F379732

General Info

Members Datasets Scaffolds Average Seq Length
274 185 264 484

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10008093|Ga0163162_100080935
Length 549
Sequence VNLQWADLGLTSYQLPANPQPAQSRQSTNINLLSNLKFQISNSNLSFFFAFPMKHILLFGAGKSATCLIDYLKQQCSEKDWKFTVCDTNIEALRAKLGNARNTEGISINVEDETQRKDLVKQADVVISLLPAHLHYLVAQDCLEFGKHLLTASYVDEKISNLRSKISDKNILFLCEMGLDPGIDHMSAMKIIHEIKDKGGKITSFKSHCGGLVAPESDDNPWHYKISWNPRNVVMAGKAGAIYKENGKEVHEEYKDLFKPERALEMEELGHLSYYPNRDSLSYIDTYQLHETDTFIRTTLRFPEFCYGWKNIIELHLTDEEVEYDTDRMTLKDFFKEWLSKQMTDRLKFSNDLLAKLLALQEQEEELKHEAELVGKEPELEHFMMVDEKGDLKDIGLDEVKNSAANAVMTKLHEANLAMKQLMFLGLDSEEMINKGKCSAADVLQFVLERKLALKEGDKDMIVMLHEFEVEEGNKKYEVKSSLIVLGEDNVRTAMAKTVGLPLGIAAKLILEGTMNVTGLHIPVIPEIYEPVLKELEQNGIKFKETTTN

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
5 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
6 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
7 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
8 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
9 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
10 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
128 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
138 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
164 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
165 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
166 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
167 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
168 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
169 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
172 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
180 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
185 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 0
Isolates 3.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.3
Nodule 0
Rhizoplane 1.09
Rhizosphere 86.86
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010043 3300001979 Unclassified 3667
2 JGI25406J46586_10037135 3300003203 Bacteria 1760
3 rootL2_10010780 3300003322 Bacteria 3646
4 rootH1_10031561 3300003323 Bacteria 10584
5 JGI25160J50197_1000790 3300003354 Bacteria 17009
6 JGI25160J50197_1010001 3300003354 Bacteria 3466
7 Ga0055535_1003520 3300003761 Bacteria 4374
8 Ga0055531_10000023 3300003794 Bacteria 165025
9 Ga0065715_10005922 3300005293 Bacteria 3697
10 Ga0070683_100003881 3300005329 Bacteria 12229
11 Ga0070683_100024807 3300005329 Bacteria 5376
12 Ga0070690_100001158 3300005330 Bacteria 13568
13 Ga0070670_100042783 3300005331 Bacteria 3895
14 Ga0070670_100043497 3300005331 Bacteria 3860
15 Ga0068869_100031774 3300005334 Bacteria 3716
16 Ga0068869_100066547 3300005334 Bacteria 2655
17 Ga0070666_10013922 3300005335 Bacteria 5111
18 Ga0070666_10069292 3300005335 Bacteria 2398
19 Ga0068868_100027504 3300005338 Bacteria 4339
20 Ga0070660_100057014 3300005339 Bacteria 3024
21 Ga0070689_100126623 3300005340 Unclassified 2045
22 Ga0070661_100003179 3300005344 Bacteria 11317
23 Ga0070661_100019630 3300005344 Bacteria 4816
24 Ga0070668_100008497 3300005347 Bacteria 7627
25 Ga0070669_100061790 3300005353 Bacteria 2753
26 Ga0070675_100028523 3300005354 Bacteria 4492
27 Ga0070675_100068555 3300005354 Bacteria 2937
28 Ga0070675_100159016 3300005354 Bacteria 1942
29 Ga0070675_100201221 3300005354 Bacteria 1729
30 Ga0070671_100049800 3300005355 Bacteria 3485
31 Ga0070671_100059407 3300005355 Bacteria 3182
32 Ga0070673_100012979 3300005364 Bacteria 5744
33 Ga0070673_100049784 3300005364 Bacteria 3272
34 Ga0070688_100079130 3300005365 Bacteria 2123
35 Ga0070659_100001835 3300005366 Bacteria 15262
36 Ga0070659_100088833 3300005366 Bacteria 2475
37 Ga0070667_100015793 3300005367 Bacteria 6246
38 Ga0070667_100111526 3300005367 Bacteria 2372
39 Ga0070678_100020299 3300005456 Bacteria 4356
40 Ga0070662_100047273 3300005457 Unclassified 3095
41 Ga0070662_100049517 3300005457 Bacteria 3030
42 Ga0068867_100036663 3300005459 Bacteria 3562
43 Ga0068867_100117232 3300005459 Bacteria 2053
44 Ga0068867_100144568 3300005459 Unclassified 1862
45 Ga0070685_10046380 3300005466 Bacteria 2494
46 Ga0070698_100004621 3300005471 Bacteria 15125
47 Ga0070679_100018398 3300005530 Bacteria 6781
48 Ga0070684_100000285 3300005535 Bacteria 35210
49 Ga0070684_100083519 3300005535 Bacteria 2830
50 Ga0068853_100004573 3300005539 Bacteria 10729
51 Ga0068853_100004633 3300005539 Bacteria 10659
52 Ga0068853_100105078 3300005539 Bacteria 2501
53 Ga0070672_100092160 3300005543 Bacteria 2446
54 Ga0070665_100051321 3300005548 Bacteria 4137
55 Ga0068855_100018440 3300005563 Bacteria 8386
56 Ga0070664_100000423 3300005564 Bacteria 31649
57 Ga0070664_100005995 3300005564 Bacteria 9824
58 Ga0070664_100160968 3300005564 Unclassified 1986
59 Ga0068857_100001120 3300005577 Bacteria 20847
60 Ga0068857_100131288 3300005577 Bacteria 2259
61 Ga0068854_100061144 3300005578 Bacteria 2727
62 Ga0068856_100023625 3300005614 Bacteria 5978
63 Ga0068852_100005821 3300005616 Bacteria 8851
64 Ga0068859_100145810 3300005617 Bacteria 2442
65 Ga0068859_100322990 3300005617 Bacteria 1637
66 Ga0068864_100039178 3300005618 Bacteria 4050
67 Ga0068864_100057425 3300005618 Bacteria 3362
68 Ga0068864_100106418 3300005618 Unclassified 2494
69 Ga0068861_100029967 3300005719 Unclassified 3984
70 Ga0068863_100041058 3300005841 Unclassified 4398
71 Ga0068863_100062056 3300005841 Bacteria 3535
72 Ga0068863_100095882 3300005841 Bacteria 2816
73 Ga0068858_100025824 3300005842 Bacteria 5464
74 Ga0068862_100049218 3300005844 Bacteria 3599
75 Ga0081539_10000899 3300005985 Bacteria 56635
76 Ga0097621_100000122 3300006237 Bacteria 44726
77 Ga0068871_100000412 3300006358 Bacteria 29568
78 Ga0068871_100052238 3300006358 Unclassified 3309
79 Ga0075428_100087239 3300006844 Unclassified 3403
80 Ga0075431_100017748 3300006847 Bacteria 7235
81 Ga0068865_100082044 3300006881 Unclassified 2317
82 Ga0097620_100145794 3300006931 Bacteria 2442
83 Ga0097620_100322987 3300006931 Bacteria 1637
84 Ga0111539_10001798 3300009094 Bacteria 28539
85 Ga0105242_10010261 3300009176 Bacteria 7181
86 Ga0105242_10137433 3300009176 Unclassified 2116
87 Ga0105248_10046755 3300009177 Bacteria 4852
88 Ga0105237_10003754 3300009545 Bacteria 17897
89 Ga0105249_10015068 3300009553 Bacteria 6840
90 Ga0105249_10050935 3300009553 Bacteria 3776
91 Ga0105249_10059626 3300009553 Bacteria 3500
92 Ga0105249_10080308 3300009553 Bacteria 3029
93 Ga0105239_10113216 3300010375 Bacteria 3009
94 Ga0157369_10033782 3300013105 Bacteria 5617
95 Ga0157369_10076189 3300013105 Bacteria 3595
96 Ga0157374_10027330 3300013296 Bacteria 5144
97 Ga0157378_10021429 3300013297 Bacteria 5683
98 Ga0157378_10033031 3300013297 Bacteria 4573
99 Ga0157378_10248826 3300013297 Bacteria 1701
100 Ga0163162_10000703 3300013306 Bacteria 30932
101 Ga0163162_10008093 3300013306 Bacteria 10261
102 Ga0163162_10012776 3300013306 Bacteria 8202
103 Ga0163162_10023195 3300013306 Bacteria 6122
104 Ga0163162_10051666 3300013306 Bacteria 4124
105 Ga0163162_10338760 3300013306 Bacteria 1636
106 Ga0157372_10006938 3300013307 Bacteria 12055
107 Ga0157372_10176283 3300013307 Unclassified 2474
108 Ga0157372_10224273 3300013307 Bacteria 2179
109 Ga0157375_10000162 3300013308 Bacteria 63098
110 Ga0157375_10194362 3300013308 Bacteria 2184
111 Ga0163163_10005940 3300014325 Bacteria 10625
112 Ga0163163_10021454 3300014325 Bacteria 6095
113 Ga0163163_10184022 3300014325 Bacteria 2137
114 Ga0157380_10007340 3300014326 Bacteria 7827
115 Ga0157380_10062697 3300014326 Bacteria 2979
116 Ga0157380_10310645 3300014326 Bacteria 1457
117 Ga0157377_10022614 3300014745 Bacteria 3322
118 Ga0157377_10041185 3300014745 Bacteria 2561
119 Ga0157379_10173805 3300014968 Bacteria 1944
120 Ga0157379_10216239 3300014968 Unclassified 1736
121 Ga0157376_10001595 3300014969 Bacteria 15011
122 Ga0157376_10038996 3300014969 Unclassified 3870
123 Ga0157376_10045398 3300014969 Bacteria 3617
124 Ga0182005_1000126 3300015265 Bacteria 53914
125 Ga0163161_10001382 3300017792 Bacteria 17961
126 Ga0163161_10005549 3300017792 Bacteria 8739
127 Ga0163161_10032488 3300017792 Unclassified 3727
128 Ga0209258_100098 3300025242 Bacteria 215216
129 Ga0209148_1000120 3300025254 Bacteria 186836
130 Ga0207426_1000019 3300025302 Bacteria 558579
131 Ga0207426_1000137 3300025302 Bacteria 199010
132 Ga0207426_1010725 3300025302 Bacteria 3539
133 Ga0209257_1000013 3300025304 Bacteria 1047305
134 Ga0207680_10041943 3300025903 Bacteria 2673
135 Ga0207647_10041551 3300025904 Bacteria 2890
136 Ga0207643_10017742 3300025908 Bacteria 3896
137 Ga0207643_10029828 3300025908 Bacteria 3034
138 Ga0207657_10002233 3300025919 Bacteria 20999
139 Ga0207649_10005070 3300025920 Bacteria 7123
140 Ga0207649_10051897 3300025920 Bacteria 2541
141 Ga0207652_10049511 3300025921 Bacteria 3597
142 Ga0207681_10032049 3300025923 Bacteria 3438
143 Ga0207681_10037132 3300025923 Bacteria 3219
144 Ga0207650_10020115 3300025925 Bacteria 4702
145 Ga0207659_10060794 3300025926 Bacteria 2721
146 Ga0207644_10036396 3300025931 Bacteria 3455
147 Ga0207644_10040764 3300025931 Bacteria 3282
148 Ga0207644_10092296 3300025931 Unclassified 2259
149 Ga0207690_10003834 3300025932 Bacteria 8898
150 Ga0207706_10013177 3300025933 Bacteria 7524
151 Ga0207706_10014897 3300025933 Bacteria 7041
152 Ga0207706_10066835 3300025933 Bacteria 3164
153 Ga0207686_10006459 3300025934 Bacteria 6311
154 Ga0207691_10069432 3300025940 Bacteria 3183
155 Ga0207711_10071646 3300025941 Bacteria 3008
156 Ga0207689_10007269 3300025942 Bacteria 9722
157 Ga0207689_10011302 3300025942 Bacteria 7662
158 Ga0207689_10032672 3300025942 Bacteria 4326
159 Ga0207661_10001045 3300025944 Bacteria 18375
160 Ga0207679_10000550 3300025945 Bacteria 25168
161 Ga0207651_10012852 3300025960 Bacteria 4760
162 Ga0207651_10060383 3300025960 Bacteria 2632
163 Ga0207712_10017273 3300025961 Bacteria 4684
164 Ga0207712_10085710 3300025961 Bacteria 2306
165 Ga0207640_10070994 3300025981 Bacteria 2344
166 Ga0207658_10015914 3300025986 Bacteria 5165
167 Ga0207677_10028264 3300026023 Bacteria 3543
168 Ga0207677_10065216 3300026023 Bacteria 2540
169 Ga0207703_10014111 3300026035 Bacteria 6228
170 Ga0207639_10079158 3300026041 Bacteria 2597
171 Ga0207678_10019607 3300026067 Bacteria 5945
172 Ga0207708_10112543 3300026075 Bacteria 2114
173 Ga0207641_10007205 3300026088 Bacteria 9271
174 Ga0207641_10016765 3300026088 Bacteria 6000
175 Ga0207641_10065654 3300026088 Bacteria 3105
176 Ga0207648_10069019 3300026089 Bacteria 3080
177 Ga0207648_10111825 3300026089 Unclassified 2398
178 Ga0207648_10193298 3300026089 Bacteria 1804
179 Ga0207676_10047521 3300026095 Bacteria 3327
180 Ga0207676_10086947 3300026095 Bacteria 2555
181 Ga0207674_10005455 3300026116 Bacteria 15106
182 Ga0207674_10016092 3300026116 Bacteria 8193
183 Ga0207674_10051356 3300026116 Bacteria 4208
184 Ga0207675_100019396 3300026118 Bacteria 6345
185 Ga0207675_100210630 3300026118 Bacteria 1869
186 Ga0207683_10031050 3300026121 Bacteria 4635
187 Ga0207683_10067950 3300026121 Bacteria 3144
188 Ga0207698_10094196 3300026142 Bacteria 2462
189 Ga0268265_10303091 3300028380 Bacteria 1439
190 Ga0265327_10000385 3300031251 Bacteria 83048
191 Ga0265327_10000644 3300031251 Bacteria 56620
192 Ga0307509_10023686 3300031507 Bacteria 6885
193 Ga0307509_10036873 3300031507 Bacteria 5349
194 Ga0307408_100083874 3300031548 Unclassified 2389
195 Ga0307508_10000354 3300031616 Bacteria 55733
196 Ga0316576_10004324 3300031727 Bacteria 8498
197 Ga0316576_10049018 3300031727 Bacteria 3065
198 Ga0316577_10000274 3300031733 Bacteria 18332
199 Ga0307407_10045298 3300031903 Unclassified 2485
200 Ga0307416_100067115 3300032002 Unclassified 2957
201 Ga0307415_100067985 3300032126 Unclassified 2492
202 Ga0316580_10005260 3300032139 Bacteria 3772
203 Ga0316574_0018408 3300035398 Bacteria 4104
204 Ga0373937_0098493 3300036401 Bacteria 2712
205 Ga0316582_0004741 3300036647 Bacteria 6922
206 Ga0316582_0037742 3300036647 Bacteria 2997
207 Ga0395905_0010691 3300037471 Bacteria 8901
208 Ga0439431_0000202 3300041997 Bacteria 11736
209 Ga0439445_0004952 3300042004 Bacteria 3026
210 Ga0439449_0041245 3300042007 Bacteria 1716
211 Ga0451577_0210125 3300042876 Bacteria 1758
212 Ga0453684_0071217 3300044712 Unclassified 4397
213 Ga0466959_0085523 3300045049 Bacteria 2269
214 Ga0495643_0020778 3300046522 Bacteria 3778
215 Ga0495668_0000624 3300046616 Bacteria 42812
216 Ga0495668_0025693 3300046616 Unclassified 3345
217 Ga0495636_0000020 3300047318 Bacteria 75085
218 Ga0495672_0046713 3300047320 Bacteria 2581
219 Ga0495686_0000102 3300047472 Bacteria 177525
220 Ga0495686_0004760 3300047472 Bacteria 10981
221 Ga0496100_0054737 3300048903 Bacteria 2604
222 Ga0496101_0115021 3300048904 Bacteria 2029
223 Ga0496110_0147378 3300048913 Bacteria 2130
224 Ga0496121_0000007 3300048924 Bacteria 942516
225 Ga0501032_0000933 3300049569 Bacteria 23653
226 Ga0501034_0011063 3300049571 Bacteria 9371
227 Ga0501034_0061385 3300049571 Bacteria 3774
228 Ga0501036_0015551 3300049572 Bacteria 6358
229 Ga0501038_0079407 3300049574 Bacteria 2767
230 Ga0501039_0055675 3300049575 Bacteria 3064
231 Ga0501043_0022801 3300049579 Bacteria 4909
232 Ga0501043_0327188 3300049579 Bacteria 1168
233 Ga0501046_0006430 3300049580 Bacteria 10409
234 Ga0501047_0042058 3300049581 Bacteria 4416
235 Ga0501048_0006411 3300049582 Bacteria 8943
236 Ga0501073_0097618 3300049589 Bacteria 2040
237 Ga0501074_0000668 3300049590 Bacteria 21402
238 Ga0501201_001107 3300049651 Bacteria 2532
239 Ga0501217_000220 3300049661 Bacteria 8651
240 Ga0501223_000584 3300049663 Bacteria 8796
241 Ga0501235_002702 3300049669 Bacteria 3813
242 Ga0501238_003928 3300049671 Bacteria 1843
243 Ga0501261_001591 3300049690 Bacteria 2789
244 Ga0501221_001138 3300049704 Bacteria 4386
245 Ga0501225_0003821 3300049705 Bacteria 4523
246 Ga0501234_013239 3300049707 Bacteria 1294
247 Ga0501241_007506 3300049758 Bacteria 1996
248 Ga0501035_0011988 3300049822 Bacteria 8018
249 Ga0501035_0013893 3300049822 Bacteria 7429
250 Ga0501035_0056323 3300049822 Bacteria 3508
251 Ga0501044_0026200 3300049823 Bacteria 6175
252 Ga0501044_0078605 3300049823 Bacteria 3343
253 nmdc:mga0qj67_3636_c1 3300050509 Bacteria 11125
254 nmdc:mga08y16_93925_c1 3300050511 Bacteria 3125
255 Ga0500644_0000040 3300053088 Bacteria 77696
256 Ga0500641_0067867 3300053096 Bacteria 1496
257 Ga0500569_000087 3300053109 Bacteria 14743
258 Ga0500642_0010781 3300053130 Bacteria 3239
259 Ga0500658_0002246 3300053134 Bacteria 7491
260 Ga0500616_0001400 3300053153 Bacteria 23227
261 Ga0500616_0008423 3300053153 Bacteria 6406
262 Ga0500622_0000110 3300053156 Bacteria 83911
263 Ga0500627_0002682 3300053158 Bacteria 5330
264 Ga0500633_0000573 3300053160 Bacteria 6012

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0327188 Ga0501043_0327188_34_1128 361
2 3300049661 Ga0501217_000220 Ga0501217_000220_7358_8605 409
3 3300049707 Ga0501234_013239 Ga0501234_013239_22_1269 409
4 3300014326 Ga0157380_10310645 Ga0157380_103106451 435
5 iso_pu_bacteria 2818991460 2819678327 436
6 iso_pu_bacteria 2929177148 2929180960 436
7 iso_pu_bacteria 2945977869 2945983359 436
8 iso_pu_bacteria 2946013367 2946017251 436
9 3300047472 Ga0495686_0000102 Ga0495686_0000102_40101_41438 437
10 3300049574 Ga0501038_0079407 Ga0501038_0079407_1268_2590 437
11 3300049822 Ga0501035_0056323 Ga0501035_0056323_413_1735 437
12 3300049823 Ga0501044_0078605 Ga0501044_0078605_1109_2431 437
13 iso_pu_bacteria 2818991442 2819575670 437
14 iso_pu_bacteria 2821136567 2821138219 437
15 iso_pu_bacteria 2904467357 2904469015 437
16 iso_pu_bacteria 2929239360 2929242897 437
17 3300046616 Ga0495668_0000624 Ga0495668_0000624_22707_24035 438
18 3300047472 Ga0495686_0004760 Ga0495686_0004760_4342_5670 438
19 3300053096 Ga0500641_0067867 Ga0500641_0067867_152_1480 438
20 3300053130 Ga0500642_0010781 Ga0500642_0010781_1767_3095 438
21 3300053153 Ga0500616_0001400 Ga0500616_0001400_10644_11972 438
22 3300053158 Ga0500627_0002682 Ga0500627_0002682_2371_3699 438
23 iso_pu_bacteria 2884791551 2884793226 438
24 iso_pu_bacteria 2910245624 2910247105 438
25 3300003323 rootH1_10031561 rootH1_100315613 440
26 3300003354 JGI25160J50197_1010001 JGI25160J50197_10100013 440
27 3300025302 Ga0207426_1000137 Ga0207426_1000137107 440
28 3300045049 Ga0466959_0085523 Ga0466959_0085523_223_1545 440
29 3300046522 Ga0495643_0020778 Ga0495643_0020778_772_2100 440
30 3300003322 rootL2_10010780 rootL2_100107803 441
31 3300003761 Ga0055535_1003520 Ga0055535_10035203 441
32 3300003794 Ga0055531_10000023 Ga0055531_10000023135 441
33 3300005331 Ga0070670_100042783 Ga0070670_1000427833 441
34 3300005347 Ga0070668_100008497 Ga0070668_1000084971 441
35 3300005353 Ga0070669_100061790 Ga0070669_1000617902 441
36 3300005354 Ga0070675_100028523 Ga0070675_1000285235 441
37 3300005364 Ga0070673_100049784 Ga0070673_1000497842 441
38 3300005365 Ga0070688_100079130 Ga0070688_1000791302 441
39 3300005457 Ga0070662_100049517 Ga0070662_1000495173 441
40 3300005459 Ga0068867_100117232 Ga0068867_1001172322 441
41 3300005543 Ga0070672_100092160 Ga0070672_1000921602 441
42 3300005578 Ga0068854_100061144 Ga0068854_1000611443 441
43 3300005617 Ga0068859_100145810 Ga0068859_1001458102 441
44 3300005844 Ga0068862_100049218 Ga0068862_1000492183 441
45 3300006931 Ga0097620_100145794 Ga0097620_1001457942 441
46 3300009094 Ga0111539_10001798 Ga0111539_1000179822 441
47 3300009553 Ga0105249_10050935 Ga0105249_100509351 441
48 3300014326 Ga0157380_10007340 Ga0157380_100073404 441
49 3300014745 Ga0157377_10022614 Ga0157377_100226143 441
50 3300015265 Ga0182005_1000126 Ga0182005_100012628 441
51 3300025242 Ga0209258_100098 Ga0209258_10009838 441
52 3300025254 Ga0209148_1000120 Ga0209148_100012012 441
53 3300025302 Ga0207426_1010725 Ga0207426_10107252 441
54 3300025304 Ga0209257_1000013 Ga0209257_1000013574 441
55 3300025908 Ga0207643_10017742 Ga0207643_100177425 441
56 3300025923 Ga0207681_10032049 Ga0207681_100320492 441
57 3300025981 Ga0207640_10070994 Ga0207640_100709942 441
58 3300026075 Ga0207708_10112543 Ga0207708_101125432 441
59 3300026089 Ga0207648_10193298 Ga0207648_101932982 441
60 3300026116 Ga0207674_10051356 Ga0207674_100513563 441
61 3300028380 Ga0268265_10303091 Ga0268265_103030911 441
62 3300041997 Ga0439431_0000202 Ga0439431_0000202_4967_6292 441
63 3300042004 Ga0439445_0004952 Ga0439445_0004952_288_1613 441
64 3300042007 Ga0439449_0041245 Ga0439449_0041245_101_1513 441
65 3300048924 Ga0496121_0000007 Ga0496121_0000007_654263_655588 441
66 3300049571 Ga0501034_0061385 Ga0501034_0061385_1712_3037 441
67 3300049671 Ga0501238_003928 Ga0501238_003928_94_1419 441
68 3300049758 Ga0501241_007506 Ga0501241_007506_641_1966 441
69 3300050511 nmdc:mga08y16_93925_c1 nmdc:mga08y16_93925_c1_783_2135 441
70 3300053088 Ga0500644_0000040 Ga0500644_0000040_54473_55798 441
71 3300053109 Ga0500569_000087 Ga0500569_000087_12566_13891 441
72 3300053134 Ga0500658_0002246 Ga0500658_0002246_2332_3657 441
73 3300053153 Ga0500616_0008423 Ga0500616_0008423_1678_3003 441
74 3300053156 Ga0500622_0000110 Ga0500622_0000110_35729_37054 441
75 3300053160 Ga0500633_0000573 Ga0500633_0000573_2612_3937 441
76 3300047318 Ga0495636_0000020 Ga0495636_0000020_41066_42397 442
77 3300031251 Ga0265327_10000644 Ga0265327_100006445 443
78 3300031727 Ga0316576_10049018 Ga0316576_100490182 447
79 3300032139 Ga0316580_10005260 Ga0316580_100052603 447
80 3300036647 Ga0316582_0037742 Ga0316582_0037742_504_1877 447
81 3300003354 JGI25160J50197_1000790 JGI25160J50197_10007905 448
82 3300025302 Ga0207426_1000019 Ga0207426_1000019158 448
83 3300031727 Ga0316576_10004324 Ga0316576_100043244 448
84 3300031733 Ga0316577_10000274 Ga0316577_100002747 448
85 3300035398 Ga0316574_0018408 Ga0316574_0018408_1054_2451 448
86 3300036647 Ga0316582_0004741 Ga0316582_0004741_4971_6368 448
87 3300013306 Ga0163162_10338760 Ga0163162_103387601 456
88 3300005539 Ga0068853_100105078 Ga0068853_1001050782 465
89 3300026041 Ga0207639_10079158 Ga0207639_100791582 465
90 3300014325 Ga0163163_10005940 Ga0163163_100059407 468
91 3300003203 JGI25406J46586_10037135 JGI25406J46586_100371351 472
92 3300005985 Ga0081539_10000899 Ga0081539_1000089916 472
93 3300046616 Ga0495668_0025693 Ga0495668_0025693_161_1672 482
94 3300005355 Ga0070671_100059407 Ga0070671_1000594072 487
95 3300005367 Ga0070667_100015793 Ga0070667_1000157933 487
96 3300005841 Ga0068863_100062056 Ga0068863_1000620563 487
97 3300006237 Ga0097621_100000122 Ga0097621_10000012241 487
98 3300006358 Ga0068871_100000412 Ga0068871_10000041228 487
99 3300009177 Ga0105248_10046755 Ga0105248_100467552 487
100 3300013297 Ga0157378_10033031 Ga0157378_100330313 487
101 3300013306 Ga0163162_10000703 Ga0163162_100007038 487
102 3300013308 Ga0157375_10000162 Ga0157375_100001622 487
103 3300014969 Ga0157376_10001595 Ga0157376_100015952 487
104 3300017792 Ga0163161_10001382 Ga0163161_1000138219 487
105 3300025931 Ga0207644_10040764 Ga0207644_100407642 487
106 3300025941 Ga0207711_10071646 Ga0207711_100716462 487
107 3300025986 Ga0207658_10015914 Ga0207658_100159143 487
108 3300026088 Ga0207641_10016765 Ga0207641_100167653 487
109 3300048903 Ga0496100_0054737 Ga0496100_0054737_231_1826 487
110 3300025960 Ga0207651_10060383 Ga0207651_100603833 489
111 3300026121 Ga0207683_10031050 Ga0207683_100310503 489
112 3300005367 Ga0070667_100111526 Ga0070667_1001115261 491
113 3300013306 Ga0163162_10008093 Ga0163162_100080935 491
114 3300005459 Ga0068867_100036663 Ga0068867_1000366631 493
115 3300005330 Ga0070690_100001158 Ga0070690_1000011587 494
116 3300005335 Ga0070666_10013922 Ga0070666_100139223 494
117 3300005355 Ga0070671_100049800 Ga0070671_1000498003 494
118 3300005456 Ga0070678_100020299 Ga0070678_1000202993 494
119 3300014968 Ga0157379_10173805 Ga0157379_101738052 494
120 3300017792 Ga0163161_10005549 Ga0163161_100055498 494
121 3300025903 Ga0207680_10041943 Ga0207680_100419432 494
122 3300025933 Ga0207706_10013177 Ga0207706_100131775 494
123 3300025942 Ga0207689_10011302 Ga0207689_100113023 494
124 3300026095 Ga0207676_10047521 Ga0207676_100475213 494
125 3300026118 Ga0207675_100210630 Ga0207675_1002106301 494
126 3300042876 Ga0451577_0210125 Ga0451577_0210125_165_1649 494
127 3300044712 Ga0453684_0071217 Ga0453684_0071217_734_2218 494
128 3300048904 Ga0496101_0115021 Ga0496101_0115021_221_1732 494
129 3300049651 Ga0501201_001107 Ga0501201_001107_568_2070 494
130 3300049663 Ga0501223_000584 Ga0501223_000584_775_2277 494
131 3300049669 Ga0501235_002702 Ga0501235_002702_2239_3741 494
132 3300049690 Ga0501261_001591 Ga0501261_001591_251_1753 494
133 3300049704 Ga0501221_001138 Ga0501221_001138_1357_2859 494
134 3300049705 Ga0501225_0003821 Ga0501225_0003821_861_2363 494
135 3300005618 Ga0068864_100106418 Ga0068864_1001064183 495
136 3300026095 Ga0207676_10086947 Ga0207676_100869473 495
137 3300031903 Ga0307407_10045298 Ga0307407_100452982 495
138 3300032002 Ga0307416_100067115 Ga0307416_1000671152 495
139 3300032126 Ga0307415_100067985 Ga0307415_1000679852 495
140 3300009553 Ga0105249_10059626 Ga0105249_100596263 496
141 3300013306 Ga0163162_10051666 Ga0163162_100516663 496
142 3300017792 Ga0163161_10032488 Ga0163161_100324883 496
143 3300005354 Ga0070675_100068555 Ga0070675_1000685553 497
144 3300025926 Ga0207659_10060794 Ga0207659_100607942 497
145 3300009176 Ga0105242_10137433 Ga0105242_101374332 498
146 3300013307 Ga0157372_10006938 Ga0157372_100069384 498
147 3300014325 Ga0163163_10184022 Ga0163163_101840222 498
148 3300049571 Ga0501034_0011063 Ga0501034_0011063_6199_7728 498
149 3300049822 Ga0501035_0013893 Ga0501035_0013893_865_2394 498
150 3300001979 JGI24740J21852_10010043 JGI24740J21852_100100432 500
151 3300005293 Ga0065715_10005922 Ga0065715_100059224 500
152 3300005329 Ga0070683_100003881 Ga0070683_1000038815 500
153 3300005329 Ga0070683_100024807 Ga0070683_1000248074 500
154 3300005331 Ga0070670_100043497 Ga0070670_1000434972 500
155 3300005334 Ga0068869_100031774 Ga0068869_1000317742 500
156 3300005334 Ga0068869_100066547 Ga0068869_1000665472 500
157 3300005335 Ga0070666_10069292 Ga0070666_100692921 500
158 3300005338 Ga0068868_100027504 Ga0068868_1000275041 500
159 3300005339 Ga0070660_100057014 Ga0070660_1000570143 500
160 3300005340 Ga0070689_100126623 Ga0070689_1001266232 500
161 3300005344 Ga0070661_100003179 Ga0070661_1000031792 500
162 3300005344 Ga0070661_100019630 Ga0070661_1000196303 500
163 3300005354 Ga0070675_100159016 Ga0070675_1001590162 500
164 3300005354 Ga0070675_100201221 Ga0070675_1002012211 500
165 3300005364 Ga0070673_100012979 Ga0070673_1000129792 500
166 3300005366 Ga0070659_100001835 Ga0070659_1000018354 500
167 3300005366 Ga0070659_100088833 Ga0070659_1000888333 500
168 3300005457 Ga0070662_100047273 Ga0070662_1000472732 500
169 3300005459 Ga0068867_100144568 Ga0068867_1001445681 500
170 3300005466 Ga0070685_10046380 Ga0070685_100463801 500
171 3300005471 Ga0070698_100004621 Ga0070698_10000462111 500
172 3300005530 Ga0070679_100018398 Ga0070679_1000183981 500
173 3300005535 Ga0070684_100000285 Ga0070684_10000028523 500
174 3300005535 Ga0070684_100083519 Ga0070684_1000835193 500
175 3300005539 Ga0068853_100004573 Ga0068853_10000457312 500
176 3300005539 Ga0068853_100004633 Ga0068853_1000046333 500
177 3300005548 Ga0070665_100051321 Ga0070665_1000513212 500
178 3300005563 Ga0068855_100018440 Ga0068855_1000184402 500
179 3300005564 Ga0070664_100000423 Ga0070664_1000004238 500
180 3300005564 Ga0070664_100005995 Ga0070664_1000059952 500
181 3300005564 Ga0070664_100160968 Ga0070664_1001609682 500
182 3300005577 Ga0068857_100001120 Ga0068857_1000011205 500
183 3300005577 Ga0068857_100131288 Ga0068857_1001312883 500
184 3300005614 Ga0068856_100023625 Ga0068856_1000236254 500
185 3300005616 Ga0068852_100005821 Ga0068852_1000058213 500
186 3300005617 Ga0068859_100322990 Ga0068859_1003229902 500
187 3300005618 Ga0068864_100039178 Ga0068864_1000391782 500
188 3300005618 Ga0068864_100057425 Ga0068864_1000574251 500
189 3300005719 Ga0068861_100029967 Ga0068861_1000299674 500
190 3300005841 Ga0068863_100041058 Ga0068863_1000410584 500
191 3300005841 Ga0068863_100095882 Ga0068863_1000958823 500
192 3300005842 Ga0068858_100025824 Ga0068858_1000258242 500
193 3300006358 Ga0068871_100052238 Ga0068871_1000522382 500
194 3300006844 Ga0075428_100087239 Ga0075428_1000872393 500
195 3300006847 Ga0075431_100017748 Ga0075431_1000177484 500
196 3300006881 Ga0068865_100082044 Ga0068865_1000820442 500
197 3300006931 Ga0097620_100322987 Ga0097620_1003229871 500
198 3300009176 Ga0105242_10010261 Ga0105242_100102612 500
199 3300009545 Ga0105237_10003754 Ga0105237_1000375412 500
200 3300009553 Ga0105249_10015068 Ga0105249_100150685 500
201 3300009553 Ga0105249_10080308 Ga0105249_100803082 500
202 3300010375 Ga0105239_10113216 Ga0105239_101132163 500
203 3300013105 Ga0157369_10033782 Ga0157369_100337825 500
204 3300013105 Ga0157369_10076189 Ga0157369_100761892 500
205 3300013296 Ga0157374_10027330 Ga0157374_100273303 500
206 3300013297 Ga0157378_10021429 Ga0157378_100214294 500
207 3300013297 Ga0157378_10248826 Ga0157378_102488261 500
208 3300013306 Ga0163162_10012776 Ga0163162_100127766 500
209 3300013306 Ga0163162_10023195 Ga0163162_100231953 500
210 3300013307 Ga0157372_10176283 Ga0157372_101762832 500
211 3300013307 Ga0157372_10224273 Ga0157372_102242732 500
212 3300013308 Ga0157375_10194362 Ga0157375_101943621 500
213 3300014325 Ga0163163_10021454 Ga0163163_100214542 500
214 3300014326 Ga0157380_10062697 Ga0157380_100626973 500
215 3300014745 Ga0157377_10041185 Ga0157377_100411851 500
216 3300014968 Ga0157379_10216239 Ga0157379_102162391 500
217 3300014969 Ga0157376_10038996 Ga0157376_100389964 500
218 3300014969 Ga0157376_10045398 Ga0157376_100453984 500
219 3300025904 Ga0207647_10041551 Ga0207647_100415513 500
220 3300025908 Ga0207643_10029828 Ga0207643_100298283 500
221 3300025919 Ga0207657_10002233 Ga0207657_100022336 500
222 3300025920 Ga0207649_10005070 Ga0207649_100050703 500
223 3300025920 Ga0207649_10051897 Ga0207649_100518972 500
224 3300025921 Ga0207652_10049511 Ga0207652_100495111 500
225 3300025923 Ga0207681_10037132 Ga0207681_100371322 500
226 3300025925 Ga0207650_10020115 Ga0207650_100201152 500
227 3300025931 Ga0207644_10036396 Ga0207644_100363963 500
228 3300025931 Ga0207644_10092296 Ga0207644_100922962 500
229 3300025932 Ga0207690_10003834 Ga0207690_100038345 500
230 3300025933 Ga0207706_10014897 Ga0207706_100148975 500
231 3300025933 Ga0207706_10066835 Ga0207706_100668352 500
232 3300025934 Ga0207686_10006459 Ga0207686_100064596 500
233 3300025940 Ga0207691_10069432 Ga0207691_100694322 500
234 3300025942 Ga0207689_10007269 Ga0207689_100072698 500
235 3300025942 Ga0207689_10032672 Ga0207689_100326722 500
236 3300025944 Ga0207661_10001045 Ga0207661_1000104513 500
237 3300025945 Ga0207679_10000550 Ga0207679_1000055015 500
238 3300025960 Ga0207651_10012852 Ga0207651_100128522 500
239 3300025961 Ga0207712_10017273 Ga0207712_100172732 500
240 3300025961 Ga0207712_10085710 Ga0207712_100857101 500
241 3300026023 Ga0207677_10028264 Ga0207677_100282643 500
242 3300026023 Ga0207677_10065216 Ga0207677_100652163 500
243 3300026035 Ga0207703_10014111 Ga0207703_100141112 500
244 3300026067 Ga0207678_10019607 Ga0207678_100196073 500
245 3300026088 Ga0207641_10007205 Ga0207641_100072052 500
246 3300026088 Ga0207641_10065654 Ga0207641_100656543 500
247 3300026089 Ga0207648_10069019 Ga0207648_100690192 500
248 3300026089 Ga0207648_10111825 Ga0207648_101118252 500
249 3300026116 Ga0207674_10005455 Ga0207674_100054555 500
250 3300026116 Ga0207674_10016092 Ga0207674_100160921 500
251 3300026118 Ga0207675_100019396 Ga0207675_1000193963 500
252 3300026121 Ga0207683_10067950 Ga0207683_100679504 500
253 3300026142 Ga0207698_10094196 Ga0207698_100941963 500
254 3300031251 Ga0265327_10000385 Ga0265327_1000038563 500
255 3300031507 Ga0307509_10023686 Ga0307509_100236863 500
256 3300031507 Ga0307509_10036873 Ga0307509_100368733 500
257 3300031548 Ga0307408_100083874 Ga0307408_1000838742 500
258 3300031616 Ga0307508_10000354 Ga0307508_1000035436 500
259 3300036401 Ga0373937_0098493 Ga0373937_0098493_1027_2547 500
260 3300037471 Ga0395905_0010691 Ga0395905_0010691_7074_8588 500
261 3300047320 Ga0495672_0046713 Ga0495672_0046713_235_1740 500
262 3300048913 Ga0496110_0147378 Ga0496110_0147378_562_2076 500
263 3300049569 Ga0501032_0000933 Ga0501032_0000933_11223_12728 500
264 3300049572 Ga0501036_0015551 Ga0501036_0015551_1495_3000 500
265 3300049575 Ga0501039_0055675 Ga0501039_0055675_218_1723 500
266 3300049579 Ga0501043_0022801 Ga0501043_0022801_3069_4574 500
267 3300049580 Ga0501046_0006430 Ga0501046_0006430_8261_9766 500
268 3300049581 Ga0501047_0042058 Ga0501047_0042058_2076_3581 500
269 3300049582 Ga0501048_0006411 Ga0501048_0006411_5409_6914 500
270 3300049589 Ga0501073_0097618 Ga0501073_0097618_373_1878 500
271 3300049590 Ga0501074_0000668 Ga0501074_0000668_634_2139 500
272 3300049822 Ga0501035_0011988 Ga0501035_0011988_3968_5473 500
273 3300049823 Ga0501044_0026200 Ga0501044_0026200_483_1988 500
274 3300050509 nmdc:mga0qj67_3636_c1 nmdc:mga0qj67_3636_c1_6188_7702 500

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03435

Sacchrp_dh_NADP

Saccharopine dehydrogenase NADP binding domain

56

174

0.95

PF16653

Sacchrp_dh_C

Saccharopine dehydrogenase C-terminal domain

178

410

0.85

PF16653

Sacchrp_dh_C

Saccharopine dehydrogenase C-terminal domain

390

541

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o1p-assembly1.cif.gz_A-2 crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase. 0.8901 2 500
5l78-assembly1.cif.gz_A crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in nad+ bound form) 0.8898 2 500
5l78-assembly1.cif.gz_A crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in nad+ bound form) 0.8858 2 500
5l78-assembly1.cif.gz_B crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in nad+ bound form) 0.8857 2 500
5o1p-assembly1.cif.gz_A-2 crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase. 0.8824 2 500
ID Description Score Start End Superfamily
af_A0A1D8PKJ4_3_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9496 2 126 3.40.50.720
af_A0A1D8PKJ4_3_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.942 2 126 3.40.50.720
af_A0A0P0VQF9_62_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.929 2 131 3.40.50.720
1e5lB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9285 127 441 3.30.360.10
af_Q54NG9_2_127_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9025 2 127 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q5ZT01-F1-model_v4 Saccharopine dehydrogenase 0.9848 1 113 GO:0004753
GO:0005737
GO:0019878
AF-A0A090Q8W3-F1-model_v4 deleted 0.9835 406 500
AF-A0A662A8G3-F1-model_v4 Saccharopine dehydrogenase 0.9814 1 136 GO:0004753
GO:0005737
GO:0019878
AF-A0A7Y2C2Q8-F1-model_v4 Saccharopine dehydrogenase 0.9797 1 131 GO:0004753
GO:0005737
GO:0019878
AF-A0A4Q3S4V4-F1-model_v4 Saccharopine dehydrogenase 0.9777 1 284 GO:0004753
GO:0005737
GO:0019878

Feature Viewer

pLDDT pTM Quality
88.91 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map