181 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
182 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
183 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
184 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
185 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
186 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
189 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
190 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
191 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
192 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
193 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
194 2643221647 Streptomyces sp. Root369 Isolate Unclassified
195 2643221692 Nocardia sp. Root136 Isolate Unclassified
196 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
197 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
198 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
199 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
200 2808606448 Streptomyces sp. 193411 Isolate Unclassified
201 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
202 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
203 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
204 2867428634 Streptomyces sp. RP5T Isolate Unclassified
205 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
206 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
207 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
208 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
209 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
210 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
211 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
212 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
213 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
214 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
215 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
216 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
217 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
218 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.15
Metatranscriptomes 0
Isolates 9.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.57
Nodule 0.36
Rhizoplane 3.28
Rhizosphere 79.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10240018 3300014325 Bacteria 1862
2 rootH1_10068745 3300003323 Bacteria 2813
3 rootH1_10288229 3300003323 Bacteria 1700
4 Ga0070683_100017274 3300005329 Bacteria 6376
5 Ga0070670_100077296 3300005331 Bacteria 2860
6 Ga0068868_100011742 3300005338 Bacteria 6383
7 Ga0070661_100033000 3300005344 Bacteria 3750
8 Ga0070692_10004694 3300005345 Bacteria 5728
9 Ga0070668_100025140 3300005347 Bacteria 4514
10 Ga0070675_100007215 3300005354 Bacteria 8568
11 Ga0070659_100021082 3300005366 Bacteria 4957
12 Ga0070709_10000543 3300005434 Bacteria 22085
13 Ga0070714_100023318 3300005435 Bacteria 5082
14 Ga0070713_100011776 3300005436 Bacteria 6389
15 Ga0070711_100016567 3300005439 Bacteria 4681
16 Ga0070694_100057322 3300005444 Bacteria 2648
17 Ga0070663_100007397 3300005455 Bacteria 6682
18 Ga0070662_100017337 3300005457 Bacteria 4855
19 Ga0070681_10371727 3300005458 Bacteria 1340
20 Ga0070706_100008215 3300005467 Bacteria 9734
21 Ga0070706_100370035 3300005467 Bacteria 1335
22 Ga0070707_100214263 3300005468 Bacteria 1877
23 Ga0070684_100001089 3300005535 Bacteria 19453
24 Ga0070684_100142404 3300005535 Bacteria 2168
25 Ga0070665_100068409 3300005548 Bacteria 3561
26 Ga0070664_100001144 3300005564 Bacteria 21010
27 Ga0070664_100170423 3300005564 Bacteria 1931
28 Ga0068856_100062904 3300005614 Bacteria 3666
29 Ga0070702_100010876 3300005615 Bacteria 4504
30 Ga0068852_100071601 3300005616 Bacteria 3045
31 Ga0068864_100011038 3300005618 Bacteria 7466
32 Ga0081455_10163054 3300005937 Bacteria 1706
33 Ga0070717_10121151 3300006028 Bacteria 2241
34 Ga0070715_10015465 3300006163 Bacteria 2846
35 Ga0070716_100018872 3300006173 Bacteria 3597
36 Ga0075428_100005309 3300006844 Bacteria 14321
37 Ga0075428_100022965 3300006844 Bacteria 6903
38 Ga0075430_100015376 3300006846 Bacteria 6515
39 Ga0075431_100022045 3300006847 Bacteria 6513
40 Ga0075431_100022280 3300006847 Bacteria 6475
41 Ga0075433_10141667 3300006852 Bacteria 2137
42 Ga0075429_100010307 3300006880 Bacteria 8084
43 Ga0075429_100011543 3300006880 Bacteria 7662
44 Ga0075429_100012350 3300006880 Bacteria 7409
45 Ga0099826_10098612 3300006948 Bacteria 1768
46 Ga0075435_100032937 3300007076 Bacteria 4095
47 Ga0111539_10003945 3300009094 Bacteria 19499
48 Ga0105245_10006999 3300009098 Bacteria 9895
49 Ga0114129_10000128 3300009147 Bacteria 77291
50 Ga0114129_10024989 3300009147 Bacteria 8469
51 Ga0105248_10010154 3300009177 Bacteria 10369
52 Ga0207692_10003499 3300025898 Bacteria 6141
53 Ga0207692_10014738 3300025898 Bacteria 3422
54 Ga0207685_10040430 3300025905 Bacteria 1738
55 Ga0207699_10018799 3300025906 Bacteria 3669
56 Ga0207699_10059882 3300025906 Bacteria 2284
57 Ga0207643_10130994 3300025908 Bacteria 1492
58 Ga0207693_10066599 3300025915 Bacteria 2820
59 Ga0207657_10027919 3300025919 Bacteria 5160
60 Ga0207650_10077330 3300025925 Bacteria 2516
61 Ga0207659_10004764 3300025926 Bacteria 8225
62 Ga0207687_10006840 3300025927 Bacteria 7512
63 Ga0207700_10065636 3300025928 Bacteria 2770
64 Ga0207664_10033189 3300025929 Bacteria 3963
65 Ga0207664_10037274 3300025929 Bacteria 3761
66 Ga0207706_10029917 3300025933 Bacteria 4860
67 Ga0207704_10196001 3300025938 Bacteria 1474
68 Ga0207665_10027046 3300025939 Bacteria 3789
69 Ga0207711_10063014 3300025941 Bacteria 3199
70 Ga0207689_10022607 3300025942 Bacteria 5283
71 Ga0207661_10086777 3300025944 Bacteria 2598
72 Ga0207679_10157491 3300025945 Bacteria 1856
73 Ga0207668_10065257 3300025972 Bacteria 2576
74 Ga0207677_10007496 3300026023 Bacteria 6043
75 Ga0207703_10012364 3300026035 Bacteria 6652
76 Ga0207703_10060492 3300026035 Bacteria 3098
77 Ga0207678_10015569 3300026067 Bacteria 6687
78 Ga0207702_10020183 3300026078 Bacteria 5519
79 Ga0207428_10034249 3300027907 Bacteria 4164
80 Ga0268264_10112032 3300028381 Bacteria 2392
81 Ga0307517_10005176 3300028786 Bacteria 19780
82 Ga0307517_10008743 3300028786 Bacteria 14491
83 Ga0307515_10000325 3300028794 Bacteria 118141
84 Ga0307511_10000010 3300030521 Bacteria 146716
85 Ga0307513_10041385 3300031456 Bacteria 5086
86 Ga0307509_10005887 3300031507 Bacteria 16797
87 Ga0307509_10006748 3300031507 Bacteria 15291
88 Ga0307509_10007319 3300031507 Bacteria 14483
89 Ga0307509_10130550 3300031507 Bacteria 2469
90 Ga0307508_10129600 3300031616 Bacteria 2126
91 Ga0316576_10002483 3300031727 Bacteria 10494
92 Ga0307516_10017306 3300031730 Bacteria 7521
93 Ga0307518_10007835 3300031838 Bacteria 7633
94 Ga0307518_10112530 3300031838 Bacteria 1938
95 Ga0307416_100166241 3300032002 Bacteria 2047
96 Ga0307415_100058593 3300032126 Bacteria 2652
97 Ga0307507_10018050 3300033179 Bacteria 8054
98 Ga0307510_10036053 3300033180 Bacteria 5511
99 Ga0307510_10048150 3300033180 Bacteria 4553
100 Ga0307510_10079308 3300033180 Bacteria 3203
101 Ga0373934_0037539 3300035086 Bacteria 1907
102 Ga0373936_0001068 3300035113 Bacteria 9812
103 Ga0373955_0083195 3300035172 Bacteria 1812
104 Ga0373924_0001148 3300035410 Bacteria 8495
105 Ga0373935_0035060 3300035692 Bacteria 3130
106 Ga0373933_0001842 3300035724 Bacteria 12269
107 Ga0373937_0195186 3300036401 Bacteria 1902
108 Ga0373925_0271948 3300037068 Bacteria 1363
109 Ga0395898_0040182 3300037466 Bacteria 4627
110 Ga0439449_0078086 3300042007 Bacteria 1221
111 Ga0439455_0003960 3300042012 Bacteria 2889
112 Ga0450903_001365 3300042138 Bacteria 4567
113 Ga0439458_0002597 3300042157 Bacteria 4369
114 Ga0439458_0012709 3300042157 Bacteria 1892
115 Ga0466971_0005841 3300044719 Bacteria 5358
116 Ga0495592_0017693 3300046454 Bacteria 5415
117 Ga0495603_0002987 3300046455 Bacteria 10008
118 Ga0495629_0001539 3300046459 Bacteria 18105
119 Ga0495629_0016856 3300046459 Bacteria 5243
120 Ga0495629_0021544 3300046459 Bacteria 4599
121 Ga0495641_0015768 3300046461 Bacteria 4010
122 Ga0495651_0001958 3300046462 Bacteria 15921
123 Ga0495651_0028336 3300046462 Bacteria 4365
124 Ga0495653_0091399 3300046463 Bacteria 2225
125 Ga0495582_0005545 3300046473 Bacteria 7028
126 Ga0495662_0001297 3300046476 Bacteria 12369
127 Ga0495662_0004933 3300046476 Bacteria 6677
128 Ga0495664_0001604 3300046477 Bacteria 12025
129 Ga0495664_0080413 3300046477 Bacteria 1953
130 Ga0495594_0104044 3300046499 Bacteria 1598
131 Ga0495607_0041893 3300046501 Bacteria 2717
132 Ga0495583_0017624 3300046506 Bacteria 3785
133 Ga0495618_0166747 3300046514 Bacteria 1402
134 Ga0495628_0148424 3300046516 Bacteria 1787
135 Ga0495628_0255150 3300046516 Bacteria 1308
136 Ga0495630_0117607 3300046517 Bacteria 2015
137 Ga0495631_0027864 3300046518 Bacteria 2581
138 Ga0495632_0021934 3300046519 Bacteria 3432
139 Ga0495637_0078187 3300046520 Bacteria 1323
140 Ga0495643_0007869 3300046522 Bacteria 6814
141 Ga0495648_0112027 3300046524 Bacteria 1483
142 Ga0495652_0035423 3300046529 Bacteria 4345
143 Ga0495652_0077061 3300046529 Bacteria 2764
144 Ga0495586_0041249 3300046535 Bacteria 2485
145 Ga0495587_0000737 3300046536 Bacteria 21915
146 Ga0495609_0080302 3300046538 Bacteria 1426
147 Ga0495645_0057998 3300046543 Bacteria 2809
148 Ga0495622_0006740 3300046557 Bacteria 5326
149 Ga0495633_0104329 3300046558 Bacteria 1315
150 Ga0495634_0045654 3300046642 Bacteria 2960
151 Ga0495634_0071248 3300046642 Bacteria 2289
152 Ga0495634_0127099 3300046642 Bacteria 1628
153 Ga0495625_0003955 3300046660 Bacteria 14238
154 Ga0495625_0140897 3300046660 Bacteria 1627
155 Ga0495635_0000315 3300046663 Bacteria 31453
156 Ga0495635_0212322 3300046663 Bacteria 1310
157 Ga0495657_0000740 3300046675 Bacteria 29071
158 Ga0495599_0078570 3300046678 Bacteria 2060
159 Ga0495646_0002757 3300046680 Bacteria 10861
160 Ga0495646_0086438 3300046680 Bacteria 1818
161 Ga0495658_0084925 3300046683 Bacteria 1865
162 Ga0495613_0072932 3300046689 Bacteria 2502
163 Ga0495624_0058848 3300046690 Bacteria 2412
164 Ga0495624_0083769 3300046690 Bacteria 1971
165 Ga0495670_0011177 3300046691 Bacteria 4413
166 Ga0495589_0023330 3300046794 Bacteria 3154
167 Ga0495600_0004053 3300046809 Bacteria 8708
168 Ga0495600_0038554 3300046809 Bacteria 3110
169 Ga0495660_0031463 3300046810 Bacteria 2983
170 Ga0495581_0001612 3300047315 Bacteria 12582
171 Ga0495604_0000708 3300047317 Bacteria 28349
172 Ga0495636_0012681 3300047318 Bacteria 3338
173 Ga0495674_0101775 3300047319 Bacteria 2443
174 Ga0495676_0006273 3300047321 Bacteria 10940
175 Ga0495676_0007580 3300047321 Bacteria 9947
176 Ga0495676_0013149 3300047321 Bacteria 7444
177 Ga0495680_0006815 3300047322 Bacteria 10549
178 Ga0495687_003463 3300047443 Bacteria 11405
179 Ga0495687_008857 3300047443 Bacteria 5703
180 Ga0495675_0003718 3300047444 Bacteria 9220
181 Ga0495685_000361 3300047447 Bacteria 14462
182 Ga0495685_005461 3300047447 Bacteria 4152
183 Ga0495685_014373 3300047447 Bacteria 2689
184 Ga0495681_0004377 3300047470 Bacteria 9646
185 Ga0495681_0013930 3300047470 Bacteria 4639
186 Ga0495684_0003627 3300047471 Bacteria 12033
187 Ga0495684_0103474 3300047471 Bacteria 2152
188 Ga0495686_0046044 3300047472 Bacteria 2759
189 Ga0495686_0064225 3300047472 Bacteria 2273
190 Ga0495593_0001258 3300047673 Bacteria 14860
191 Ga0495593_0035449 3300047673 Bacteria 2709
192 Ga0495614_0007818 3300048089 Bacteria 4753
193 Ga0495614_0012143 3300048089 Bacteria 3782
194 Ga0495614_0027601 3300048089 Bacteria 2447
195 Ga0496102_0014429 3300048905 Bacteria 6864
196 Ga0496102_0085059 3300048905 Bacteria 2920
197 Ga0496105_0002271 3300048908 Bacteria 13940
198 Ga0496108_0006932 3300048911 Bacteria 9173
199 Ga0496109_0107285 3300048912 Bacteria 2594
200 Ga0496112_0008190 3300048915 Bacteria 9345
201 Ga0496113_0010643 3300048916 Bacteria 6091
202 Ga0496114_0027127 3300048917 Bacteria 4691
203 Ga0496115_0050811 3300048918 Bacteria 3323
204 Ga0501031_0035736 3300049568 Bacteria 3242
205 Ga0501031_0172241 3300049568 Bacteria 1414
206 Ga0501033_0023590 3300049570 Bacteria 4640
207 Ga0501034_0175155 3300049571 Bacteria 2111
208 Ga0501037_0054760 3300049573 Bacteria 2917
209 Ga0501038_0039319 3300049574 Bacteria 4137
210 Ga0501043_0032751 3300049579 Bacteria 4087
211 Ga0501047_0000065 3300049581 Bacteria 132939
212 Ga0501047_0030982 3300049581 Bacteria 5157
213 Ga0501047_0158692 3300049581 Bacteria 2134
214 Ga0501044_0092409 3300049823 Bacteria 3051
215 nmdc:mga05p37_1493_c1 3300050507 Bacteria 27180
216 nmdc:mga05p37_18657_c1 3300050507 Bacteria 8384
217 nmdc:mga05p37_85795_c1 3300050507 Bacteria 3880
218 nmdc:mga09592_11635_c1 3300050508 Bacteria 7157
219 nmdc:mga09592_1187_c1 3300050508 Bacteria 12233
220 nmdc:mga0qj67_279565_c1 3300050509 Bacteria 1353
221 nmdc:mga0qj67_30078_c1 3300050509 Bacteria 4224
222 nmdc:mga0qj67_8_c4 3300050509 Bacteria 18514
223 nmdc:mga06r32_22395_c1 3300050510 Bacteria 5841
224 nmdc:mga06r32_962_c2 3300050510 Bacteria 18224
225 nmdc:mga08y16_3564_c1 3300050511 Bacteria 16165
226 nmdc:mga0rr50_12614_c1 3300050513 Bacteria 5471
227 nmdc:mga08x19_32140_c1 3300050514 Bacteria 3306
228 Ga0495612_0035284 3300053078 Bacteria 2027
229 Ga0495619_0006576 3300053085 Bacteria 7353
230 Ga0500578_0005887 3300053086 Bacteria 8264
231 Ga0500646_0000240 3300053090 Bacteria 16745
232 Ga0500566_0035091 3300053094 Bacteria 2915
233 Ga0500640_004622 3300053095 Bacteria 5025
234 Ga0500654_051036 3300053099 Bacteria 2226
235 Ga0500553_056042 3300053101 Bacteria 1870
236 Ga0500560_052989 3300053107 Bacteria 1306
237 Ga0500569_000669 3300053109 Bacteria 5908
238 Ga0500628_005224 3300053129 Bacteria 2163
239 Ga0500652_002723 3300053131 Bacteria 5334
240 Ga0500658_0016531 3300053134 Bacteria 2749
241 Ga0500561_0000738 3300053137 Bacteria 5185
242 Ga0500600_0005675 3300053149 Bacteria 7380
243 Ga0500616_0002116 3300053153 Bacteria 17242
244 Ga0500633_0001637 3300053160 Bacteria 4326
245 Ga0500634_0035204 3300053161 Bacteria 2727
246 Ga0500656_002167 3300053732 Bacteria 1764
247 Ga0500587_004813 3300053739 Bacteria 1842
248 2547409840 2547132111 Bacteria 8013147
249 2585308113 2582581313 Bacteria 10042643
250 2644266325 2643221647 Bacteria 10741251
251 2644514717 2643221692 Bacteria 7282860
252 2753271214 2751185782 Bacteria 11227053
253 2784585676 2784132148 Bacteria 8627943
254 2785366067 2784746768 Bacteria 10036182
255 2786667055 2786546132 Bacteria 10419719
256 2809229174 2808606448 Bacteria 8656184
257 2816425157 2816332119 Bacteria 8120218
258 2862180815 2862178590 Bacteria 8583590
259 2862282236 2862281513 Bacteria 9621493
260 2867436051 2867428634 Bacteria 9590268
261 2873152037 2873151551 Bacteria 8625867
262 2877684429 2877676314 Bacteria 9512378
263 2954390012 2954380949 Bacteria 10050426
264 2954682139 2954673503 Bacteria 9685905
265 2954690785 2954682443 Bacteria 9862841
266 2954700638 2954691527 Bacteria 10720516
267 2954701591 2954701450 Bacteria 10834262
268 2954719285 2954711539 Bacteria 10867210
269 2954729257 2954721474 Bacteria 10456478
270 2954732553 2954731030 Bacteria 10243860
271 2954748157 2954740390 Bacteria 10229294
272 2954751432 2954749733 Bacteria 10366972
273 2954767282 2954759201 Bacteria 9358192
274 8023629013 8023623736 Bacteria 8593882
275 Ga0163163_10240018
276 rootH1_10068745
277 rootH1_10288229
278 Ga0070683_100017274
279 Ga0070670_100077296
280 Ga0068868_100011742
281 Ga0070661_100033000
282 Ga0070692_10004694
283 Ga0070668_100025140
284 Ga0070675_100007215
285 Ga0070659_100021082
286 Ga0070709_10000543
287 Ga0070714_100023318
288 Ga0070713_100011776
289 Ga0070711_100016567
290 Ga0070694_100057322
291 Ga0070663_100007397
292 Ga0070662_100017337
293 Ga0070681_10371727
294 Ga0070706_100008215
295 Ga0070706_100370035
296 Ga0070707_100214263
297 Ga0070684_100001089
298 Ga0070684_100142404
299 Ga0070665_100068409
300 Ga0070664_100001144
301 Ga0070664_100170423
302 Ga0068856_100062904
303 Ga0070702_100010876
304 Ga0068852_100071601
305 Ga0068864_100011038
306 Ga0081455_10163054
307 Ga0070717_10121151
308 Ga0070715_10015465
309 Ga0070716_100018872
310 Ga0075428_100005309
311 Ga0075428_100022965
312 Ga0075430_100015376
313 Ga0075431_100022045
314 Ga0075431_100022280
315 Ga0075433_10141667
316 Ga0075429_100010307
317 Ga0075429_100011543
318 Ga0075429_100012350
319 Ga0099826_10098612
320 Ga0075435_100032937
321 Ga0111539_10003945
322 Ga0105245_10006999
323 Ga0114129_10000128
324 Ga0114129_10024989
325 Ga0105248_10010154
326 Ga0207692_10003499
327 Ga0207692_10014738
328 Ga0207685_10040430
329 Ga0207699_10018799
330 Ga0207699_10059882
331 Ga0207643_10130994
332 Ga0207693_10066599
333 Ga0207657_10027919
334 Ga0207650_10077330
335 Ga0207659_10004764
336 Ga0207687_10006840
337 Ga0207700_10065636
338 Ga0207664_10033189
339 Ga0207664_10037274
340 Ga0207706_10029917
341 Ga0207704_10196001
342 Ga0207665_10027046
343 Ga0207711_10063014
344 Ga0207689_10022607
345 Ga0207661_10086777
346 Ga0207679_10157491
347 Ga0207668_10065257
348 Ga0207677_10007496
349 Ga0207703_10012364
350 Ga0207703_10060492
351 Ga0207678_10015569
352 Ga0207702_10020183
353 Ga0207428_10034249
354 Ga0268264_10112032
355 Ga0307517_10005176
356 Ga0307517_10008743
357 Ga0307515_10000325
358 Ga0307511_10000010
359 Ga0307513_10041385
360 Ga0307509_10005887
361 Ga0307509_10006748
362 Ga0307509_10007319
363 Ga0307509_10130550
364 Ga0307508_10129600
365 Ga0316576_10002483
366 Ga0307516_10017306
367 Ga0307518_10007835
368 Ga0307518_10112530
369 Ga0307416_100166241
370 Ga0307415_100058593
371 Ga0307507_10018050
372 Ga0307510_10036053
373 Ga0307510_10048150
374 Ga0307510_10079308
375 Ga0373934_0037539
376 Ga0373936_0001068
377 Ga0373955_0083195
378 Ga0373924_0001148
379 Ga0373935_0035060
380 Ga0373933_0001842
381 Ga0373937_0195186
382 Ga0373925_0271948
383 Ga0395898_0040182
384 Ga0439449_0078086
385 Ga0439455_0003960
386 Ga0450903_001365
387 Ga0439458_0002597
388 Ga0439458_0012709
389 Ga0466971_0005841
390 Ga0495592_0017693
391 Ga0495603_0002987
392 Ga0495629_0001539
393 Ga0495629_0016856
394 Ga0495629_0021544
395 Ga0495641_0015768
396 Ga0495651_0001958
397 Ga0495651_0028336
398 Ga0495653_0091399
399 Ga0495582_0005545
400 Ga0495662_0001297
401 Ga0495662_0004933
402 Ga0495664_0001604
403 Ga0495664_0080413
404 Ga0495594_0104044
405 Ga0495607_0041893
406 Ga0495583_0017624
407 Ga0495618_0166747
408 Ga0495628_0148424
409 Ga0495628_0255150
410 Ga0495630_0117607
411 Ga0495631_0027864
412 Ga0495632_0021934
413 Ga0495637_0078187
414 Ga0495643_0007869
415 Ga0495648_0112027
416 Ga0495652_0035423
417 Ga0495652_0077061
418 Ga0495586_0041249
419 Ga0495587_0000737
420 Ga0495609_0080302
421 Ga0495645_0057998
422 Ga0495622_0006740
423 Ga0495633_0104329
424 Ga0495634_0045654
425 Ga0495634_0071248
426 Ga0495634_0127099
427 Ga0495625_0003955
428 Ga0495625_0140897
429 Ga0495635_0000315
430 Ga0495635_0212322
431 Ga0495657_0000740
432 Ga0495599_0078570
433 Ga0495646_0002757
434 Ga0495646_0086438
435 Ga0495658_0084925
436 Ga0495613_0072932
437 Ga0495624_0058848
438 Ga0495624_0083769
439 Ga0495670_0011177
440 Ga0495589_0023330
441 Ga0495600_0004053
442 Ga0495600_0038554
443 Ga0495660_0031463
444 Ga0495581_0001612
445 Ga0495604_0000708
446 Ga0495636_0012681
447 Ga0495674_0101775
448 Ga0495676_0006273
449 Ga0495676_0007580
450 Ga0495676_0013149
451 Ga0495680_0006815
452 Ga0495687_003463
453 Ga0495687_008857
454 Ga0495675_0003718
455 Ga0495685_000361
456 Ga0495685_005461
457 Ga0495685_014373
458 Ga0495681_0004377
459 Ga0495681_0013930
460 Ga0495684_0003627
461 Ga0495684_0103474
462 Ga0495686_0046044
463 Ga0495686_0064225
464 Ga0495593_0001258
465 Ga0495593_0035449
466 Ga0495614_0007818
467 Ga0495614_0012143
468 Ga0495614_0027601
469 Ga0496102_0014429
470 Ga0496102_0085059
471 Ga0496105_0002271
472 Ga0496108_0006932
473 Ga0496109_0107285
474 Ga0496112_0008190
475 Ga0496113_0010643
476 Ga0496114_0027127
477 Ga0496115_0050811
478 Ga0501031_0035736
479 Ga0501031_0172241
480 Ga0501033_0023590
481 Ga0501034_0175155
482 Ga0501037_0054760
483 Ga0501038_0039319
484 Ga0501043_0032751
485 Ga0501047_0000065
486 Ga0501047_0030982
487 Ga0501047_0158692
488 Ga0501044_0092409
489 nmdc:mga05p37_1493_c1
490 nmdc:mga05p37_18657_c1
491 nmdc:mga05p37_85795_c1
492 nmdc:mga09592_11635_c1
493 nmdc:mga09592_1187_c1
494 nmdc:mga0qj67_279565_c1
495 nmdc:mga0qj67_30078_c1
496 nmdc:mga0qj67_8_c4
497 nmdc:mga06r32_22395_c1
498 nmdc:mga06r32_962_c2
499 nmdc:mga08y16_3564_c1
500 nmdc:mga0rr50_12614_c1
501 nmdc:mga08x19_32140_c1
502 Ga0495612_0035284
503 Ga0495619_0006576
504 Ga0500578_0005887
505 Ga0500646_0000240
506 Ga0500566_0035091
507 Ga0500640_004622
508 Ga0500654_051036
509 Ga0500553_056042
510 Ga0500560_052989
511 Ga0500569_000669
512 Ga0500628_005224
513 Ga0500652_002723
514 Ga0500658_0016531
515 Ga0500561_0000738
516 Ga0500600_0005675
517 Ga0500616_0002116
518 Ga0500633_0001637
519 Ga0500634_0035204
520 Ga0500656_002167
521 Ga0500587_004813
522 2547409840
523 2585308113
524 2644266325
525 2644514717
526 2753271214
527 2784585676
528 2785366067
529 2786667055
530 2809229174
531 2816425157
532 2862180815
533 2862282236
534 2867436051
535 2873152037
536 2877684429
537 2954390012
538 2954682139
539 2954690785
540 2954700638
541 2954701591
542 2954719285
543 2954729257
544 2954732553
545 2954748157
546 2954751432
547 2954767282
548 8023629013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01411

tRNA-synt_2c

tRNA synthetases class II (A)

72

449

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v59-assembly1.cif.gz_A crystal structure of catalytic fragment of human alars in complex with aze-sa 0.9216 1 341
4xem-assembly1.cif.gz_A crystal structure of wild type human alars catalytic domain 0.919 1 341
4xeo-assembly1.cif.gz_A crystal structure of human alars catalytic domain with r329h mutation 0.9121 1 346
4xeo-assembly2.cif.gz_B crystal structure of human alars catalytic domain with r329h mutation 0.9077 1 343
5knn-assembly3.cif.gz_C evolutionary gain of alanine mischarging to non-cognate trnas with a g4:u69 base pair 0.8777 1 387
ID Description Score Start End Superfamily
af_P50475_4_255_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9199 1 232 3.30.930.10
af_Q2FXV9_4_242_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8955 1 232 3.30.930.10
3hxxA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8908 1 233 3.30.930.10
af_P9WFW7_1_245_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8768 1 232 3.30.930.10
af_Q2FXV9_4_242_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8665 1 232 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A7K3DA05-F1-model_v4 alanine--tRNA ligase (EC 6.1.1.7) 0.9661 1 241 GO:0000049
GO:0002161
GO:0004813
GO:0005524
GO:0005829
GO:0006419
AF-A0A535KV59-F1-model_v4 alanine--tRNA ligase (EC 6.1.1.7) 0.9631 1 172 GO:0000049
GO:0002161
GO:0004813
GO:0005524
GO:0005829
GO:0006419
AF-A0A0F5VJB8-F1-model_v4 alanine--tRNA ligase (EC 6.1.1.7) 0.9603 1 115 GO:0000049
GO:0002161
GO:0004813
GO:0005524
GO:0005829
GO:0006419
AF-A0A810L1S3-F1-model_v4 alanine--tRNA ligase (EC 6.1.1.7) 0.9554 1 386 GO:0000049
GO:0002161
GO:0004813
GO:0005524
GO:0005829
GO:0006419
AF-A0A0G0NBR7-F1-model_v4 alanine--tRNA ligase (EC 6.1.1.7) 0.9541 1 158 GO:0000049
GO:0002161
GO:0004813
GO:0005524
GO:0006419

Map