F379732
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 185 | 264 | 484 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10008093|Ga0163162_100080935 |
| Length | 549 |
| Sequence | VNLQWADLGLTSYQLPANPQPAQSRQSTNINLLSNLKFQISNSNLSFFFAFPMKHILLFGAGKSATCLIDYLKQQCSEKDWKFTVCDTNIEALRAKLGNARNTEGISINVEDETQRKDLVKQADVVISLLPAHLHYLVAQDCLEFGKHLLTASYVDEKISNLRSKISDKNILFLCEMGLDPGIDHMSAMKIIHEIKDKGGKITSFKSHCGGLVAPESDDNPWHYKISWNPRNVVMAGKAGAIYKENGKEVHEEYKDLFKPERALEMEELGHLSYYPNRDSLSYIDTYQLHETDTFIRTTLRFPEFCYGWKNIIELHLTDEEVEYDTDRMTLKDFFKEWLSKQMTDRLKFSNDLLAKLLALQEQEEELKHEAELVGKEPELEHFMMVDEKGDLKDIGLDEVKNSAANAVMTKLHEANLAMKQLMFLGLDSEEMINKGKCSAADVLQFVLERKLALKEGDKDMIVMLHEFEVEEGNKKYEVKSSLIVLGEDNVRTAMAKTVGLPLGIAAKLILEGTMNVTGLHIPVIPEIYEPVLKELEQNGIKFKETTTN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 2 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 3 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 4 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 5 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 6 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 7 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 8 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 9 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 10 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 127 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 128 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 129 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 133 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 138 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 139 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 140 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 141 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 142 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 143 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 151 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 152 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 164 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 165 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 166 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 167 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 168 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 169 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 170 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 171 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 172 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 173 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 178 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 179 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 180 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 181 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 182 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 183 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 184 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 185 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.35 |
| Metatranscriptomes | 0 |
| Isolates | 3.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.3 |
| Nodule | 0 |
| Rhizoplane | 1.09 |
| Rhizosphere | 86.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010043 | 3300001979 | Unclassified | 3667 |
| 2 | JGI25406J46586_10037135 | 3300003203 | Bacteria | 1760 |
| 3 | rootL2_10010780 | 3300003322 | Bacteria | 3646 |
| 4 | rootH1_10031561 | 3300003323 | Bacteria | 10584 |
| 5 | JGI25160J50197_1000790 | 3300003354 | Bacteria | 17009 |
| 6 | JGI25160J50197_1010001 | 3300003354 | Bacteria | 3466 |
| 7 | Ga0055535_1003520 | 3300003761 | Bacteria | 4374 |
| 8 | Ga0055531_10000023 | 3300003794 | Bacteria | 165025 |
| 9 | Ga0065715_10005922 | 3300005293 | Bacteria | 3697 |
| 10 | Ga0070683_100003881 | 3300005329 | Bacteria | 12229 |
| 11 | Ga0070683_100024807 | 3300005329 | Bacteria | 5376 |
| 12 | Ga0070690_100001158 | 3300005330 | Bacteria | 13568 |
| 13 | Ga0070670_100042783 | 3300005331 | Bacteria | 3895 |
| 14 | Ga0070670_100043497 | 3300005331 | Bacteria | 3860 |
| 15 | Ga0068869_100031774 | 3300005334 | Bacteria | 3716 |
| 16 | Ga0068869_100066547 | 3300005334 | Bacteria | 2655 |
| 17 | Ga0070666_10013922 | 3300005335 | Bacteria | 5111 |
| 18 | Ga0070666_10069292 | 3300005335 | Bacteria | 2398 |
| 19 | Ga0068868_100027504 | 3300005338 | Bacteria | 4339 |
| 20 | Ga0070660_100057014 | 3300005339 | Bacteria | 3024 |
| 21 | Ga0070689_100126623 | 3300005340 | Unclassified | 2045 |
| 22 | Ga0070661_100003179 | 3300005344 | Bacteria | 11317 |
| 23 | Ga0070661_100019630 | 3300005344 | Bacteria | 4816 |
| 24 | Ga0070668_100008497 | 3300005347 | Bacteria | 7627 |
| 25 | Ga0070669_100061790 | 3300005353 | Bacteria | 2753 |
| 26 | Ga0070675_100028523 | 3300005354 | Bacteria | 4492 |
| 27 | Ga0070675_100068555 | 3300005354 | Bacteria | 2937 |
| 28 | Ga0070675_100159016 | 3300005354 | Bacteria | 1942 |
| 29 | Ga0070675_100201221 | 3300005354 | Bacteria | 1729 |
| 30 | Ga0070671_100049800 | 3300005355 | Bacteria | 3485 |
| 31 | Ga0070671_100059407 | 3300005355 | Bacteria | 3182 |
| 32 | Ga0070673_100012979 | 3300005364 | Bacteria | 5744 |
| 33 | Ga0070673_100049784 | 3300005364 | Bacteria | 3272 |
| 34 | Ga0070688_100079130 | 3300005365 | Bacteria | 2123 |
| 35 | Ga0070659_100001835 | 3300005366 | Bacteria | 15262 |
| 36 | Ga0070659_100088833 | 3300005366 | Bacteria | 2475 |
| 37 | Ga0070667_100015793 | 3300005367 | Bacteria | 6246 |
| 38 | Ga0070667_100111526 | 3300005367 | Bacteria | 2372 |
| 39 | Ga0070678_100020299 | 3300005456 | Bacteria | 4356 |
| 40 | Ga0070662_100047273 | 3300005457 | Unclassified | 3095 |
| 41 | Ga0070662_100049517 | 3300005457 | Bacteria | 3030 |
| 42 | Ga0068867_100036663 | 3300005459 | Bacteria | 3562 |
| 43 | Ga0068867_100117232 | 3300005459 | Bacteria | 2053 |
| 44 | Ga0068867_100144568 | 3300005459 | Unclassified | 1862 |
| 45 | Ga0070685_10046380 | 3300005466 | Bacteria | 2494 |
| 46 | Ga0070698_100004621 | 3300005471 | Bacteria | 15125 |
| 47 | Ga0070679_100018398 | 3300005530 | Bacteria | 6781 |
| 48 | Ga0070684_100000285 | 3300005535 | Bacteria | 35210 |
| 49 | Ga0070684_100083519 | 3300005535 | Bacteria | 2830 |
| 50 | Ga0068853_100004573 | 3300005539 | Bacteria | 10729 |
| 51 | Ga0068853_100004633 | 3300005539 | Bacteria | 10659 |
| 52 | Ga0068853_100105078 | 3300005539 | Bacteria | 2501 |
| 53 | Ga0070672_100092160 | 3300005543 | Bacteria | 2446 |
| 54 | Ga0070665_100051321 | 3300005548 | Bacteria | 4137 |
| 55 | Ga0068855_100018440 | 3300005563 | Bacteria | 8386 |
| 56 | Ga0070664_100000423 | 3300005564 | Bacteria | 31649 |
| 57 | Ga0070664_100005995 | 3300005564 | Bacteria | 9824 |
| 58 | Ga0070664_100160968 | 3300005564 | Unclassified | 1986 |
| 59 | Ga0068857_100001120 | 3300005577 | Bacteria | 20847 |
| 60 | Ga0068857_100131288 | 3300005577 | Bacteria | 2259 |
| 61 | Ga0068854_100061144 | 3300005578 | Bacteria | 2727 |
| 62 | Ga0068856_100023625 | 3300005614 | Bacteria | 5978 |
| 63 | Ga0068852_100005821 | 3300005616 | Bacteria | 8851 |
| 64 | Ga0068859_100145810 | 3300005617 | Bacteria | 2442 |
| 65 | Ga0068859_100322990 | 3300005617 | Bacteria | 1637 |
| 66 | Ga0068864_100039178 | 3300005618 | Bacteria | 4050 |
| 67 | Ga0068864_100057425 | 3300005618 | Bacteria | 3362 |
| 68 | Ga0068864_100106418 | 3300005618 | Unclassified | 2494 |
| 69 | Ga0068861_100029967 | 3300005719 | Unclassified | 3984 |
| 70 | Ga0068863_100041058 | 3300005841 | Unclassified | 4398 |
| 71 | Ga0068863_100062056 | 3300005841 | Bacteria | 3535 |
| 72 | Ga0068863_100095882 | 3300005841 | Bacteria | 2816 |
| 73 | Ga0068858_100025824 | 3300005842 | Bacteria | 5464 |
| 74 | Ga0068862_100049218 | 3300005844 | Bacteria | 3599 |
| 75 | Ga0081539_10000899 | 3300005985 | Bacteria | 56635 |
| 76 | Ga0097621_100000122 | 3300006237 | Bacteria | 44726 |
| 77 | Ga0068871_100000412 | 3300006358 | Bacteria | 29568 |
| 78 | Ga0068871_100052238 | 3300006358 | Unclassified | 3309 |
| 79 | Ga0075428_100087239 | 3300006844 | Unclassified | 3403 |
| 80 | Ga0075431_100017748 | 3300006847 | Bacteria | 7235 |
| 81 | Ga0068865_100082044 | 3300006881 | Unclassified | 2317 |
| 82 | Ga0097620_100145794 | 3300006931 | Bacteria | 2442 |
| 83 | Ga0097620_100322987 | 3300006931 | Bacteria | 1637 |
| 84 | Ga0111539_10001798 | 3300009094 | Bacteria | 28539 |
| 85 | Ga0105242_10010261 | 3300009176 | Bacteria | 7181 |
| 86 | Ga0105242_10137433 | 3300009176 | Unclassified | 2116 |
| 87 | Ga0105248_10046755 | 3300009177 | Bacteria | 4852 |
| 88 | Ga0105237_10003754 | 3300009545 | Bacteria | 17897 |
| 89 | Ga0105249_10015068 | 3300009553 | Bacteria | 6840 |
| 90 | Ga0105249_10050935 | 3300009553 | Bacteria | 3776 |
| 91 | Ga0105249_10059626 | 3300009553 | Bacteria | 3500 |
| 92 | Ga0105249_10080308 | 3300009553 | Bacteria | 3029 |
| 93 | Ga0105239_10113216 | 3300010375 | Bacteria | 3009 |
| 94 | Ga0157369_10033782 | 3300013105 | Bacteria | 5617 |
| 95 | Ga0157369_10076189 | 3300013105 | Bacteria | 3595 |
| 96 | Ga0157374_10027330 | 3300013296 | Bacteria | 5144 |
| 97 | Ga0157378_10021429 | 3300013297 | Bacteria | 5683 |
| 98 | Ga0157378_10033031 | 3300013297 | Bacteria | 4573 |
| 99 | Ga0157378_10248826 | 3300013297 | Bacteria | 1701 |
| 100 | Ga0163162_10000703 | 3300013306 | Bacteria | 30932 |
| 101 | Ga0163162_10008093 | 3300013306 | Bacteria | 10261 |
| 102 | Ga0163162_10012776 | 3300013306 | Bacteria | 8202 |
| 103 | Ga0163162_10023195 | 3300013306 | Bacteria | 6122 |
| 104 | Ga0163162_10051666 | 3300013306 | Bacteria | 4124 |
| 105 | Ga0163162_10338760 | 3300013306 | Bacteria | 1636 |
| 106 | Ga0157372_10006938 | 3300013307 | Bacteria | 12055 |
| 107 | Ga0157372_10176283 | 3300013307 | Unclassified | 2474 |
| 108 | Ga0157372_10224273 | 3300013307 | Bacteria | 2179 |
| 109 | Ga0157375_10000162 | 3300013308 | Bacteria | 63098 |
| 110 | Ga0157375_10194362 | 3300013308 | Bacteria | 2184 |
| 111 | Ga0163163_10005940 | 3300014325 | Bacteria | 10625 |
| 112 | Ga0163163_10021454 | 3300014325 | Bacteria | 6095 |
| 113 | Ga0163163_10184022 | 3300014325 | Bacteria | 2137 |
| 114 | Ga0157380_10007340 | 3300014326 | Bacteria | 7827 |
| 115 | Ga0157380_10062697 | 3300014326 | Bacteria | 2979 |
| 116 | Ga0157380_10310645 | 3300014326 | Bacteria | 1457 |
| 117 | Ga0157377_10022614 | 3300014745 | Bacteria | 3322 |
| 118 | Ga0157377_10041185 | 3300014745 | Bacteria | 2561 |
| 119 | Ga0157379_10173805 | 3300014968 | Bacteria | 1944 |
| 120 | Ga0157379_10216239 | 3300014968 | Unclassified | 1736 |
| 121 | Ga0157376_10001595 | 3300014969 | Bacteria | 15011 |
| 122 | Ga0157376_10038996 | 3300014969 | Unclassified | 3870 |
| 123 | Ga0157376_10045398 | 3300014969 | Bacteria | 3617 |
| 124 | Ga0182005_1000126 | 3300015265 | Bacteria | 53914 |
| 125 | Ga0163161_10001382 | 3300017792 | Bacteria | 17961 |
| 126 | Ga0163161_10005549 | 3300017792 | Bacteria | 8739 |
| 127 | Ga0163161_10032488 | 3300017792 | Unclassified | 3727 |
| 128 | Ga0209258_100098 | 3300025242 | Bacteria | 215216 |
| 129 | Ga0209148_1000120 | 3300025254 | Bacteria | 186836 |
| 130 | Ga0207426_1000019 | 3300025302 | Bacteria | 558579 |
| 131 | Ga0207426_1000137 | 3300025302 | Bacteria | 199010 |
| 132 | Ga0207426_1010725 | 3300025302 | Bacteria | 3539 |
| 133 | Ga0209257_1000013 | 3300025304 | Bacteria | 1047305 |
| 134 | Ga0207680_10041943 | 3300025903 | Bacteria | 2673 |
| 135 | Ga0207647_10041551 | 3300025904 | Bacteria | 2890 |
| 136 | Ga0207643_10017742 | 3300025908 | Bacteria | 3896 |
| 137 | Ga0207643_10029828 | 3300025908 | Bacteria | 3034 |
| 138 | Ga0207657_10002233 | 3300025919 | Bacteria | 20999 |
| 139 | Ga0207649_10005070 | 3300025920 | Bacteria | 7123 |
| 140 | Ga0207649_10051897 | 3300025920 | Bacteria | 2541 |
| 141 | Ga0207652_10049511 | 3300025921 | Bacteria | 3597 |
| 142 | Ga0207681_10032049 | 3300025923 | Bacteria | 3438 |
| 143 | Ga0207681_10037132 | 3300025923 | Bacteria | 3219 |
| 144 | Ga0207650_10020115 | 3300025925 | Bacteria | 4702 |
| 145 | Ga0207659_10060794 | 3300025926 | Bacteria | 2721 |
| 146 | Ga0207644_10036396 | 3300025931 | Bacteria | 3455 |
| 147 | Ga0207644_10040764 | 3300025931 | Bacteria | 3282 |
| 148 | Ga0207644_10092296 | 3300025931 | Unclassified | 2259 |
| 149 | Ga0207690_10003834 | 3300025932 | Bacteria | 8898 |
| 150 | Ga0207706_10013177 | 3300025933 | Bacteria | 7524 |
| 151 | Ga0207706_10014897 | 3300025933 | Bacteria | 7041 |
| 152 | Ga0207706_10066835 | 3300025933 | Bacteria | 3164 |
| 153 | Ga0207686_10006459 | 3300025934 | Bacteria | 6311 |
| 154 | Ga0207691_10069432 | 3300025940 | Bacteria | 3183 |
| 155 | Ga0207711_10071646 | 3300025941 | Bacteria | 3008 |
| 156 | Ga0207689_10007269 | 3300025942 | Bacteria | 9722 |
| 157 | Ga0207689_10011302 | 3300025942 | Bacteria | 7662 |
| 158 | Ga0207689_10032672 | 3300025942 | Bacteria | 4326 |
| 159 | Ga0207661_10001045 | 3300025944 | Bacteria | 18375 |
| 160 | Ga0207679_10000550 | 3300025945 | Bacteria | 25168 |
| 161 | Ga0207651_10012852 | 3300025960 | Bacteria | 4760 |
| 162 | Ga0207651_10060383 | 3300025960 | Bacteria | 2632 |
| 163 | Ga0207712_10017273 | 3300025961 | Bacteria | 4684 |
| 164 | Ga0207712_10085710 | 3300025961 | Bacteria | 2306 |
| 165 | Ga0207640_10070994 | 3300025981 | Bacteria | 2344 |
| 166 | Ga0207658_10015914 | 3300025986 | Bacteria | 5165 |
| 167 | Ga0207677_10028264 | 3300026023 | Bacteria | 3543 |
| 168 | Ga0207677_10065216 | 3300026023 | Bacteria | 2540 |
| 169 | Ga0207703_10014111 | 3300026035 | Bacteria | 6228 |
| 170 | Ga0207639_10079158 | 3300026041 | Bacteria | 2597 |
| 171 | Ga0207678_10019607 | 3300026067 | Bacteria | 5945 |
| 172 | Ga0207708_10112543 | 3300026075 | Bacteria | 2114 |
| 173 | Ga0207641_10007205 | 3300026088 | Bacteria | 9271 |
| 174 | Ga0207641_10016765 | 3300026088 | Bacteria | 6000 |
| 175 | Ga0207641_10065654 | 3300026088 | Bacteria | 3105 |
| 176 | Ga0207648_10069019 | 3300026089 | Bacteria | 3080 |
| 177 | Ga0207648_10111825 | 3300026089 | Unclassified | 2398 |
| 178 | Ga0207648_10193298 | 3300026089 | Bacteria | 1804 |
| 179 | Ga0207676_10047521 | 3300026095 | Bacteria | 3327 |
| 180 | Ga0207676_10086947 | 3300026095 | Bacteria | 2555 |
| 181 | Ga0207674_10005455 | 3300026116 | Bacteria | 15106 |
| 182 | Ga0207674_10016092 | 3300026116 | Bacteria | 8193 |
| 183 | Ga0207674_10051356 | 3300026116 | Bacteria | 4208 |
| 184 | Ga0207675_100019396 | 3300026118 | Bacteria | 6345 |
| 185 | Ga0207675_100210630 | 3300026118 | Bacteria | 1869 |
| 186 | Ga0207683_10031050 | 3300026121 | Bacteria | 4635 |
| 187 | Ga0207683_10067950 | 3300026121 | Bacteria | 3144 |
| 188 | Ga0207698_10094196 | 3300026142 | Bacteria | 2462 |
| 189 | Ga0268265_10303091 | 3300028380 | Bacteria | 1439 |
| 190 | Ga0265327_10000385 | 3300031251 | Bacteria | 83048 |
| 191 | Ga0265327_10000644 | 3300031251 | Bacteria | 56620 |
| 192 | Ga0307509_10023686 | 3300031507 | Bacteria | 6885 |
| 193 | Ga0307509_10036873 | 3300031507 | Bacteria | 5349 |
| 194 | Ga0307408_100083874 | 3300031548 | Unclassified | 2389 |
| 195 | Ga0307508_10000354 | 3300031616 | Bacteria | 55733 |
| 196 | Ga0316576_10004324 | 3300031727 | Bacteria | 8498 |
| 197 | Ga0316576_10049018 | 3300031727 | Bacteria | 3065 |
| 198 | Ga0316577_10000274 | 3300031733 | Bacteria | 18332 |
| 199 | Ga0307407_10045298 | 3300031903 | Unclassified | 2485 |
| 200 | Ga0307416_100067115 | 3300032002 | Unclassified | 2957 |
| 201 | Ga0307415_100067985 | 3300032126 | Unclassified | 2492 |
| 202 | Ga0316580_10005260 | 3300032139 | Bacteria | 3772 |
| 203 | Ga0316574_0018408 | 3300035398 | Bacteria | 4104 |
| 204 | Ga0373937_0098493 | 3300036401 | Bacteria | 2712 |
| 205 | Ga0316582_0004741 | 3300036647 | Bacteria | 6922 |
| 206 | Ga0316582_0037742 | 3300036647 | Bacteria | 2997 |
| 207 | Ga0395905_0010691 | 3300037471 | Bacteria | 8901 |
| 208 | Ga0439431_0000202 | 3300041997 | Bacteria | 11736 |
| 209 | Ga0439445_0004952 | 3300042004 | Bacteria | 3026 |
| 210 | Ga0439449_0041245 | 3300042007 | Bacteria | 1716 |
| 211 | Ga0451577_0210125 | 3300042876 | Bacteria | 1758 |
| 212 | Ga0453684_0071217 | 3300044712 | Unclassified | 4397 |
| 213 | Ga0466959_0085523 | 3300045049 | Bacteria | 2269 |
| 214 | Ga0495643_0020778 | 3300046522 | Bacteria | 3778 |
| 215 | Ga0495668_0000624 | 3300046616 | Bacteria | 42812 |
| 216 | Ga0495668_0025693 | 3300046616 | Unclassified | 3345 |
| 217 | Ga0495636_0000020 | 3300047318 | Bacteria | 75085 |
| 218 | Ga0495672_0046713 | 3300047320 | Bacteria | 2581 |
| 219 | Ga0495686_0000102 | 3300047472 | Bacteria | 177525 |
| 220 | Ga0495686_0004760 | 3300047472 | Bacteria | 10981 |
| 221 | Ga0496100_0054737 | 3300048903 | Bacteria | 2604 |
| 222 | Ga0496101_0115021 | 3300048904 | Bacteria | 2029 |
| 223 | Ga0496110_0147378 | 3300048913 | Bacteria | 2130 |
| 224 | Ga0496121_0000007 | 3300048924 | Bacteria | 942516 |
| 225 | Ga0501032_0000933 | 3300049569 | Bacteria | 23653 |
| 226 | Ga0501034_0011063 | 3300049571 | Bacteria | 9371 |
| 227 | Ga0501034_0061385 | 3300049571 | Bacteria | 3774 |
| 228 | Ga0501036_0015551 | 3300049572 | Bacteria | 6358 |
| 229 | Ga0501038_0079407 | 3300049574 | Bacteria | 2767 |
| 230 | Ga0501039_0055675 | 3300049575 | Bacteria | 3064 |
| 231 | Ga0501043_0022801 | 3300049579 | Bacteria | 4909 |
| 232 | Ga0501043_0327188 | 3300049579 | Bacteria | 1168 |
| 233 | Ga0501046_0006430 | 3300049580 | Bacteria | 10409 |
| 234 | Ga0501047_0042058 | 3300049581 | Bacteria | 4416 |
| 235 | Ga0501048_0006411 | 3300049582 | Bacteria | 8943 |
| 236 | Ga0501073_0097618 | 3300049589 | Bacteria | 2040 |
| 237 | Ga0501074_0000668 | 3300049590 | Bacteria | 21402 |
| 238 | Ga0501201_001107 | 3300049651 | Bacteria | 2532 |
| 239 | Ga0501217_000220 | 3300049661 | Bacteria | 8651 |
| 240 | Ga0501223_000584 | 3300049663 | Bacteria | 8796 |
| 241 | Ga0501235_002702 | 3300049669 | Bacteria | 3813 |
| 242 | Ga0501238_003928 | 3300049671 | Bacteria | 1843 |
| 243 | Ga0501261_001591 | 3300049690 | Bacteria | 2789 |
| 244 | Ga0501221_001138 | 3300049704 | Bacteria | 4386 |
| 245 | Ga0501225_0003821 | 3300049705 | Bacteria | 4523 |
| 246 | Ga0501234_013239 | 3300049707 | Bacteria | 1294 |
| 247 | Ga0501241_007506 | 3300049758 | Bacteria | 1996 |
| 248 | Ga0501035_0011988 | 3300049822 | Bacteria | 8018 |
| 249 | Ga0501035_0013893 | 3300049822 | Bacteria | 7429 |
| 250 | Ga0501035_0056323 | 3300049822 | Bacteria | 3508 |
| 251 | Ga0501044_0026200 | 3300049823 | Bacteria | 6175 |
| 252 | Ga0501044_0078605 | 3300049823 | Bacteria | 3343 |
| 253 | nmdc:mga0qj67_3636_c1 | 3300050509 | Bacteria | 11125 |
| 254 | nmdc:mga08y16_93925_c1 | 3300050511 | Bacteria | 3125 |
| 255 | Ga0500644_0000040 | 3300053088 | Bacteria | 77696 |
| 256 | Ga0500641_0067867 | 3300053096 | Bacteria | 1496 |
| 257 | Ga0500569_000087 | 3300053109 | Bacteria | 14743 |
| 258 | Ga0500642_0010781 | 3300053130 | Bacteria | 3239 |
| 259 | Ga0500658_0002246 | 3300053134 | Bacteria | 7491 |
| 260 | Ga0500616_0001400 | 3300053153 | Bacteria | 23227 |
| 261 | Ga0500616_0008423 | 3300053153 | Bacteria | 6406 |
| 262 | Ga0500622_0000110 | 3300053156 | Bacteria | 83911 |
| 263 | Ga0500627_0002682 | 3300053158 | Bacteria | 5330 |
| 264 | Ga0500633_0000573 | 3300053160 | Bacteria | 6012 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049579 | Ga0501043_0327188 | Ga0501043_0327188_34_1128 | 361 |
| 2 | 3300049661 | Ga0501217_000220 | Ga0501217_000220_7358_8605 | 409 |
| 3 | 3300049707 | Ga0501234_013239 | Ga0501234_013239_22_1269 | 409 |
| 4 | 3300014326 | Ga0157380_10310645 | Ga0157380_103106451 | 435 |
| 5 | iso_pu_bacteria | 2818991460 | 2819678327 | 436 |
| 6 | iso_pu_bacteria | 2929177148 | 2929180960 | 436 |
| 7 | iso_pu_bacteria | 2945977869 | 2945983359 | 436 |
| 8 | iso_pu_bacteria | 2946013367 | 2946017251 | 436 |
| 9 | 3300047472 | Ga0495686_0000102 | Ga0495686_0000102_40101_41438 | 437 |
| 10 | 3300049574 | Ga0501038_0079407 | Ga0501038_0079407_1268_2590 | 437 |
| 11 | 3300049822 | Ga0501035_0056323 | Ga0501035_0056323_413_1735 | 437 |
| 12 | 3300049823 | Ga0501044_0078605 | Ga0501044_0078605_1109_2431 | 437 |
| 13 | iso_pu_bacteria | 2818991442 | 2819575670 | 437 |
| 14 | iso_pu_bacteria | 2821136567 | 2821138219 | 437 |
| 15 | iso_pu_bacteria | 2904467357 | 2904469015 | 437 |
| 16 | iso_pu_bacteria | 2929239360 | 2929242897 | 437 |
| 17 | 3300046616 | Ga0495668_0000624 | Ga0495668_0000624_22707_24035 | 438 |
| 18 | 3300047472 | Ga0495686_0004760 | Ga0495686_0004760_4342_5670 | 438 |
| 19 | 3300053096 | Ga0500641_0067867 | Ga0500641_0067867_152_1480 | 438 |
| 20 | 3300053130 | Ga0500642_0010781 | Ga0500642_0010781_1767_3095 | 438 |
| 21 | 3300053153 | Ga0500616_0001400 | Ga0500616_0001400_10644_11972 | 438 |
| 22 | 3300053158 | Ga0500627_0002682 | Ga0500627_0002682_2371_3699 | 438 |
| 23 | iso_pu_bacteria | 2884791551 | 2884793226 | 438 |
| 24 | iso_pu_bacteria | 2910245624 | 2910247105 | 438 |
| 25 | 3300003323 | rootH1_10031561 | rootH1_100315613 | 440 |
| 26 | 3300003354 | JGI25160J50197_1010001 | JGI25160J50197_10100013 | 440 |
| 27 | 3300025302 | Ga0207426_1000137 | Ga0207426_1000137107 | 440 |
| 28 | 3300045049 | Ga0466959_0085523 | Ga0466959_0085523_223_1545 | 440 |
| 29 | 3300046522 | Ga0495643_0020778 | Ga0495643_0020778_772_2100 | 440 |
| 30 | 3300003322 | rootL2_10010780 | rootL2_100107803 | 441 |
| 31 | 3300003761 | Ga0055535_1003520 | Ga0055535_10035203 | 441 |
| 32 | 3300003794 | Ga0055531_10000023 | Ga0055531_10000023135 | 441 |
| 33 | 3300005331 | Ga0070670_100042783 | Ga0070670_1000427833 | 441 |
| 34 | 3300005347 | Ga0070668_100008497 | Ga0070668_1000084971 | 441 |
| 35 | 3300005353 | Ga0070669_100061790 | Ga0070669_1000617902 | 441 |
| 36 | 3300005354 | Ga0070675_100028523 | Ga0070675_1000285235 | 441 |
| 37 | 3300005364 | Ga0070673_100049784 | Ga0070673_1000497842 | 441 |
| 38 | 3300005365 | Ga0070688_100079130 | Ga0070688_1000791302 | 441 |
| 39 | 3300005457 | Ga0070662_100049517 | Ga0070662_1000495173 | 441 |
| 40 | 3300005459 | Ga0068867_100117232 | Ga0068867_1001172322 | 441 |
| 41 | 3300005543 | Ga0070672_100092160 | Ga0070672_1000921602 | 441 |
| 42 | 3300005578 | Ga0068854_100061144 | Ga0068854_1000611443 | 441 |
| 43 | 3300005617 | Ga0068859_100145810 | Ga0068859_1001458102 | 441 |
| 44 | 3300005844 | Ga0068862_100049218 | Ga0068862_1000492183 | 441 |
| 45 | 3300006931 | Ga0097620_100145794 | Ga0097620_1001457942 | 441 |
| 46 | 3300009094 | Ga0111539_10001798 | Ga0111539_1000179822 | 441 |
| 47 | 3300009553 | Ga0105249_10050935 | Ga0105249_100509351 | 441 |
| 48 | 3300014326 | Ga0157380_10007340 | Ga0157380_100073404 | 441 |
| 49 | 3300014745 | Ga0157377_10022614 | Ga0157377_100226143 | 441 |
| 50 | 3300015265 | Ga0182005_1000126 | Ga0182005_100012628 | 441 |
| 51 | 3300025242 | Ga0209258_100098 | Ga0209258_10009838 | 441 |
| 52 | 3300025254 | Ga0209148_1000120 | Ga0209148_100012012 | 441 |
| 53 | 3300025302 | Ga0207426_1010725 | Ga0207426_10107252 | 441 |
| 54 | 3300025304 | Ga0209257_1000013 | Ga0209257_1000013574 | 441 |
| 55 | 3300025908 | Ga0207643_10017742 | Ga0207643_100177425 | 441 |
| 56 | 3300025923 | Ga0207681_10032049 | Ga0207681_100320492 | 441 |
| 57 | 3300025981 | Ga0207640_10070994 | Ga0207640_100709942 | 441 |
| 58 | 3300026075 | Ga0207708_10112543 | Ga0207708_101125432 | 441 |
| 59 | 3300026089 | Ga0207648_10193298 | Ga0207648_101932982 | 441 |
| 60 | 3300026116 | Ga0207674_10051356 | Ga0207674_100513563 | 441 |
| 61 | 3300028380 | Ga0268265_10303091 | Ga0268265_103030911 | 441 |
| 62 | 3300041997 | Ga0439431_0000202 | Ga0439431_0000202_4967_6292 | 441 |
| 63 | 3300042004 | Ga0439445_0004952 | Ga0439445_0004952_288_1613 | 441 |
| 64 | 3300042007 | Ga0439449_0041245 | Ga0439449_0041245_101_1513 | 441 |
| 65 | 3300048924 | Ga0496121_0000007 | Ga0496121_0000007_654263_655588 | 441 |
| 66 | 3300049571 | Ga0501034_0061385 | Ga0501034_0061385_1712_3037 | 441 |
| 67 | 3300049671 | Ga0501238_003928 | Ga0501238_003928_94_1419 | 441 |
| 68 | 3300049758 | Ga0501241_007506 | Ga0501241_007506_641_1966 | 441 |
| 69 | 3300050511 | nmdc:mga08y16_93925_c1 | nmdc:mga08y16_93925_c1_783_2135 | 441 |
| 70 | 3300053088 | Ga0500644_0000040 | Ga0500644_0000040_54473_55798 | 441 |
| 71 | 3300053109 | Ga0500569_000087 | Ga0500569_000087_12566_13891 | 441 |
| 72 | 3300053134 | Ga0500658_0002246 | Ga0500658_0002246_2332_3657 | 441 |
| 73 | 3300053153 | Ga0500616_0008423 | Ga0500616_0008423_1678_3003 | 441 |
| 74 | 3300053156 | Ga0500622_0000110 | Ga0500622_0000110_35729_37054 | 441 |
| 75 | 3300053160 | Ga0500633_0000573 | Ga0500633_0000573_2612_3937 | 441 |
| 76 | 3300047318 | Ga0495636_0000020 | Ga0495636_0000020_41066_42397 | 442 |
| 77 | 3300031251 | Ga0265327_10000644 | Ga0265327_100006445 | 443 |
| 78 | 3300031727 | Ga0316576_10049018 | Ga0316576_100490182 | 447 |
| 79 | 3300032139 | Ga0316580_10005260 | Ga0316580_100052603 | 447 |
| 80 | 3300036647 | Ga0316582_0037742 | Ga0316582_0037742_504_1877 | 447 |
| 81 | 3300003354 | JGI25160J50197_1000790 | JGI25160J50197_10007905 | 448 |
| 82 | 3300025302 | Ga0207426_1000019 | Ga0207426_1000019158 | 448 |
| 83 | 3300031727 | Ga0316576_10004324 | Ga0316576_100043244 | 448 |
| 84 | 3300031733 | Ga0316577_10000274 | Ga0316577_100002747 | 448 |
| 85 | 3300035398 | Ga0316574_0018408 | Ga0316574_0018408_1054_2451 | 448 |
| 86 | 3300036647 | Ga0316582_0004741 | Ga0316582_0004741_4971_6368 | 448 |
| 87 | 3300013306 | Ga0163162_10338760 | Ga0163162_103387601 | 456 |
| 88 | 3300005539 | Ga0068853_100105078 | Ga0068853_1001050782 | 465 |
| 89 | 3300026041 | Ga0207639_10079158 | Ga0207639_100791582 | 465 |
| 90 | 3300014325 | Ga0163163_10005940 | Ga0163163_100059407 | 468 |
| 91 | 3300003203 | JGI25406J46586_10037135 | JGI25406J46586_100371351 | 472 |
| 92 | 3300005985 | Ga0081539_10000899 | Ga0081539_1000089916 | 472 |
| 93 | 3300046616 | Ga0495668_0025693 | Ga0495668_0025693_161_1672 | 482 |
| 94 | 3300005355 | Ga0070671_100059407 | Ga0070671_1000594072 | 487 |
| 95 | 3300005367 | Ga0070667_100015793 | Ga0070667_1000157933 | 487 |
| 96 | 3300005841 | Ga0068863_100062056 | Ga0068863_1000620563 | 487 |
| 97 | 3300006237 | Ga0097621_100000122 | Ga0097621_10000012241 | 487 |
| 98 | 3300006358 | Ga0068871_100000412 | Ga0068871_10000041228 | 487 |
| 99 | 3300009177 | Ga0105248_10046755 | Ga0105248_100467552 | 487 |
| 100 | 3300013297 | Ga0157378_10033031 | Ga0157378_100330313 | 487 |
| 101 | 3300013306 | Ga0163162_10000703 | Ga0163162_100007038 | 487 |
| 102 | 3300013308 | Ga0157375_10000162 | Ga0157375_100001622 | 487 |
| 103 | 3300014969 | Ga0157376_10001595 | Ga0157376_100015952 | 487 |
| 104 | 3300017792 | Ga0163161_10001382 | Ga0163161_1000138219 | 487 |
| 105 | 3300025931 | Ga0207644_10040764 | Ga0207644_100407642 | 487 |
| 106 | 3300025941 | Ga0207711_10071646 | Ga0207711_100716462 | 487 |
| 107 | 3300025986 | Ga0207658_10015914 | Ga0207658_100159143 | 487 |
| 108 | 3300026088 | Ga0207641_10016765 | Ga0207641_100167653 | 487 |
| 109 | 3300048903 | Ga0496100_0054737 | Ga0496100_0054737_231_1826 | 487 |
| 110 | 3300025960 | Ga0207651_10060383 | Ga0207651_100603833 | 489 |
| 111 | 3300026121 | Ga0207683_10031050 | Ga0207683_100310503 | 489 |
| 112 | 3300005367 | Ga0070667_100111526 | Ga0070667_1001115261 | 491 |
| 113 | 3300013306 | Ga0163162_10008093 | Ga0163162_100080935 | 491 |
| 114 | 3300005459 | Ga0068867_100036663 | Ga0068867_1000366631 | 493 |
| 115 | 3300005330 | Ga0070690_100001158 | Ga0070690_1000011587 | 494 |
| 116 | 3300005335 | Ga0070666_10013922 | Ga0070666_100139223 | 494 |
| 117 | 3300005355 | Ga0070671_100049800 | Ga0070671_1000498003 | 494 |
| 118 | 3300005456 | Ga0070678_100020299 | Ga0070678_1000202993 | 494 |
| 119 | 3300014968 | Ga0157379_10173805 | Ga0157379_101738052 | 494 |
| 120 | 3300017792 | Ga0163161_10005549 | Ga0163161_100055498 | 494 |
| 121 | 3300025903 | Ga0207680_10041943 | Ga0207680_100419432 | 494 |
| 122 | 3300025933 | Ga0207706_10013177 | Ga0207706_100131775 | 494 |
| 123 | 3300025942 | Ga0207689_10011302 | Ga0207689_100113023 | 494 |
| 124 | 3300026095 | Ga0207676_10047521 | Ga0207676_100475213 | 494 |
| 125 | 3300026118 | Ga0207675_100210630 | Ga0207675_1002106301 | 494 |
| 126 | 3300042876 | Ga0451577_0210125 | Ga0451577_0210125_165_1649 | 494 |
| 127 | 3300044712 | Ga0453684_0071217 | Ga0453684_0071217_734_2218 | 494 |
| 128 | 3300048904 | Ga0496101_0115021 | Ga0496101_0115021_221_1732 | 494 |
| 129 | 3300049651 | Ga0501201_001107 | Ga0501201_001107_568_2070 | 494 |
| 130 | 3300049663 | Ga0501223_000584 | Ga0501223_000584_775_2277 | 494 |
| 131 | 3300049669 | Ga0501235_002702 | Ga0501235_002702_2239_3741 | 494 |
| 132 | 3300049690 | Ga0501261_001591 | Ga0501261_001591_251_1753 | 494 |
| 133 | 3300049704 | Ga0501221_001138 | Ga0501221_001138_1357_2859 | 494 |
| 134 | 3300049705 | Ga0501225_0003821 | Ga0501225_0003821_861_2363 | 494 |
| 135 | 3300005618 | Ga0068864_100106418 | Ga0068864_1001064183 | 495 |
| 136 | 3300026095 | Ga0207676_10086947 | Ga0207676_100869473 | 495 |
| 137 | 3300031903 | Ga0307407_10045298 | Ga0307407_100452982 | 495 |
| 138 | 3300032002 | Ga0307416_100067115 | Ga0307416_1000671152 | 495 |
| 139 | 3300032126 | Ga0307415_100067985 | Ga0307415_1000679852 | 495 |
| 140 | 3300009553 | Ga0105249_10059626 | Ga0105249_100596263 | 496 |
| 141 | 3300013306 | Ga0163162_10051666 | Ga0163162_100516663 | 496 |
| 142 | 3300017792 | Ga0163161_10032488 | Ga0163161_100324883 | 496 |
| 143 | 3300005354 | Ga0070675_100068555 | Ga0070675_1000685553 | 497 |
| 144 | 3300025926 | Ga0207659_10060794 | Ga0207659_100607942 | 497 |
| 145 | 3300009176 | Ga0105242_10137433 | Ga0105242_101374332 | 498 |
| 146 | 3300013307 | Ga0157372_10006938 | Ga0157372_100069384 | 498 |
| 147 | 3300014325 | Ga0163163_10184022 | Ga0163163_101840222 | 498 |
| 148 | 3300049571 | Ga0501034_0011063 | Ga0501034_0011063_6199_7728 | 498 |
| 149 | 3300049822 | Ga0501035_0013893 | Ga0501035_0013893_865_2394 | 498 |
| 150 | 3300001979 | JGI24740J21852_10010043 | JGI24740J21852_100100432 | 500 |
| 151 | 3300005293 | Ga0065715_10005922 | Ga0065715_100059224 | 500 |
| 152 | 3300005329 | Ga0070683_100003881 | Ga0070683_1000038815 | 500 |
| 153 | 3300005329 | Ga0070683_100024807 | Ga0070683_1000248074 | 500 |
| 154 | 3300005331 | Ga0070670_100043497 | Ga0070670_1000434972 | 500 |
| 155 | 3300005334 | Ga0068869_100031774 | Ga0068869_1000317742 | 500 |
| 156 | 3300005334 | Ga0068869_100066547 | Ga0068869_1000665472 | 500 |
| 157 | 3300005335 | Ga0070666_10069292 | Ga0070666_100692921 | 500 |
| 158 | 3300005338 | Ga0068868_100027504 | Ga0068868_1000275041 | 500 |
| 159 | 3300005339 | Ga0070660_100057014 | Ga0070660_1000570143 | 500 |
| 160 | 3300005340 | Ga0070689_100126623 | Ga0070689_1001266232 | 500 |
| 161 | 3300005344 | Ga0070661_100003179 | Ga0070661_1000031792 | 500 |
| 162 | 3300005344 | Ga0070661_100019630 | Ga0070661_1000196303 | 500 |
| 163 | 3300005354 | Ga0070675_100159016 | Ga0070675_1001590162 | 500 |
| 164 | 3300005354 | Ga0070675_100201221 | Ga0070675_1002012211 | 500 |
| 165 | 3300005364 | Ga0070673_100012979 | Ga0070673_1000129792 | 500 |
| 166 | 3300005366 | Ga0070659_100001835 | Ga0070659_1000018354 | 500 |
| 167 | 3300005366 | Ga0070659_100088833 | Ga0070659_1000888333 | 500 |
| 168 | 3300005457 | Ga0070662_100047273 | Ga0070662_1000472732 | 500 |
| 169 | 3300005459 | Ga0068867_100144568 | Ga0068867_1001445681 | 500 |
| 170 | 3300005466 | Ga0070685_10046380 | Ga0070685_100463801 | 500 |
| 171 | 3300005471 | Ga0070698_100004621 | Ga0070698_10000462111 | 500 |
| 172 | 3300005530 | Ga0070679_100018398 | Ga0070679_1000183981 | 500 |
| 173 | 3300005535 | Ga0070684_100000285 | Ga0070684_10000028523 | 500 |
| 174 | 3300005535 | Ga0070684_100083519 | Ga0070684_1000835193 | 500 |
| 175 | 3300005539 | Ga0068853_100004573 | Ga0068853_10000457312 | 500 |
| 176 | 3300005539 | Ga0068853_100004633 | Ga0068853_1000046333 | 500 |
| 177 | 3300005548 | Ga0070665_100051321 | Ga0070665_1000513212 | 500 |
| 178 | 3300005563 | Ga0068855_100018440 | Ga0068855_1000184402 | 500 |
| 179 | 3300005564 | Ga0070664_100000423 | Ga0070664_1000004238 | 500 |
| 180 | 3300005564 | Ga0070664_100005995 | Ga0070664_1000059952 | 500 |
| 181 | 3300005564 | Ga0070664_100160968 | Ga0070664_1001609682 | 500 |
| 182 | 3300005577 | Ga0068857_100001120 | Ga0068857_1000011205 | 500 |
| 183 | 3300005577 | Ga0068857_100131288 | Ga0068857_1001312883 | 500 |
| 184 | 3300005614 | Ga0068856_100023625 | Ga0068856_1000236254 | 500 |
| 185 | 3300005616 | Ga0068852_100005821 | Ga0068852_1000058213 | 500 |
| 186 | 3300005617 | Ga0068859_100322990 | Ga0068859_1003229902 | 500 |
| 187 | 3300005618 | Ga0068864_100039178 | Ga0068864_1000391782 | 500 |
| 188 | 3300005618 | Ga0068864_100057425 | Ga0068864_1000574251 | 500 |
| 189 | 3300005719 | Ga0068861_100029967 | Ga0068861_1000299674 | 500 |
| 190 | 3300005841 | Ga0068863_100041058 | Ga0068863_1000410584 | 500 |
| 191 | 3300005841 | Ga0068863_100095882 | Ga0068863_1000958823 | 500 |
| 192 | 3300005842 | Ga0068858_100025824 | Ga0068858_1000258242 | 500 |
| 193 | 3300006358 | Ga0068871_100052238 | Ga0068871_1000522382 | 500 |
| 194 | 3300006844 | Ga0075428_100087239 | Ga0075428_1000872393 | 500 |
| 195 | 3300006847 | Ga0075431_100017748 | Ga0075431_1000177484 | 500 |
| 196 | 3300006881 | Ga0068865_100082044 | Ga0068865_1000820442 | 500 |
| 197 | 3300006931 | Ga0097620_100322987 | Ga0097620_1003229871 | 500 |
| 198 | 3300009176 | Ga0105242_10010261 | Ga0105242_100102612 | 500 |
| 199 | 3300009545 | Ga0105237_10003754 | Ga0105237_1000375412 | 500 |
| 200 | 3300009553 | Ga0105249_10015068 | Ga0105249_100150685 | 500 |
| 201 | 3300009553 | Ga0105249_10080308 | Ga0105249_100803082 | 500 |
| 202 | 3300010375 | Ga0105239_10113216 | Ga0105239_101132163 | 500 |
| 203 | 3300013105 | Ga0157369_10033782 | Ga0157369_100337825 | 500 |
| 204 | 3300013105 | Ga0157369_10076189 | Ga0157369_100761892 | 500 |
| 205 | 3300013296 | Ga0157374_10027330 | Ga0157374_100273303 | 500 |
| 206 | 3300013297 | Ga0157378_10021429 | Ga0157378_100214294 | 500 |
| 207 | 3300013297 | Ga0157378_10248826 | Ga0157378_102488261 | 500 |
| 208 | 3300013306 | Ga0163162_10012776 | Ga0163162_100127766 | 500 |
| 209 | 3300013306 | Ga0163162_10023195 | Ga0163162_100231953 | 500 |
| 210 | 3300013307 | Ga0157372_10176283 | Ga0157372_101762832 | 500 |
| 211 | 3300013307 | Ga0157372_10224273 | Ga0157372_102242732 | 500 |
| 212 | 3300013308 | Ga0157375_10194362 | Ga0157375_101943621 | 500 |
| 213 | 3300014325 | Ga0163163_10021454 | Ga0163163_100214542 | 500 |
| 214 | 3300014326 | Ga0157380_10062697 | Ga0157380_100626973 | 500 |
| 215 | 3300014745 | Ga0157377_10041185 | Ga0157377_100411851 | 500 |
| 216 | 3300014968 | Ga0157379_10216239 | Ga0157379_102162391 | 500 |
| 217 | 3300014969 | Ga0157376_10038996 | Ga0157376_100389964 | 500 |
| 218 | 3300014969 | Ga0157376_10045398 | Ga0157376_100453984 | 500 |
| 219 | 3300025904 | Ga0207647_10041551 | Ga0207647_100415513 | 500 |
| 220 | 3300025908 | Ga0207643_10029828 | Ga0207643_100298283 | 500 |
| 221 | 3300025919 | Ga0207657_10002233 | Ga0207657_100022336 | 500 |
| 222 | 3300025920 | Ga0207649_10005070 | Ga0207649_100050703 | 500 |
| 223 | 3300025920 | Ga0207649_10051897 | Ga0207649_100518972 | 500 |
| 224 | 3300025921 | Ga0207652_10049511 | Ga0207652_100495111 | 500 |
| 225 | 3300025923 | Ga0207681_10037132 | Ga0207681_100371322 | 500 |
| 226 | 3300025925 | Ga0207650_10020115 | Ga0207650_100201152 | 500 |
| 227 | 3300025931 | Ga0207644_10036396 | Ga0207644_100363963 | 500 |
| 228 | 3300025931 | Ga0207644_10092296 | Ga0207644_100922962 | 500 |
| 229 | 3300025932 | Ga0207690_10003834 | Ga0207690_100038345 | 500 |
| 230 | 3300025933 | Ga0207706_10014897 | Ga0207706_100148975 | 500 |
| 231 | 3300025933 | Ga0207706_10066835 | Ga0207706_100668352 | 500 |
| 232 | 3300025934 | Ga0207686_10006459 | Ga0207686_100064596 | 500 |
| 233 | 3300025940 | Ga0207691_10069432 | Ga0207691_100694322 | 500 |
| 234 | 3300025942 | Ga0207689_10007269 | Ga0207689_100072698 | 500 |
| 235 | 3300025942 | Ga0207689_10032672 | Ga0207689_100326722 | 500 |
| 236 | 3300025944 | Ga0207661_10001045 | Ga0207661_1000104513 | 500 |
| 237 | 3300025945 | Ga0207679_10000550 | Ga0207679_1000055015 | 500 |
| 238 | 3300025960 | Ga0207651_10012852 | Ga0207651_100128522 | 500 |
| 239 | 3300025961 | Ga0207712_10017273 | Ga0207712_100172732 | 500 |
| 240 | 3300025961 | Ga0207712_10085710 | Ga0207712_100857101 | 500 |
| 241 | 3300026023 | Ga0207677_10028264 | Ga0207677_100282643 | 500 |
| 242 | 3300026023 | Ga0207677_10065216 | Ga0207677_100652163 | 500 |
| 243 | 3300026035 | Ga0207703_10014111 | Ga0207703_100141112 | 500 |
| 244 | 3300026067 | Ga0207678_10019607 | Ga0207678_100196073 | 500 |
| 245 | 3300026088 | Ga0207641_10007205 | Ga0207641_100072052 | 500 |
| 246 | 3300026088 | Ga0207641_10065654 | Ga0207641_100656543 | 500 |
| 247 | 3300026089 | Ga0207648_10069019 | Ga0207648_100690192 | 500 |
| 248 | 3300026089 | Ga0207648_10111825 | Ga0207648_101118252 | 500 |
| 249 | 3300026116 | Ga0207674_10005455 | Ga0207674_100054555 | 500 |
| 250 | 3300026116 | Ga0207674_10016092 | Ga0207674_100160921 | 500 |
| 251 | 3300026118 | Ga0207675_100019396 | Ga0207675_1000193963 | 500 |
| 252 | 3300026121 | Ga0207683_10067950 | Ga0207683_100679504 | 500 |
| 253 | 3300026142 | Ga0207698_10094196 | Ga0207698_100941963 | 500 |
| 254 | 3300031251 | Ga0265327_10000385 | Ga0265327_1000038563 | 500 |
| 255 | 3300031507 | Ga0307509_10023686 | Ga0307509_100236863 | 500 |
| 256 | 3300031507 | Ga0307509_10036873 | Ga0307509_100368733 | 500 |
| 257 | 3300031548 | Ga0307408_100083874 | Ga0307408_1000838742 | 500 |
| 258 | 3300031616 | Ga0307508_10000354 | Ga0307508_1000035436 | 500 |
| 259 | 3300036401 | Ga0373937_0098493 | Ga0373937_0098493_1027_2547 | 500 |
| 260 | 3300037471 | Ga0395905_0010691 | Ga0395905_0010691_7074_8588 | 500 |
| 261 | 3300047320 | Ga0495672_0046713 | Ga0495672_0046713_235_1740 | 500 |
| 262 | 3300048913 | Ga0496110_0147378 | Ga0496110_0147378_562_2076 | 500 |
| 263 | 3300049569 | Ga0501032_0000933 | Ga0501032_0000933_11223_12728 | 500 |
| 264 | 3300049572 | Ga0501036_0015551 | Ga0501036_0015551_1495_3000 | 500 |
| 265 | 3300049575 | Ga0501039_0055675 | Ga0501039_0055675_218_1723 | 500 |
| 266 | 3300049579 | Ga0501043_0022801 | Ga0501043_0022801_3069_4574 | 500 |
| 267 | 3300049580 | Ga0501046_0006430 | Ga0501046_0006430_8261_9766 | 500 |
| 268 | 3300049581 | Ga0501047_0042058 | Ga0501047_0042058_2076_3581 | 500 |
| 269 | 3300049582 | Ga0501048_0006411 | Ga0501048_0006411_5409_6914 | 500 |
| 270 | 3300049589 | Ga0501073_0097618 | Ga0501073_0097618_373_1878 | 500 |
| 271 | 3300049590 | Ga0501074_0000668 | Ga0501074_0000668_634_2139 | 500 |
| 272 | 3300049822 | Ga0501035_0011988 | Ga0501035_0011988_3968_5473 | 500 |
| 273 | 3300049823 | Ga0501044_0026200 | Ga0501044_0026200_483_1988 | 500 |
| 274 | 3300050509 | nmdc:mga0qj67_3636_c1 | nmdc:mga0qj67_3636_c1_6188_7702 | 500 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o1p-assembly1.cif.gz_A-2 | crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase. | 0.8901 | 2 | 500 |
| 5l78-assembly1.cif.gz_A | crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in nad+ bound form) | 0.8898 | 2 | 500 |
| 5l78-assembly1.cif.gz_A | crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in nad+ bound form) | 0.8858 | 2 | 500 |
| 5l78-assembly1.cif.gz_B | crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in nad+ bound form) | 0.8857 | 2 | 500 |
| 5o1p-assembly1.cif.gz_A-2 | crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase. | 0.8824 | 2 | 500 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PKJ4_3_122_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9496 | 2 | 126 | 3.40.50.720 |
| af_A0A1D8PKJ4_3_122_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.942 | 2 | 126 | 3.40.50.720 |
| af_A0A0P0VQF9_62_202_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.929 | 2 | 131 | 3.40.50.720 |
| 1e5lB02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9285 | 127 | 441 | 3.30.360.10 |
| af_Q54NG9_2_127_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9025 | 2 | 127 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5ZT01-F1-model_v4 | Saccharopine dehydrogenase | 0.9848 | 1 | 113 |
GO:0004753
GO:0005737 GO:0019878 |
| AF-A0A090Q8W3-F1-model_v4 | deleted | 0.9835 | 406 | 500 |
|
| AF-A0A662A8G3-F1-model_v4 | Saccharopine dehydrogenase | 0.9814 | 1 | 136 |
GO:0004753
GO:0005737 GO:0019878 |
| AF-A0A7Y2C2Q8-F1-model_v4 | Saccharopine dehydrogenase | 0.9797 | 1 | 131 |
GO:0004753
GO:0005737 GO:0019878 |
| AF-A0A4Q3S4V4-F1-model_v4 | Saccharopine dehydrogenase | 0.9777 | 1 | 284 |
GO:0004753
GO:0005737 GO:0019878 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar