F379618

General Info

Members Datasets Scaffolds Average Seq Length
274 168 273 219

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10000752|Ga0081538_100007527
Length 247
Sequence MGIALLPPPGSVPCAPAHTRPRNPPSSLLRVASTRVKICGVSDPADARRVAELGAWALGMIFWPDSPRACALEDGEVIGAELHRRLELVGVFVNAPLDEVAATADLCRLSMLQLHGDEGPAYCQEAARRTGAKVMKAARVRNAAQVHDLERFRTDFHLLDAYSPRSPGGTGESFDWELARLHPRRPPVVLSGGLTPDNVGAAIAAARPFAVDVASGTEAEPGRKDPAKMTAFVRAVAAADERLGAVA

Samples

Sample ID Description Type Environment
1 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
115 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
128 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.47
Rhizosphere 93.8
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10003952 3300003373 Bacteria 3588
2 JGI25407J50210_10008204 3300003373 Bacteria 2632
3 JGI25407J50210_10010002 3300003373 Bacteria 2409
4 JGI25407J50210_10034408 3300003373 Bacteria 1306
5 Ga0070658_10249076 3300005327 Bacteria 1507
6 Ga0070690_100043015 3300005330 Bacteria 2863
7 Ga0068869_100051114 3300005334 Bacteria 2998
8 Ga0070682_100206101 3300005337 Bacteria 1390
9 Ga0070660_100336499 3300005339 Bacteria 1242
10 Ga0070691_10181942 3300005341 Bacteria 1095
11 Ga0070661_100242336 3300005344 Bacteria 1389
12 Ga0070668_100041585 3300005347 Bacteria 3522
13 Ga0070669_100100446 3300005353 Bacteria 2182
14 Ga0070675_100380734 3300005354 Bacteria 1256
15 Ga0070659_100040753 3300005366 Bacteria 3629
16 Ga0070710_10091960 3300005437 Bacteria 1791
17 Ga0070700_100179875 3300005441 Bacteria 1471
18 Ga0070678_100131994 3300005456 Bacteria 1986
19 Ga0070662_100000228 3300005457 Bacteria 33120
20 Ga0070662_100533840 3300005457 Bacteria 981
21 Ga0068867_100144196 3300005459 Bacteria 1864
22 Ga0068867_100803275 3300005459 Bacteria 839
23 Ga0070685_10045195 3300005466 Bacteria 2524
24 Ga0070684_100026148 3300005535 Bacteria 4914
25 Ga0070684_100518232 3300005535 Bacteria 1105
26 Ga0068853_100676035 3300005539 Bacteria 984
27 Ga0070686_100083332 3300005544 Bacteria 2122
28 Ga0070695_100239038 3300005545 Bacteria 1317
29 Ga0070696_100055471 3300005546 Bacteria 2763
30 Ga0070693_100193946 3300005547 Bacteria 1315
31 Ga0070664_100220817 3300005564 Bacteria 1695
32 Ga0068857_100153033 3300005577 Bacteria 2090
33 Ga0070702_100204658 3300005615 Bacteria 1309
34 Ga0070702_100244525 3300005615 Bacteria 1213
35 Ga0068852_100586863 3300005616 Bacteria 1118
36 Ga0068864_100191224 3300005618 Bacteria 1876
37 Ga0068864_100341633 3300005618 Bacteria 1411
38 Ga0068866_10277933 3300005718 Unclassified 1036
39 Ga0068866_10477817 3300005718 Bacteria 820
40 Ga0068861_100027333 3300005719 Bacteria 4153
41 Ga0068861_100492919 3300005719 Bacteria 1106
42 Ga0068870_10084428 3300005840 Bacteria 1763
43 Ga0081455_10141763 3300005937 Bacteria 1866
44 Ga0081455_10215557 3300005937 Bacteria 1427
45 Ga0081455_10325458 3300005937 Unclassified 1093
46 Ga0081538_10000024 3300005981 Bacteria 130974
47 Ga0081538_10000228 3300005981 Bacteria 63185
48 Ga0081538_10000360 3300005981 Bacteria 51870
49 Ga0081538_10000752 3300005981 Bacteria 35370
50 Ga0081538_10000910 3300005981 Bacteria 31938
51 Ga0081538_10004604 3300005981 Bacteria 12669
52 Ga0081538_10004702 3300005981 Bacteria 12501
53 Ga0081538_10007448 3300005981 Bacteria 9469
54 Ga0081538_10011687 3300005981 Bacteria 7096
55 Ga0081538_10028306 3300005981 Bacteria 3857
56 Ga0081538_10034670 3300005981 Bacteria 3331
57 Ga0081538_10054702 3300005981 Bacteria 2357
58 Ga0081538_10065793 3300005981 Bacteria 2038
59 Ga0081538_10107608 3300005981 Bacteria 1380
60 Ga0081538_10138781 3300005981 Bacteria 1126
61 Ga0081538_10157860 3300005981 Unclassified 1014
62 Ga0081540_1086144 3300005983 Bacteria 1396
63 Ga0075432_10004464 3300006058 Bacteria 4772
64 Ga0070715_10051302 3300006163 Bacteria 1775
65 Ga0097621_100230516 3300006237 Bacteria 1617
66 Ga0068871_100480184 3300006358 Bacteria 1118
67 Ga0075428_100070743 3300006844 Bacteria 3814
68 Ga0075428_100141536 3300006844 Bacteria 2615
69 Ga0075428_100190983 3300006844 Bacteria 2215
70 Ga0075428_100565722 3300006844 Bacteria 1215
71 Ga0075430_100000245 3300006846 Bacteria 37686
72 Ga0075430_100003035 3300006846 Bacteria 14041
73 Ga0075430_100607255 3300006846 Bacteria 903
74 Ga0075431_100009559 3300006847 Bacteria 9739
75 Ga0075431_100079389 3300006847 Bacteria 3387
76 Ga0075431_100129732 3300006847 Bacteria 2601
77 Ga0075431_100279975 3300006847 Bacteria 1689
78 Ga0075431_100334491 3300006847 Bacteria 1525
79 Ga0075431_100385826 3300006847 Bacteria 1404
80 Ga0075434_100287292 3300006871 Bacteria 1665
81 Ga0075429_100002283 3300006880 Bacteria 16086
82 Ga0075429_100234666 3300006880 Bacteria 1607
83 Ga0075429_100412647 3300006880 Unclassified 1183
84 Ga0068865_100337558 3300006881 Unclassified 1217
85 Ga0111539_10050228 3300009094 Bacteria 4968
86 Ga0111539_10145262 3300009094 Bacteria 2777
87 Ga0111539_10517300 3300009094 Bacteria 1390
88 Ga0111539_10644440 3300009094 Unclassified 1234
89 Ga0111539_10878499 3300009094 Bacteria 1043
90 Ga0105245_10003111 3300009098 Bacteria 14844
91 Ga0105245_11054701 3300009098 Bacteria 858
92 Ga0105247_10043281 3300009101 Bacteria 2758
93 Ga0114129_10002844 3300009147 Bacteria 24191
94 Ga0114129_10013759 3300009147 Bacteria 11532
95 Ga0114129_10665714 3300009147 Bacteria 1342
96 Ga0114129_10725247 3300009147 Bacteria 1275
97 Ga0114129_10874433 3300009147 Bacteria 1141
98 Ga0114129_11454368 3300009147 Bacteria 844
99 Ga0105241_10090538 3300009174 Bacteria 2413
100 Ga0105242_10248957 3300009176 Bacteria 1600
101 Ga0105248_10445835 3300009177 Bacteria 1458
102 Ga0105238_10264423 3300009551 Bacteria 1700
103 Ga0105238_10396373 3300009551 Bacteria 1373
104 Ga0105249_10008979 3300009553 Bacteria 8732
105 Ga0105239_10020000 3300010375 Bacteria 7388
106 Ga0105239_10517720 3300010375 Bacteria 1357
107 Ga0163162_10381020 3300013306 Bacteria 1544
108 Ga0163163_10230661 3300014325 Bacteria 1900
109 Ga0163163_10594233 3300014325 Bacteria 1170
110 Ga0157380_10114673 3300014326 Bacteria 2271
111 Ga0157377_10141841 3300014745 Bacteria 1477
112 Ga0157379_10131330 3300014968 Bacteria 2254
113 Ga0157376_10271904 3300014969 Bacteria 1592
114 Ga0163161_10133323 3300017792 Bacteria 1876
115 Ga0213875_10221445 3300021388 Bacteria 891
116 Ga0207642_10340724 3300025899 Bacteria 881
117 Ga0207688_10017322 3300025901 Bacteria 3915
118 Ga0207688_10053764 3300025901 Bacteria 2258
119 Ga0207688_10424247 3300025901 Bacteria 827
120 Ga0207645_10138715 3300025907 Bacteria 1584
121 Ga0207643_10059708 3300025908 Bacteria 2176
122 Ga0207693_10266149 3300025915 Bacteria 1343
123 Ga0207663_10151689 3300025916 Bacteria 1626
124 Ga0207662_10003675 3300025918 Bacteria 7946
125 Ga0207657_10021351 3300025919 Bacteria 6097
126 Ga0207652_10316394 3300025921 Bacteria 1409
127 Ga0207681_10278231 3300025923 Bacteria 1317
128 Ga0207694_10448631 3300025924 Bacteria 1077
129 Ga0207659_10295098 3300025926 Bacteria 1329
130 Ga0207687_10062742 3300025927 Bacteria 2629
131 Ga0207687_10110380 3300025927 Bacteria 2040
132 Ga0207690_10158831 3300025932 Bacteria 1683
133 Ga0207706_10001194 3300025933 Bacteria 26218
134 Ga0207709_10081850 3300025935 Bacteria 2083
135 Ga0207669_10058166 3300025937 Bacteria 2358
136 Ga0207704_10071013 3300025938 Bacteria 2208
137 Ga0207665_10084193 3300025939 Bacteria 2194
138 Ga0207691_10118035 3300025940 Bacteria 2354
139 Ga0207679_10364369 3300025945 Bacteria 1263
140 Ga0207712_10011336 3300025961 Bacteria 5678
141 Ga0207712_10242674 3300025961 Bacteria 1452
142 Ga0207668_10252316 3300025972 Bacteria 1433
143 Ga0207640_10101673 3300025981 Bacteria 2017
144 Ga0207658_10249772 3300025986 Bacteria 1507
145 Ga0207639_10329772 3300026041 Bacteria 1357
146 Ga0207678_10157999 3300026067 Bacteria 1936
147 Ga0207708_10048416 3300026075 Bacteria 3236
148 Ga0207708_10148213 3300026075 Bacteria 1845
149 Ga0207708_10315222 3300026075 Bacteria 1275
150 Ga0207702_10229766 3300026078 Bacteria 1733
151 Ga0207641_10411337 3300026088 Bacteria 1301
152 Ga0207676_10179822 3300026095 Bacteria 1851
153 Ga0207675_100015096 3300026118 Bacteria 7207
154 Ga0207675_100199379 3300026118 Bacteria 1922
155 Ga0207675_100514693 3300026118 Bacteria 1192
156 Ga0207683_10075801 3300026121 Bacteria 2978
157 Ga0207683_10793518 3300026121 Bacteria 879
158 Ga0207428_10018527 3300027907 Bacteria 5944
159 Ga0207428_10022110 3300027907 Bacteria 5370
160 Ga0207428_10130074 3300027907 Bacteria 1927
161 Ga0268264_10354156 3300028381 Bacteria 1398
162 Ga0265316_10166317 3300031344 Bacteria 1647
163 Ga0307408_100426616 3300031548 Bacteria 1145
164 Ga0316579_10157532 3300031691 Bacteria 1097
165 Ga0316578_10035644 3300031728 Bacteria 2861
166 Ga0307405_10036864 3300031731 Bacteria 2934
167 Ga0307405_10113226 3300031731 Bacteria 1842
168 Ga0307405_10517202 3300031731 Bacteria 960
169 Ga0316577_10046869 3300031733 Bacteria 2413
170 Ga0307413_10064057 3300031824 Bacteria 2282
171 Ga0307410_10010418 3300031852 Bacteria 5263
172 Ga0307406_10043696 3300031901 Bacteria 2804
173 Ga0307406_10129846 3300031901 Bacteria 1767
174 Ga0307406_10294756 3300031901 Bacteria 1243
175 Ga0307406_10572196 3300031901 Bacteria 927
176 Ga0307407_10058249 3300031903 Bacteria 2245
177 Ga0307407_10113978 3300031903 Bacteria 1702
178 Ga0307409_100014869 3300031995 Bacteria 5082
179 Ga0307409_100027847 3300031995 Bacteria 4013
180 Ga0307409_100231243 3300031995 Bacteria 1676
181 Ga0307416_100019908 3300032002 Bacteria 4771
182 Ga0307416_100051676 3300032002 Bacteria 3285
183 Ga0307416_100053586 3300032002 Bacteria 3237
184 Ga0307416_100294224 3300032002 Bacteria 1609
185 Ga0307416_100403444 3300032002 Bacteria 1405
186 Ga0307416_101281445 3300032002 Bacteria 839
187 Ga0307411_10017274 3300032005 Bacteria 4106
188 Ga0307411_10020394 3300032005 Bacteria 3854
189 Ga0307415_100011377 3300032126 Bacteria 5089
190 Ga0307415_100016081 3300032126 Bacteria 4448
191 Ga0307415_100443764 3300032126 Bacteria 1120
192 Ga0307415_101031878 3300032126 Unclassified 766
193 Ga0373930_0008608 3300034816 Bacteria 1788
194 Ga0373958_0024488 3300034819 Bacteria 1143
195 Ga0373941_0050081 3300035115 Bacteria 1325
196 Ga0373960_0005971 3300035121 Bacteria 2839
197 Ga0373943_0045966 3300035170 Bacteria 2129
198 Ga0373935_0419944 3300035692 Bacteria 963
199 Ga0373947_0350741 3300035725 Bacteria 990
200 Ga0316584_0124036 3300036712 Bacteria 1929
201 Ga0373925_0039617 3300037068 Bacteria 3486
202 Ga0395900_0063408 3300037418 Bacteria 3799
203 Ga0316581_0045915 3300037588 Bacteria 1335
204 Ga0436364_0371372 3300037853 Bacteria 821
205 Ga0436362_0275857 3300039453 Bacteria 2888
206 Ga0439463_008576 3300042016 Bacteria 2518
207 Ga0439460_0066748 3300042461 Bacteria 1107
208 Ga0466961_0093451 3300044693 Bacteria 1898
209 Ga0466964_0068849 3300044706 Bacteria 1491
210 Ga0453684_0020986 3300044712 Bacteria 9795
211 Ga0466957_0413296 3300044842 Bacteria 924
212 Ga0466967_0049652 3300045976 Bacteria 3670
213 Ga0466967_0371953 3300045976 Bacteria 1386
214 Ga0495596_0064309 3300046500 Bacteria 1427
215 Ga0495631_0141741 3300046518 Bacteria 1032
216 Ga0495656_0197932 3300046615 Unclassified 996
217 Ga0495676_0270851 3300047321 Bacteria 1152
218 Ga0496100_0019343 3300048903 Bacteria 4061
219 Ga0496100_0084354 3300048903 Bacteria 2153
220 Ga0496101_0242622 3300048904 Bacteria 1402
221 Ga0496102_0650226 3300048905 Bacteria 977
222 Ga0496104_0009750 3300048907 Bacteria 8562
223 Ga0496104_0391725 3300048907 Bacteria 1301
224 Ga0496105_0042101 3300048908 Bacteria 3765
225 Ga0496105_0298448 3300048908 Bacteria 1295
226 Ga0496108_0604442 3300048911 Bacteria 955
227 Ga0496109_0001323 3300048912 Bacteria 20434
228 Ga0496109_0069720 3300048912 Bacteria 3225
229 Ga0496112_0442615 3300048915 Bacteria 1237
230 Ga0496112_0889645 3300048915 Bacteria 813
231 Ga0496113_0081019 3300048916 Bacteria 2487
232 Ga0496115_0097850 3300048918 Bacteria 2403
233 Ga0501036_0450438 3300049572 Bacteria 1072
234 Ga0501040_0165302 3300049576 Bacteria 1565
235 Ga0501042_0183129 3300049578 Bacteria 1511
236 Ga0501042_0517908 3300049578 Bacteria 866
237 Ga0501048_0036906 3300049582 Bacteria 3511
238 Ga0501048_0338682 3300049582 Bacteria 1072
239 Ga0501067_0284311 3300049583 Archaea 921
240 Ga0501067_0326862 3300049583 Bacteria 854
241 Ga0501071_0276223 3300049587 Bacteria 1271
242 Ga0501072_0082417 3300049588 Bacteria 2550
243 Ga0501072_0118842 3300049588 Bacteria 2106
244 Ga0501075_0097495 3300049591 Bacteria 2231
245 Ga0501076_0273644 3300049592 Bacteria 1383
246 Ga0501079_0049483 3300049741 Bacteria 3244
247 Ga0501081_0061642 3300049743 Bacteria 2601
248 Ga0501081_0112524 3300049743 Bacteria 1932
249 Ga0501045_0027965 3300049824 Bacteria 4067
250 nmdc:mga05p37_162238_c1 3300050507 Bacteria 2729
251 nmdc:mga05p37_1877_c2 3300050507 Bacteria 21709
252 nmdc:mga05p37_53904_c1 3300050507 Bacteria 4947
253 nmdc:mga05p37_745193_c1 3300050507 Bacteria 1081
254 nmdc:mga09592_343529_c1 3300050508 Bacteria 1292
255 nmdc:mga09592_501_c1 3300050508 Bacteria 29569
256 nmdc:mga09592_610349_c1 3300050508 Bacteria 934
257 nmdc:mga0qj67_235256_c1 3300050509 Bacteria 1486
258 nmdc:mga0qj67_29055_c1 3300050509 Bacteria 4293
259 nmdc:mga0qj67_7333_c1 3300050509 Bacteria 8151
260 nmdc:mga06r32_105341_c1 3300050510 Bacteria 2770
261 nmdc:mga06r32_285373_c1 3300050510 Bacteria 1637
262 nmdc:mga06r32_340023_c1 3300050510 Bacteria 1486
263 nmdc:mga06r32_41285_c1 3300050510 Bacteria 4382
264 nmdc:mga06r32_94274_c1 3300050510 Bacteria 2929
265 nmdc:mga08y16_314978_c1 3300050511 Bacteria 1611
266 nmdc:mga08y16_498486_c1 3300050511 Bacteria 1237
267 nmdc:mga0a205_431909_c1 3300050515 Bacteria 1178
268 Ga0501084_0200259 3300054114 Bacteria 1685
269 Ga0501084_0287177 3300054114 Bacteria 1389
270 Ga0501082_0039415 3300060353 Bacteria 4075
271 Ga0501082_0446985 3300060353 Bacteria 1129
272 Ga0530510_0011926 3300061734 Bacteria 6097
273 Ga0530510_0120832 3300061734 Bacteria 1923

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_498486_c1 nmdc:mga08y16_498486_c1_40_663 180
2 3300006844 Ga0075428_100190983 Ga0075428_1001909833 183
3 3300006847 Ga0075431_100279975 Ga0075431_1002799752 183
4 3300050510 nmdc:mga06r32_41285_c1 nmdc:mga06r32_41285_c1_2393_2968 183
5 3300005719 Ga0068861_100492919 Ga0068861_1004929192 196
6 3300009147 Ga0114129_10874433 Ga0114129_108744332 196
7 3300026118 Ga0207675_100199379 Ga0207675_1001993792 196
8 3300026118 Ga0207675_100514693 Ga0207675_1005146932 196
9 3300044693 Ga0466961_0093451 Ga0466961_0093451_223_891 196
10 3300050507 nmdc:mga05p37_53904_c1 nmdc:mga05p37_53904_c1_102_719 196
11 3300006880 Ga0075429_100002283 Ga0075429_10000228318 197
12 3300009147 Ga0114129_10002844 Ga0114129_100028442 197
13 3300031548 Ga0307408_100426616 Ga0307408_1004266162 197
14 3300031691 Ga0316579_10157532 Ga0316579_101575322 197
15 3300031728 Ga0316578_10035644 Ga0316578_100356443 197
16 3300031731 Ga0307405_10113226 Ga0307405_101132262 197
17 3300031733 Ga0316577_10046869 Ga0316577_100468692 197
18 3300031824 Ga0307413_10064057 Ga0307413_100640572 197
19 3300031852 Ga0307410_10010418 Ga0307410_100104185 197
20 3300031903 Ga0307407_10113978 Ga0307407_101139782 197
21 3300031995 Ga0307409_100014869 Ga0307409_1000148693 197
22 3300032002 Ga0307416_100019908 Ga0307416_1000199083 197
23 3300032005 Ga0307411_10017274 Ga0307411_100172743 197
24 3300032126 Ga0307415_100016081 Ga0307415_1000160816 197
25 3300036712 Ga0316584_0124036 Ga0316584_0124036_695_1309 197
26 3300037588 Ga0316581_0045915 Ga0316581_0045915_644_1258 197
27 3300050507 nmdc:mga05p37_1877_c2 nmdc:mga05p37_1877_c2_6330_6950 197
28 3300050508 nmdc:mga09592_501_c1 nmdc:mga09592_501_c1_18055_18675 197
29 iso_pu_bacteria 2929297113 2929298883 197
30 3300009094 Ga0111539_10050228 Ga0111539_100502283 198
31 3300014326 Ga0157380_10114673 Ga0157380_101146732 198
32 3300025901 Ga0207688_10424247 Ga0207688_104242472 198
33 3300025937 Ga0207669_10058166 Ga0207669_100581663 198
34 3300027907 Ga0207428_10022110 Ga0207428_100221103 198
35 3300044706 Ga0466964_0068849 Ga0466964_0068849_614_1285 198
36 3300045976 Ga0466967_0371953 Ga0466967_0371953_441_1112 198
37 3300048915 Ga0496112_0889645 Ga0496112_0889645_138_767 199
38 3300003373 JGI25407J50210_10010002 JGI25407J50210_100100023 201
39 3300005327 Ga0070658_10249076 Ga0070658_102490762 201
40 3300005981 Ga0081538_10000024 Ga0081538_1000002434 201
41 3300025916 Ga0207663_10151689 Ga0207663_101516892 201
42 3300025921 Ga0207652_10316394 Ga0207652_103163942 201
43 3300035170 Ga0373943_0045966 Ga0373943_0045966_90_722 201
44 3300035692 Ga0373935_0419944 Ga0373935_0419944_104_736 201
45 3300037068 Ga0373925_0039617 Ga0373925_0039617_827_1459 201
46 3300005437 Ga0070710_10091960 Ga0070710_100919602 202
47 3300005937 Ga0081455_10141763 Ga0081455_101417632 202
48 3300006163 Ga0070715_10051302 Ga0070715_100513022 202
49 3300009147 Ga0114129_11454368 Ga0114129_114543682 202
50 3300025915 Ga0207693_10266149 Ga0207693_102661492 202
51 3300025939 Ga0207665_10084193 Ga0207665_100841932 202
52 3300031344 Ga0265316_10166317 Ga0265316_101663172 202
53 3300044712 Ga0453684_0020986 Ga0453684_0020986_7003_7641 202
54 3300010375 Ga0105239_10517720 Ga0105239_105177202 204
55 3300050509 nmdc:mga0qj67_235256_c1 nmdc:mga0qj67_235256_c1_780_1418 204
56 3300005459 Ga0068867_100803275 Ga0068867_1008032751 205
57 3300006881 Ga0068865_100337558 Ga0068865_1003375582 205
58 3300009176 Ga0105242_10248957 Ga0105242_102489572 205
59 3300026121 Ga0207683_10793518 Ga0207683_107935182 205
60 3300032002 Ga0307416_100051676 Ga0307416_1000516762 205
61 3300032002 Ga0307416_101281445 Ga0307416_1012814452 205
62 3300032126 Ga0307415_101031878 Ga0307415_1010318781 205
63 3300049583 Ga0501067_0326862 Ga0501067_0326862_17_679 205
64 3300005330 Ga0070690_100043015 Ga0070690_1000430152 206
65 3300005334 Ga0068869_100051114 Ga0068869_1000511143 206
66 3300005337 Ga0070682_100206101 Ga0070682_1002061012 206
67 3300005339 Ga0070660_100336499 Ga0070660_1003364992 206
68 3300005341 Ga0070691_10181942 Ga0070691_101819422 206
69 3300005344 Ga0070661_100242336 Ga0070661_1002423362 206
70 3300005353 Ga0070669_100100446 Ga0070669_1001004462 206
71 3300005354 Ga0070675_100380734 Ga0070675_1003807342 206
72 3300005366 Ga0070659_100040753 Ga0070659_1000407534 206
73 3300005456 Ga0070678_100131994 Ga0070678_1001319942 206
74 3300005457 Ga0070662_100533840 Ga0070662_1005338402 206
75 3300005459 Ga0068867_100144196 Ga0068867_1001441961 206
76 3300005466 Ga0070685_10045195 Ga0070685_100451953 206
77 3300005535 Ga0070684_100026148 Ga0070684_1000261486 206
78 3300005539 Ga0068853_100676035 Ga0068853_1006760351 206
79 3300005544 Ga0070686_100083332 Ga0070686_1000833322 206
80 3300005545 Ga0070695_100239038 Ga0070695_1002390381 206
81 3300005547 Ga0070693_100193946 Ga0070693_1001939462 206
82 3300005564 Ga0070664_100220817 Ga0070664_1002208172 206
83 3300005577 Ga0068857_100153033 Ga0068857_1001530332 206
84 3300005615 Ga0070702_100204658 Ga0070702_1002046581 206
85 3300005616 Ga0068852_100586863 Ga0068852_1005868631 206
86 3300005618 Ga0068864_100191224 Ga0068864_1001912242 206
87 3300005618 Ga0068864_100341633 Ga0068864_1003416332 206
88 3300005718 Ga0068866_10277933 Ga0068866_102779332 206
89 3300005840 Ga0068870_10084428 Ga0068870_100844282 206
90 3300005937 Ga0081455_10215557 Ga0081455_102155571 206
91 3300006058 Ga0075432_10004464 Ga0075432_100044642 206
92 3300006237 Ga0097621_100230516 Ga0097621_1002305162 206
93 3300006358 Ga0068871_100480184 Ga0068871_1004801842 206
94 3300006847 Ga0075431_100385826 Ga0075431_1003858262 206
95 3300006871 Ga0075434_100287292 Ga0075434_1002872922 206
96 3300009094 Ga0111539_10145262 Ga0111539_101452622 206
97 3300009094 Ga0111539_10517300 Ga0111539_105173002 206
98 3300009098 Ga0105245_11054701 Ga0105245_110547012 206
99 3300009101 Ga0105247_10043281 Ga0105247_100432811 206
100 3300009174 Ga0105241_10090538 Ga0105241_100905383 206
101 3300009177 Ga0105248_10445835 Ga0105248_104458352 206
102 3300009551 Ga0105238_10264423 Ga0105238_102644232 206
103 3300013306 Ga0163162_10381020 Ga0163162_103810202 206
104 3300014325 Ga0163163_10230661 Ga0163163_102306612 206
105 3300014325 Ga0163163_10594233 Ga0163163_105942332 206
106 3300014745 Ga0157377_10141841 Ga0157377_101418412 206
107 3300014968 Ga0157379_10131330 Ga0157379_101313302 206
108 3300014969 Ga0157376_10271904 Ga0157376_102719042 206
109 3300025901 Ga0207688_10017322 Ga0207688_100173223 206
110 3300025907 Ga0207645_10138715 Ga0207645_101387152 206
111 3300025908 Ga0207643_10059708 Ga0207643_100597083 206
112 3300025918 Ga0207662_10003675 Ga0207662_100036752 206
113 3300025919 Ga0207657_10021351 Ga0207657_100213516 206
114 3300025923 Ga0207681_10278231 Ga0207681_102782312 206
115 3300025926 Ga0207659_10295098 Ga0207659_102950982 206
116 3300025927 Ga0207687_10110380 Ga0207687_101103802 206
117 3300025932 Ga0207690_10158831 Ga0207690_101588312 206
118 3300025935 Ga0207709_10081850 Ga0207709_100818502 206
119 3300025938 Ga0207704_10071013 Ga0207704_100710132 206
120 3300025940 Ga0207691_10118035 Ga0207691_101180352 206
121 3300025945 Ga0207679_10364369 Ga0207679_103643692 206
122 3300025961 Ga0207712_10242674 Ga0207712_102426742 206
123 3300025981 Ga0207640_10101673 Ga0207640_101016732 206
124 3300025986 Ga0207658_10249772 Ga0207658_102497722 206
125 3300026041 Ga0207639_10329772 Ga0207639_103297722 206
126 3300026067 Ga0207678_10157999 Ga0207678_101579992 206
127 3300026075 Ga0207708_10148213 Ga0207708_101482132 206
128 3300026075 Ga0207708_10315222 Ga0207708_103152222 206
129 3300026088 Ga0207641_10411337 Ga0207641_104113372 206
130 3300026095 Ga0207676_10179822 Ga0207676_101798222 206
131 3300026121 Ga0207683_10075801 Ga0207683_100758013 206
132 3300027907 Ga0207428_10018527 Ga0207428_100185272 206
133 3300027907 Ga0207428_10130074 Ga0207428_101300742 206
134 3300028381 Ga0268264_10354156 Ga0268264_103541562 206
135 3300031731 Ga0307405_10036864 Ga0307405_100368643 206
136 3300031901 Ga0307406_10043696 Ga0307406_100436962 206
137 3300031901 Ga0307406_10129846 Ga0307406_101298462 206
138 3300031901 Ga0307406_10572196 Ga0307406_105721962 206
139 3300031995 Ga0307409_100027847 Ga0307409_1000278471 206
140 3300031995 Ga0307409_100231243 Ga0307409_1002312432 206
141 3300032002 Ga0307416_100294224 Ga0307416_1002942242 206
142 3300032005 Ga0307411_10020394 Ga0307411_100203942 206
143 3300032126 Ga0307415_100011377 Ga0307415_1000113772 206
144 3300032126 Ga0307415_100443764 Ga0307415_1004437642 206
145 3300034816 Ga0373930_0008608 Ga0373930_0008608_253_888 206
146 3300034819 Ga0373958_0024488 Ga0373958_0024488_336_971 206
147 3300035115 Ga0373941_0050081 Ga0373941_0050081_545_1180 206
148 3300035121 Ga0373960_0005971 Ga0373960_0005971_1246_1881 206
149 3300035725 Ga0373947_0350741 Ga0373947_0350741_175_810 206
150 3300037418 Ga0395900_0063408 Ga0395900_0063408_801_1436 206
151 3300045976 Ga0466967_0049652 Ga0466967_0049652_2350_3012 206
152 3300047321 Ga0495676_0270851 Ga0495676_0270851_85_720 206
153 3300048903 Ga0496100_0084354 Ga0496100_0084354_619_1302 206
154 3300048904 Ga0496101_0242622 Ga0496101_0242622_648_1331 206
155 3300048907 Ga0496104_0391725 Ga0496104_0391725_54_737 206
156 3300048908 Ga0496105_0298448 Ga0496105_0298448_429_1112 206
157 3300048912 Ga0496109_0069720 Ga0496109_0069720_480_1145 206
158 3300048915 Ga0496112_0442615 Ga0496112_0442615_32_715 206
159 3300048916 Ga0496113_0081019 Ga0496113_0081019_943_1626 206
160 3300048918 Ga0496115_0097850 Ga0496115_0097850_512_1195 206
161 3300050510 nmdc:mga06r32_285373_c1 nmdc:mga06r32_285373_c1_435_1073 206
162 3300050515 nmdc:mga0a205_431909_c1 nmdc:mga0a205_431909_c1_250_885 206
163 3300003373 JGI25407J50210_10003952 JGI25407J50210_100039524 207
164 3300003373 JGI25407J50210_10008204 JGI25407J50210_100082043 207
165 3300003373 JGI25407J50210_10034408 JGI25407J50210_100344082 207
166 3300005347 Ga0070668_100041585 Ga0070668_1000415853 207
167 3300005441 Ga0070700_100179875 Ga0070700_1001798752 207
168 3300005457 Ga0070662_100000228 Ga0070662_10000022821 207
169 3300005535 Ga0070684_100518232 Ga0070684_1005182322 207
170 3300005546 Ga0070696_100055471 Ga0070696_1000554712 207
171 3300005615 Ga0070702_100244525 Ga0070702_1002445252 207
172 3300005718 Ga0068866_10477817 Ga0068866_104778171 207
173 3300005719 Ga0068861_100027333 Ga0068861_1000273334 207
174 3300005937 Ga0081455_10325458 Ga0081455_103254582 207
175 3300005981 Ga0081538_10000228 Ga0081538_100002282 207
176 3300005981 Ga0081538_10000360 Ga0081538_100003605 207
177 3300005981 Ga0081538_10000752 Ga0081538_100007527 207
178 3300005981 Ga0081538_10000910 Ga0081538_1000091011 207
179 3300005981 Ga0081538_10004604 Ga0081538_100046045 207
180 3300005981 Ga0081538_10004702 Ga0081538_100047023 207
181 3300005981 Ga0081538_10007448 Ga0081538_100074488 207
182 3300005981 Ga0081538_10011687 Ga0081538_100116873 207
183 3300005981 Ga0081538_10028306 Ga0081538_100283065 207
184 3300005981 Ga0081538_10034670 Ga0081538_100346702 207
185 3300005981 Ga0081538_10054702 Ga0081538_100547023 207
186 3300005981 Ga0081538_10065793 Ga0081538_100657932 207
187 3300005981 Ga0081538_10107608 Ga0081538_101076081 207
188 3300005981 Ga0081538_10138781 Ga0081538_101387811 207
189 3300005981 Ga0081538_10157860 Ga0081538_101578602 207
190 3300005983 Ga0081540_1086144 Ga0081540_10861442 207
191 3300006844 Ga0075428_100070743 Ga0075428_1000707432 207
192 3300006844 Ga0075428_100141536 Ga0075428_1001415362 207
193 3300006844 Ga0075428_100565722 Ga0075428_1005657222 207
194 3300006846 Ga0075430_100000245 Ga0075430_10000024520 207
195 3300006846 Ga0075430_100003035 Ga0075430_10000303512 207
196 3300006846 Ga0075430_100607255 Ga0075430_1006072552 207
197 3300006847 Ga0075431_100009559 Ga0075431_1000095594 207
198 3300006847 Ga0075431_100079389 Ga0075431_1000793893 207
199 3300006847 Ga0075431_100129732 Ga0075431_1001297323 207
200 3300006847 Ga0075431_100334491 Ga0075431_1003344912 207
201 3300006880 Ga0075429_100234666 Ga0075429_1002346662 207
202 3300006880 Ga0075429_100412647 Ga0075429_1004126472 207
203 3300009094 Ga0111539_10644440 Ga0111539_106444402 207
204 3300009094 Ga0111539_10878499 Ga0111539_108784992 207
205 3300009098 Ga0105245_10003111 Ga0105245_100031114 207
206 3300009147 Ga0114129_10013759 Ga0114129_100137592 207
207 3300009147 Ga0114129_10665714 Ga0114129_106657142 207
208 3300009147 Ga0114129_10725247 Ga0114129_107252472 207
209 3300009551 Ga0105238_10396373 Ga0105238_103963732 207
210 3300009553 Ga0105249_10008979 Ga0105249_100089798 207
211 3300010375 Ga0105239_10020000 Ga0105239_100200004 207
212 3300017792 Ga0163161_10133323 Ga0163161_101333232 207
213 3300021388 Ga0213875_10221445 Ga0213875_102214451 207
214 3300025899 Ga0207642_10340724 Ga0207642_103407241 207
215 3300025901 Ga0207688_10053764 Ga0207688_100537642 207
216 3300025924 Ga0207694_10448631 Ga0207694_104486311 207
217 3300025927 Ga0207687_10062742 Ga0207687_100627422 207
218 3300025933 Ga0207706_10001194 Ga0207706_100011944 207
219 3300025961 Ga0207712_10011336 Ga0207712_100113364 207
220 3300025972 Ga0207668_10252316 Ga0207668_102523162 207
221 3300026075 Ga0207708_10048416 Ga0207708_100484162 207
222 3300026078 Ga0207702_10229766 Ga0207702_102297661 207
223 3300026118 Ga0207675_100015096 Ga0207675_1000150966 207
224 3300031731 Ga0307405_10517202 Ga0307405_105172022 207
225 3300031901 Ga0307406_10294756 Ga0307406_102947562 207
226 3300031903 Ga0307407_10058249 Ga0307407_100582492 207
227 3300032002 Ga0307416_100053586 Ga0307416_1000535862 207
228 3300032002 Ga0307416_100403444 Ga0307416_1004034442 207
229 3300037853 Ga0436364_0371372 Ga0436364_0371372_20_664 207
230 3300039453 Ga0436362_0275857 Ga0436362_0275857_1828_2481 207
231 3300042016 Ga0439463_008576 Ga0439463_008576_1408_2064 207
232 3300042461 Ga0439460_0066748 Ga0439460_0066748_417_1073 207
233 3300044842 Ga0466957_0413296 Ga0466957_0413296_154_819 207
234 3300046500 Ga0495596_0064309 Ga0495596_0064309_267_905 207
235 3300046518 Ga0495631_0141741 Ga0495631_0141741_218_898 207
236 3300046615 Ga0495656_0197932 Ga0495656_0197932_14_655 207
237 3300048903 Ga0496100_0019343 Ga0496100_0019343_113_814 207
238 3300048905 Ga0496102_0650226 Ga0496102_0650226_59_760 207
239 3300048907 Ga0496104_0009750 Ga0496104_0009750_3633_4334 207
240 3300048908 Ga0496105_0042101 Ga0496105_0042101_2990_3691 207
241 3300048911 Ga0496108_0604442 Ga0496108_0604442_241_942 207
242 3300048912 Ga0496109_0001323 Ga0496109_0001323_15999_16700 207
243 3300049572 Ga0501036_0450438 Ga0501036_0450438_240_896 207
244 3300049576 Ga0501040_0165302 Ga0501040_0165302_685_1365 207
245 3300049578 Ga0501042_0183129 Ga0501042_0183129_11_667 207
246 3300049578 Ga0501042_0517908 Ga0501042_0517908_86_766 207
247 3300049582 Ga0501048_0036906 Ga0501048_0036906_1000_1656 207
248 3300049582 Ga0501048_0338682 Ga0501048_0338682_193_831 207
249 3300049583 Ga0501067_0284311 Ga0501067_0284311_98_736 207
250 3300049587 Ga0501071_0276223 Ga0501071_0276223_32_712 207
251 3300049588 Ga0501072_0082417 Ga0501072_0082417_1282_1983 207
252 3300049588 Ga0501072_0118842 Ga0501072_0118842_78_734 207
253 3300049591 Ga0501075_0097495 Ga0501075_0097495_761_1441 207
254 3300049592 Ga0501076_0273644 Ga0501076_0273644_62_742 207
255 3300049741 Ga0501079_0049483 Ga0501079_0049483_1954_2610 207
256 3300049743 Ga0501081_0061642 Ga0501081_0061642_1355_2035 207
257 3300049743 Ga0501081_0112524 Ga0501081_0112524_24_680 207
258 3300049824 Ga0501045_0027965 Ga0501045_0027965_1435_2091 207
259 3300050507 nmdc:mga05p37_162238_c1 nmdc:mga05p37_162238_c1_1386_2024 207
260 3300050507 nmdc:mga05p37_745193_c1 nmdc:mga05p37_745193_c1_120_758 207
261 3300050508 nmdc:mga09592_343529_c1 nmdc:mga09592_343529_c1_343_981 207
262 3300050508 nmdc:mga09592_610349_c1 nmdc:mga09592_610349_c1_221_859 207
263 3300050509 nmdc:mga0qj67_29055_c1 nmdc:mga0qj67_29055_c1_1564_2202 207
264 3300050509 nmdc:mga0qj67_7333_c1 nmdc:mga0qj67_7333_c1_1410_2057 207
265 3300050510 nmdc:mga06r32_105341_c1 nmdc:mga06r32_105341_c1_637_1311 207
266 3300050510 nmdc:mga06r32_340023_c1 nmdc:mga06r32_340023_c1_442_1089 207
267 3300050510 nmdc:mga06r32_94274_c1 nmdc:mga06r32_94274_c1_340_987 207
268 3300050511 nmdc:mga08y16_314978_c1 nmdc:mga08y16_314978_c1_774_1451 207
269 3300054114 Ga0501084_0200259 Ga0501084_0200259_401_1039 207
270 3300054114 Ga0501084_0287177 Ga0501084_0287177_38_718 207
271 3300060353 Ga0501082_0039415 Ga0501082_0039415_1341_1997 207
272 3300060353 Ga0501082_0446985 Ga0501082_0446985_43_681 207
273 3300061734 Ga0530510_0011926 Ga0530510_0011926_162_818 207
274 3300061734 Ga0530510_0120832 Ga0530510_0120832_55_735 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

36

235

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v5x-assembly1.cif.gz_B crystal structure of phosphoribosyl anthranilate isomerase from thermus thermophilus 0.9074 2 201
1v5x-assembly1.cif.gz_B crystal structure of phosphoribosyl anthranilate isomerase from thermus thermophilus 0.8944 2 201
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.889 1 201
1nsj-assembly1.cif.gz_A-2 crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima 0.886 1 201
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.8802 1 201
ID Description Score Start End Superfamily
af_Q8LPI9_65_212_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.914 1 106 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9074 2 201 3.20.20.70
af_P00909_260_447_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9057 7 196 3.20.20.70
af_P00909_260_447_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8966 7 196 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8944 2 201 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A838UYB3-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9794 2 200 GO:0000162
GO:0004640
GO:0006568
AF-A0A7J9YSZ1-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9763 2 202 GO:0000162
GO:0004640
GO:0006568
AF-A0A537YV11-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9762 2 207 GO:0000162
GO:0004640
GO:0006568
AF-A0A7V9HRX4-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9734 2 205 GO:0000162
GO:0004640
GO:0006568
AF-A0A2H6B764-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9699 1 206 GO:0000162
GO:0004640
GO:0006568

Feature Viewer

pLDDT pTM Quality
88.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map