F379618
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 168 | 273 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10000752|Ga0081538_100007527 |
| Length | 247 |
| Sequence | MGIALLPPPGSVPCAPAHTRPRNPPSSLLRVASTRVKICGVSDPADARRVAELGAWALGMIFWPDSPRACALEDGEVIGAELHRRLELVGVFVNAPLDEVAATADLCRLSMLQLHGDEGPAYCQEAARRTGAKVMKAARVRNAAQVHDLERFRTDFHLLDAYSPRSPGGTGESFDWELARLHPRRPPVVLSGGLTPDNVGAAIAAARPFAVDVASGTEAEPGRKDPAKMTAFVRAVAAADERLGAVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 65 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 103 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 104 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 106 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 107 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 108 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 109 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 110 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 111 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 112 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 113 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 114 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 115 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 116 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 117 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 119 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 120 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 121 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 124 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 125 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 126 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 127 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 128 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 129 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 130 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 131 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 132 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 141 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 142 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 143 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 146 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 147 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 148 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0 |
| Isolates | 0.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.47 |
| Rhizosphere | 93.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10003952 | 3300003373 | Bacteria | 3588 |
| 2 | JGI25407J50210_10008204 | 3300003373 | Bacteria | 2632 |
| 3 | JGI25407J50210_10010002 | 3300003373 | Bacteria | 2409 |
| 4 | JGI25407J50210_10034408 | 3300003373 | Bacteria | 1306 |
| 5 | Ga0070658_10249076 | 3300005327 | Bacteria | 1507 |
| 6 | Ga0070690_100043015 | 3300005330 | Bacteria | 2863 |
| 7 | Ga0068869_100051114 | 3300005334 | Bacteria | 2998 |
| 8 | Ga0070682_100206101 | 3300005337 | Bacteria | 1390 |
| 9 | Ga0070660_100336499 | 3300005339 | Bacteria | 1242 |
| 10 | Ga0070691_10181942 | 3300005341 | Bacteria | 1095 |
| 11 | Ga0070661_100242336 | 3300005344 | Bacteria | 1389 |
| 12 | Ga0070668_100041585 | 3300005347 | Bacteria | 3522 |
| 13 | Ga0070669_100100446 | 3300005353 | Bacteria | 2182 |
| 14 | Ga0070675_100380734 | 3300005354 | Bacteria | 1256 |
| 15 | Ga0070659_100040753 | 3300005366 | Bacteria | 3629 |
| 16 | Ga0070710_10091960 | 3300005437 | Bacteria | 1791 |
| 17 | Ga0070700_100179875 | 3300005441 | Bacteria | 1471 |
| 18 | Ga0070678_100131994 | 3300005456 | Bacteria | 1986 |
| 19 | Ga0070662_100000228 | 3300005457 | Bacteria | 33120 |
| 20 | Ga0070662_100533840 | 3300005457 | Bacteria | 981 |
| 21 | Ga0068867_100144196 | 3300005459 | Bacteria | 1864 |
| 22 | Ga0068867_100803275 | 3300005459 | Bacteria | 839 |
| 23 | Ga0070685_10045195 | 3300005466 | Bacteria | 2524 |
| 24 | Ga0070684_100026148 | 3300005535 | Bacteria | 4914 |
| 25 | Ga0070684_100518232 | 3300005535 | Bacteria | 1105 |
| 26 | Ga0068853_100676035 | 3300005539 | Bacteria | 984 |
| 27 | Ga0070686_100083332 | 3300005544 | Bacteria | 2122 |
| 28 | Ga0070695_100239038 | 3300005545 | Bacteria | 1317 |
| 29 | Ga0070696_100055471 | 3300005546 | Bacteria | 2763 |
| 30 | Ga0070693_100193946 | 3300005547 | Bacteria | 1315 |
| 31 | Ga0070664_100220817 | 3300005564 | Bacteria | 1695 |
| 32 | Ga0068857_100153033 | 3300005577 | Bacteria | 2090 |
| 33 | Ga0070702_100204658 | 3300005615 | Bacteria | 1309 |
| 34 | Ga0070702_100244525 | 3300005615 | Bacteria | 1213 |
| 35 | Ga0068852_100586863 | 3300005616 | Bacteria | 1118 |
| 36 | Ga0068864_100191224 | 3300005618 | Bacteria | 1876 |
| 37 | Ga0068864_100341633 | 3300005618 | Bacteria | 1411 |
| 38 | Ga0068866_10277933 | 3300005718 | Unclassified | 1036 |
| 39 | Ga0068866_10477817 | 3300005718 | Bacteria | 820 |
| 40 | Ga0068861_100027333 | 3300005719 | Bacteria | 4153 |
| 41 | Ga0068861_100492919 | 3300005719 | Bacteria | 1106 |
| 42 | Ga0068870_10084428 | 3300005840 | Bacteria | 1763 |
| 43 | Ga0081455_10141763 | 3300005937 | Bacteria | 1866 |
| 44 | Ga0081455_10215557 | 3300005937 | Bacteria | 1427 |
| 45 | Ga0081455_10325458 | 3300005937 | Unclassified | 1093 |
| 46 | Ga0081538_10000024 | 3300005981 | Bacteria | 130974 |
| 47 | Ga0081538_10000228 | 3300005981 | Bacteria | 63185 |
| 48 | Ga0081538_10000360 | 3300005981 | Bacteria | 51870 |
| 49 | Ga0081538_10000752 | 3300005981 | Bacteria | 35370 |
| 50 | Ga0081538_10000910 | 3300005981 | Bacteria | 31938 |
| 51 | Ga0081538_10004604 | 3300005981 | Bacteria | 12669 |
| 52 | Ga0081538_10004702 | 3300005981 | Bacteria | 12501 |
| 53 | Ga0081538_10007448 | 3300005981 | Bacteria | 9469 |
| 54 | Ga0081538_10011687 | 3300005981 | Bacteria | 7096 |
| 55 | Ga0081538_10028306 | 3300005981 | Bacteria | 3857 |
| 56 | Ga0081538_10034670 | 3300005981 | Bacteria | 3331 |
| 57 | Ga0081538_10054702 | 3300005981 | Bacteria | 2357 |
| 58 | Ga0081538_10065793 | 3300005981 | Bacteria | 2038 |
| 59 | Ga0081538_10107608 | 3300005981 | Bacteria | 1380 |
| 60 | Ga0081538_10138781 | 3300005981 | Bacteria | 1126 |
| 61 | Ga0081538_10157860 | 3300005981 | Unclassified | 1014 |
| 62 | Ga0081540_1086144 | 3300005983 | Bacteria | 1396 |
| 63 | Ga0075432_10004464 | 3300006058 | Bacteria | 4772 |
| 64 | Ga0070715_10051302 | 3300006163 | Bacteria | 1775 |
| 65 | Ga0097621_100230516 | 3300006237 | Bacteria | 1617 |
| 66 | Ga0068871_100480184 | 3300006358 | Bacteria | 1118 |
| 67 | Ga0075428_100070743 | 3300006844 | Bacteria | 3814 |
| 68 | Ga0075428_100141536 | 3300006844 | Bacteria | 2615 |
| 69 | Ga0075428_100190983 | 3300006844 | Bacteria | 2215 |
| 70 | Ga0075428_100565722 | 3300006844 | Bacteria | 1215 |
| 71 | Ga0075430_100000245 | 3300006846 | Bacteria | 37686 |
| 72 | Ga0075430_100003035 | 3300006846 | Bacteria | 14041 |
| 73 | Ga0075430_100607255 | 3300006846 | Bacteria | 903 |
| 74 | Ga0075431_100009559 | 3300006847 | Bacteria | 9739 |
| 75 | Ga0075431_100079389 | 3300006847 | Bacteria | 3387 |
| 76 | Ga0075431_100129732 | 3300006847 | Bacteria | 2601 |
| 77 | Ga0075431_100279975 | 3300006847 | Bacteria | 1689 |
| 78 | Ga0075431_100334491 | 3300006847 | Bacteria | 1525 |
| 79 | Ga0075431_100385826 | 3300006847 | Bacteria | 1404 |
| 80 | Ga0075434_100287292 | 3300006871 | Bacteria | 1665 |
| 81 | Ga0075429_100002283 | 3300006880 | Bacteria | 16086 |
| 82 | Ga0075429_100234666 | 3300006880 | Bacteria | 1607 |
| 83 | Ga0075429_100412647 | 3300006880 | Unclassified | 1183 |
| 84 | Ga0068865_100337558 | 3300006881 | Unclassified | 1217 |
| 85 | Ga0111539_10050228 | 3300009094 | Bacteria | 4968 |
| 86 | Ga0111539_10145262 | 3300009094 | Bacteria | 2777 |
| 87 | Ga0111539_10517300 | 3300009094 | Bacteria | 1390 |
| 88 | Ga0111539_10644440 | 3300009094 | Unclassified | 1234 |
| 89 | Ga0111539_10878499 | 3300009094 | Bacteria | 1043 |
| 90 | Ga0105245_10003111 | 3300009098 | Bacteria | 14844 |
| 91 | Ga0105245_11054701 | 3300009098 | Bacteria | 858 |
| 92 | Ga0105247_10043281 | 3300009101 | Bacteria | 2758 |
| 93 | Ga0114129_10002844 | 3300009147 | Bacteria | 24191 |
| 94 | Ga0114129_10013759 | 3300009147 | Bacteria | 11532 |
| 95 | Ga0114129_10665714 | 3300009147 | Bacteria | 1342 |
| 96 | Ga0114129_10725247 | 3300009147 | Bacteria | 1275 |
| 97 | Ga0114129_10874433 | 3300009147 | Bacteria | 1141 |
| 98 | Ga0114129_11454368 | 3300009147 | Bacteria | 844 |
| 99 | Ga0105241_10090538 | 3300009174 | Bacteria | 2413 |
| 100 | Ga0105242_10248957 | 3300009176 | Bacteria | 1600 |
| 101 | Ga0105248_10445835 | 3300009177 | Bacteria | 1458 |
| 102 | Ga0105238_10264423 | 3300009551 | Bacteria | 1700 |
| 103 | Ga0105238_10396373 | 3300009551 | Bacteria | 1373 |
| 104 | Ga0105249_10008979 | 3300009553 | Bacteria | 8732 |
| 105 | Ga0105239_10020000 | 3300010375 | Bacteria | 7388 |
| 106 | Ga0105239_10517720 | 3300010375 | Bacteria | 1357 |
| 107 | Ga0163162_10381020 | 3300013306 | Bacteria | 1544 |
| 108 | Ga0163163_10230661 | 3300014325 | Bacteria | 1900 |
| 109 | Ga0163163_10594233 | 3300014325 | Bacteria | 1170 |
| 110 | Ga0157380_10114673 | 3300014326 | Bacteria | 2271 |
| 111 | Ga0157377_10141841 | 3300014745 | Bacteria | 1477 |
| 112 | Ga0157379_10131330 | 3300014968 | Bacteria | 2254 |
| 113 | Ga0157376_10271904 | 3300014969 | Bacteria | 1592 |
| 114 | Ga0163161_10133323 | 3300017792 | Bacteria | 1876 |
| 115 | Ga0213875_10221445 | 3300021388 | Bacteria | 891 |
| 116 | Ga0207642_10340724 | 3300025899 | Bacteria | 881 |
| 117 | Ga0207688_10017322 | 3300025901 | Bacteria | 3915 |
| 118 | Ga0207688_10053764 | 3300025901 | Bacteria | 2258 |
| 119 | Ga0207688_10424247 | 3300025901 | Bacteria | 827 |
| 120 | Ga0207645_10138715 | 3300025907 | Bacteria | 1584 |
| 121 | Ga0207643_10059708 | 3300025908 | Bacteria | 2176 |
| 122 | Ga0207693_10266149 | 3300025915 | Bacteria | 1343 |
| 123 | Ga0207663_10151689 | 3300025916 | Bacteria | 1626 |
| 124 | Ga0207662_10003675 | 3300025918 | Bacteria | 7946 |
| 125 | Ga0207657_10021351 | 3300025919 | Bacteria | 6097 |
| 126 | Ga0207652_10316394 | 3300025921 | Bacteria | 1409 |
| 127 | Ga0207681_10278231 | 3300025923 | Bacteria | 1317 |
| 128 | Ga0207694_10448631 | 3300025924 | Bacteria | 1077 |
| 129 | Ga0207659_10295098 | 3300025926 | Bacteria | 1329 |
| 130 | Ga0207687_10062742 | 3300025927 | Bacteria | 2629 |
| 131 | Ga0207687_10110380 | 3300025927 | Bacteria | 2040 |
| 132 | Ga0207690_10158831 | 3300025932 | Bacteria | 1683 |
| 133 | Ga0207706_10001194 | 3300025933 | Bacteria | 26218 |
| 134 | Ga0207709_10081850 | 3300025935 | Bacteria | 2083 |
| 135 | Ga0207669_10058166 | 3300025937 | Bacteria | 2358 |
| 136 | Ga0207704_10071013 | 3300025938 | Bacteria | 2208 |
| 137 | Ga0207665_10084193 | 3300025939 | Bacteria | 2194 |
| 138 | Ga0207691_10118035 | 3300025940 | Bacteria | 2354 |
| 139 | Ga0207679_10364369 | 3300025945 | Bacteria | 1263 |
| 140 | Ga0207712_10011336 | 3300025961 | Bacteria | 5678 |
| 141 | Ga0207712_10242674 | 3300025961 | Bacteria | 1452 |
| 142 | Ga0207668_10252316 | 3300025972 | Bacteria | 1433 |
| 143 | Ga0207640_10101673 | 3300025981 | Bacteria | 2017 |
| 144 | Ga0207658_10249772 | 3300025986 | Bacteria | 1507 |
| 145 | Ga0207639_10329772 | 3300026041 | Bacteria | 1357 |
| 146 | Ga0207678_10157999 | 3300026067 | Bacteria | 1936 |
| 147 | Ga0207708_10048416 | 3300026075 | Bacteria | 3236 |
| 148 | Ga0207708_10148213 | 3300026075 | Bacteria | 1845 |
| 149 | Ga0207708_10315222 | 3300026075 | Bacteria | 1275 |
| 150 | Ga0207702_10229766 | 3300026078 | Bacteria | 1733 |
| 151 | Ga0207641_10411337 | 3300026088 | Bacteria | 1301 |
| 152 | Ga0207676_10179822 | 3300026095 | Bacteria | 1851 |
| 153 | Ga0207675_100015096 | 3300026118 | Bacteria | 7207 |
| 154 | Ga0207675_100199379 | 3300026118 | Bacteria | 1922 |
| 155 | Ga0207675_100514693 | 3300026118 | Bacteria | 1192 |
| 156 | Ga0207683_10075801 | 3300026121 | Bacteria | 2978 |
| 157 | Ga0207683_10793518 | 3300026121 | Bacteria | 879 |
| 158 | Ga0207428_10018527 | 3300027907 | Bacteria | 5944 |
| 159 | Ga0207428_10022110 | 3300027907 | Bacteria | 5370 |
| 160 | Ga0207428_10130074 | 3300027907 | Bacteria | 1927 |
| 161 | Ga0268264_10354156 | 3300028381 | Bacteria | 1398 |
| 162 | Ga0265316_10166317 | 3300031344 | Bacteria | 1647 |
| 163 | Ga0307408_100426616 | 3300031548 | Bacteria | 1145 |
| 164 | Ga0316579_10157532 | 3300031691 | Bacteria | 1097 |
| 165 | Ga0316578_10035644 | 3300031728 | Bacteria | 2861 |
| 166 | Ga0307405_10036864 | 3300031731 | Bacteria | 2934 |
| 167 | Ga0307405_10113226 | 3300031731 | Bacteria | 1842 |
| 168 | Ga0307405_10517202 | 3300031731 | Bacteria | 960 |
| 169 | Ga0316577_10046869 | 3300031733 | Bacteria | 2413 |
| 170 | Ga0307413_10064057 | 3300031824 | Bacteria | 2282 |
| 171 | Ga0307410_10010418 | 3300031852 | Bacteria | 5263 |
| 172 | Ga0307406_10043696 | 3300031901 | Bacteria | 2804 |
| 173 | Ga0307406_10129846 | 3300031901 | Bacteria | 1767 |
| 174 | Ga0307406_10294756 | 3300031901 | Bacteria | 1243 |
| 175 | Ga0307406_10572196 | 3300031901 | Bacteria | 927 |
| 176 | Ga0307407_10058249 | 3300031903 | Bacteria | 2245 |
| 177 | Ga0307407_10113978 | 3300031903 | Bacteria | 1702 |
| 178 | Ga0307409_100014869 | 3300031995 | Bacteria | 5082 |
| 179 | Ga0307409_100027847 | 3300031995 | Bacteria | 4013 |
| 180 | Ga0307409_100231243 | 3300031995 | Bacteria | 1676 |
| 181 | Ga0307416_100019908 | 3300032002 | Bacteria | 4771 |
| 182 | Ga0307416_100051676 | 3300032002 | Bacteria | 3285 |
| 183 | Ga0307416_100053586 | 3300032002 | Bacteria | 3237 |
| 184 | Ga0307416_100294224 | 3300032002 | Bacteria | 1609 |
| 185 | Ga0307416_100403444 | 3300032002 | Bacteria | 1405 |
| 186 | Ga0307416_101281445 | 3300032002 | Bacteria | 839 |
| 187 | Ga0307411_10017274 | 3300032005 | Bacteria | 4106 |
| 188 | Ga0307411_10020394 | 3300032005 | Bacteria | 3854 |
| 189 | Ga0307415_100011377 | 3300032126 | Bacteria | 5089 |
| 190 | Ga0307415_100016081 | 3300032126 | Bacteria | 4448 |
| 191 | Ga0307415_100443764 | 3300032126 | Bacteria | 1120 |
| 192 | Ga0307415_101031878 | 3300032126 | Unclassified | 766 |
| 193 | Ga0373930_0008608 | 3300034816 | Bacteria | 1788 |
| 194 | Ga0373958_0024488 | 3300034819 | Bacteria | 1143 |
| 195 | Ga0373941_0050081 | 3300035115 | Bacteria | 1325 |
| 196 | Ga0373960_0005971 | 3300035121 | Bacteria | 2839 |
| 197 | Ga0373943_0045966 | 3300035170 | Bacteria | 2129 |
| 198 | Ga0373935_0419944 | 3300035692 | Bacteria | 963 |
| 199 | Ga0373947_0350741 | 3300035725 | Bacteria | 990 |
| 200 | Ga0316584_0124036 | 3300036712 | Bacteria | 1929 |
| 201 | Ga0373925_0039617 | 3300037068 | Bacteria | 3486 |
| 202 | Ga0395900_0063408 | 3300037418 | Bacteria | 3799 |
| 203 | Ga0316581_0045915 | 3300037588 | Bacteria | 1335 |
| 204 | Ga0436364_0371372 | 3300037853 | Bacteria | 821 |
| 205 | Ga0436362_0275857 | 3300039453 | Bacteria | 2888 |
| 206 | Ga0439463_008576 | 3300042016 | Bacteria | 2518 |
| 207 | Ga0439460_0066748 | 3300042461 | Bacteria | 1107 |
| 208 | Ga0466961_0093451 | 3300044693 | Bacteria | 1898 |
| 209 | Ga0466964_0068849 | 3300044706 | Bacteria | 1491 |
| 210 | Ga0453684_0020986 | 3300044712 | Bacteria | 9795 |
| 211 | Ga0466957_0413296 | 3300044842 | Bacteria | 924 |
| 212 | Ga0466967_0049652 | 3300045976 | Bacteria | 3670 |
| 213 | Ga0466967_0371953 | 3300045976 | Bacteria | 1386 |
| 214 | Ga0495596_0064309 | 3300046500 | Bacteria | 1427 |
| 215 | Ga0495631_0141741 | 3300046518 | Bacteria | 1032 |
| 216 | Ga0495656_0197932 | 3300046615 | Unclassified | 996 |
| 217 | Ga0495676_0270851 | 3300047321 | Bacteria | 1152 |
| 218 | Ga0496100_0019343 | 3300048903 | Bacteria | 4061 |
| 219 | Ga0496100_0084354 | 3300048903 | Bacteria | 2153 |
| 220 | Ga0496101_0242622 | 3300048904 | Bacteria | 1402 |
| 221 | Ga0496102_0650226 | 3300048905 | Bacteria | 977 |
| 222 | Ga0496104_0009750 | 3300048907 | Bacteria | 8562 |
| 223 | Ga0496104_0391725 | 3300048907 | Bacteria | 1301 |
| 224 | Ga0496105_0042101 | 3300048908 | Bacteria | 3765 |
| 225 | Ga0496105_0298448 | 3300048908 | Bacteria | 1295 |
| 226 | Ga0496108_0604442 | 3300048911 | Bacteria | 955 |
| 227 | Ga0496109_0001323 | 3300048912 | Bacteria | 20434 |
| 228 | Ga0496109_0069720 | 3300048912 | Bacteria | 3225 |
| 229 | Ga0496112_0442615 | 3300048915 | Bacteria | 1237 |
| 230 | Ga0496112_0889645 | 3300048915 | Bacteria | 813 |
| 231 | Ga0496113_0081019 | 3300048916 | Bacteria | 2487 |
| 232 | Ga0496115_0097850 | 3300048918 | Bacteria | 2403 |
| 233 | Ga0501036_0450438 | 3300049572 | Bacteria | 1072 |
| 234 | Ga0501040_0165302 | 3300049576 | Bacteria | 1565 |
| 235 | Ga0501042_0183129 | 3300049578 | Bacteria | 1511 |
| 236 | Ga0501042_0517908 | 3300049578 | Bacteria | 866 |
| 237 | Ga0501048_0036906 | 3300049582 | Bacteria | 3511 |
| 238 | Ga0501048_0338682 | 3300049582 | Bacteria | 1072 |
| 239 | Ga0501067_0284311 | 3300049583 | Archaea | 921 |
| 240 | Ga0501067_0326862 | 3300049583 | Bacteria | 854 |
| 241 | Ga0501071_0276223 | 3300049587 | Bacteria | 1271 |
| 242 | Ga0501072_0082417 | 3300049588 | Bacteria | 2550 |
| 243 | Ga0501072_0118842 | 3300049588 | Bacteria | 2106 |
| 244 | Ga0501075_0097495 | 3300049591 | Bacteria | 2231 |
| 245 | Ga0501076_0273644 | 3300049592 | Bacteria | 1383 |
| 246 | Ga0501079_0049483 | 3300049741 | Bacteria | 3244 |
| 247 | Ga0501081_0061642 | 3300049743 | Bacteria | 2601 |
| 248 | Ga0501081_0112524 | 3300049743 | Bacteria | 1932 |
| 249 | Ga0501045_0027965 | 3300049824 | Bacteria | 4067 |
| 250 | nmdc:mga05p37_162238_c1 | 3300050507 | Bacteria | 2729 |
| 251 | nmdc:mga05p37_1877_c2 | 3300050507 | Bacteria | 21709 |
| 252 | nmdc:mga05p37_53904_c1 | 3300050507 | Bacteria | 4947 |
| 253 | nmdc:mga05p37_745193_c1 | 3300050507 | Bacteria | 1081 |
| 254 | nmdc:mga09592_343529_c1 | 3300050508 | Bacteria | 1292 |
| 255 | nmdc:mga09592_501_c1 | 3300050508 | Bacteria | 29569 |
| 256 | nmdc:mga09592_610349_c1 | 3300050508 | Bacteria | 934 |
| 257 | nmdc:mga0qj67_235256_c1 | 3300050509 | Bacteria | 1486 |
| 258 | nmdc:mga0qj67_29055_c1 | 3300050509 | Bacteria | 4293 |
| 259 | nmdc:mga0qj67_7333_c1 | 3300050509 | Bacteria | 8151 |
| 260 | nmdc:mga06r32_105341_c1 | 3300050510 | Bacteria | 2770 |
| 261 | nmdc:mga06r32_285373_c1 | 3300050510 | Bacteria | 1637 |
| 262 | nmdc:mga06r32_340023_c1 | 3300050510 | Bacteria | 1486 |
| 263 | nmdc:mga06r32_41285_c1 | 3300050510 | Bacteria | 4382 |
| 264 | nmdc:mga06r32_94274_c1 | 3300050510 | Bacteria | 2929 |
| 265 | nmdc:mga08y16_314978_c1 | 3300050511 | Bacteria | 1611 |
| 266 | nmdc:mga08y16_498486_c1 | 3300050511 | Bacteria | 1237 |
| 267 | nmdc:mga0a205_431909_c1 | 3300050515 | Bacteria | 1178 |
| 268 | Ga0501084_0200259 | 3300054114 | Bacteria | 1685 |
| 269 | Ga0501084_0287177 | 3300054114 | Bacteria | 1389 |
| 270 | Ga0501082_0039415 | 3300060353 | Bacteria | 4075 |
| 271 | Ga0501082_0446985 | 3300060353 | Bacteria | 1129 |
| 272 | Ga0530510_0011926 | 3300061734 | Bacteria | 6097 |
| 273 | Ga0530510_0120832 | 3300061734 | Bacteria | 1923 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050511 | nmdc:mga08y16_498486_c1 | nmdc:mga08y16_498486_c1_40_663 | 180 |
| 2 | 3300006844 | Ga0075428_100190983 | Ga0075428_1001909833 | 183 |
| 3 | 3300006847 | Ga0075431_100279975 | Ga0075431_1002799752 | 183 |
| 4 | 3300050510 | nmdc:mga06r32_41285_c1 | nmdc:mga06r32_41285_c1_2393_2968 | 183 |
| 5 | 3300005719 | Ga0068861_100492919 | Ga0068861_1004929192 | 196 |
| 6 | 3300009147 | Ga0114129_10874433 | Ga0114129_108744332 | 196 |
| 7 | 3300026118 | Ga0207675_100199379 | Ga0207675_1001993792 | 196 |
| 8 | 3300026118 | Ga0207675_100514693 | Ga0207675_1005146932 | 196 |
| 9 | 3300044693 | Ga0466961_0093451 | Ga0466961_0093451_223_891 | 196 |
| 10 | 3300050507 | nmdc:mga05p37_53904_c1 | nmdc:mga05p37_53904_c1_102_719 | 196 |
| 11 | 3300006880 | Ga0075429_100002283 | Ga0075429_10000228318 | 197 |
| 12 | 3300009147 | Ga0114129_10002844 | Ga0114129_100028442 | 197 |
| 13 | 3300031548 | Ga0307408_100426616 | Ga0307408_1004266162 | 197 |
| 14 | 3300031691 | Ga0316579_10157532 | Ga0316579_101575322 | 197 |
| 15 | 3300031728 | Ga0316578_10035644 | Ga0316578_100356443 | 197 |
| 16 | 3300031731 | Ga0307405_10113226 | Ga0307405_101132262 | 197 |
| 17 | 3300031733 | Ga0316577_10046869 | Ga0316577_100468692 | 197 |
| 18 | 3300031824 | Ga0307413_10064057 | Ga0307413_100640572 | 197 |
| 19 | 3300031852 | Ga0307410_10010418 | Ga0307410_100104185 | 197 |
| 20 | 3300031903 | Ga0307407_10113978 | Ga0307407_101139782 | 197 |
| 21 | 3300031995 | Ga0307409_100014869 | Ga0307409_1000148693 | 197 |
| 22 | 3300032002 | Ga0307416_100019908 | Ga0307416_1000199083 | 197 |
| 23 | 3300032005 | Ga0307411_10017274 | Ga0307411_100172743 | 197 |
| 24 | 3300032126 | Ga0307415_100016081 | Ga0307415_1000160816 | 197 |
| 25 | 3300036712 | Ga0316584_0124036 | Ga0316584_0124036_695_1309 | 197 |
| 26 | 3300037588 | Ga0316581_0045915 | Ga0316581_0045915_644_1258 | 197 |
| 27 | 3300050507 | nmdc:mga05p37_1877_c2 | nmdc:mga05p37_1877_c2_6330_6950 | 197 |
| 28 | 3300050508 | nmdc:mga09592_501_c1 | nmdc:mga09592_501_c1_18055_18675 | 197 |
| 29 | iso_pu_bacteria | 2929297113 | 2929298883 | 197 |
| 30 | 3300009094 | Ga0111539_10050228 | Ga0111539_100502283 | 198 |
| 31 | 3300014326 | Ga0157380_10114673 | Ga0157380_101146732 | 198 |
| 32 | 3300025901 | Ga0207688_10424247 | Ga0207688_104242472 | 198 |
| 33 | 3300025937 | Ga0207669_10058166 | Ga0207669_100581663 | 198 |
| 34 | 3300027907 | Ga0207428_10022110 | Ga0207428_100221103 | 198 |
| 35 | 3300044706 | Ga0466964_0068849 | Ga0466964_0068849_614_1285 | 198 |
| 36 | 3300045976 | Ga0466967_0371953 | Ga0466967_0371953_441_1112 | 198 |
| 37 | 3300048915 | Ga0496112_0889645 | Ga0496112_0889645_138_767 | 199 |
| 38 | 3300003373 | JGI25407J50210_10010002 | JGI25407J50210_100100023 | 201 |
| 39 | 3300005327 | Ga0070658_10249076 | Ga0070658_102490762 | 201 |
| 40 | 3300005981 | Ga0081538_10000024 | Ga0081538_1000002434 | 201 |
| 41 | 3300025916 | Ga0207663_10151689 | Ga0207663_101516892 | 201 |
| 42 | 3300025921 | Ga0207652_10316394 | Ga0207652_103163942 | 201 |
| 43 | 3300035170 | Ga0373943_0045966 | Ga0373943_0045966_90_722 | 201 |
| 44 | 3300035692 | Ga0373935_0419944 | Ga0373935_0419944_104_736 | 201 |
| 45 | 3300037068 | Ga0373925_0039617 | Ga0373925_0039617_827_1459 | 201 |
| 46 | 3300005437 | Ga0070710_10091960 | Ga0070710_100919602 | 202 |
| 47 | 3300005937 | Ga0081455_10141763 | Ga0081455_101417632 | 202 |
| 48 | 3300006163 | Ga0070715_10051302 | Ga0070715_100513022 | 202 |
| 49 | 3300009147 | Ga0114129_11454368 | Ga0114129_114543682 | 202 |
| 50 | 3300025915 | Ga0207693_10266149 | Ga0207693_102661492 | 202 |
| 51 | 3300025939 | Ga0207665_10084193 | Ga0207665_100841932 | 202 |
| 52 | 3300031344 | Ga0265316_10166317 | Ga0265316_101663172 | 202 |
| 53 | 3300044712 | Ga0453684_0020986 | Ga0453684_0020986_7003_7641 | 202 |
| 54 | 3300010375 | Ga0105239_10517720 | Ga0105239_105177202 | 204 |
| 55 | 3300050509 | nmdc:mga0qj67_235256_c1 | nmdc:mga0qj67_235256_c1_780_1418 | 204 |
| 56 | 3300005459 | Ga0068867_100803275 | Ga0068867_1008032751 | 205 |
| 57 | 3300006881 | Ga0068865_100337558 | Ga0068865_1003375582 | 205 |
| 58 | 3300009176 | Ga0105242_10248957 | Ga0105242_102489572 | 205 |
| 59 | 3300026121 | Ga0207683_10793518 | Ga0207683_107935182 | 205 |
| 60 | 3300032002 | Ga0307416_100051676 | Ga0307416_1000516762 | 205 |
| 61 | 3300032002 | Ga0307416_101281445 | Ga0307416_1012814452 | 205 |
| 62 | 3300032126 | Ga0307415_101031878 | Ga0307415_1010318781 | 205 |
| 63 | 3300049583 | Ga0501067_0326862 | Ga0501067_0326862_17_679 | 205 |
| 64 | 3300005330 | Ga0070690_100043015 | Ga0070690_1000430152 | 206 |
| 65 | 3300005334 | Ga0068869_100051114 | Ga0068869_1000511143 | 206 |
| 66 | 3300005337 | Ga0070682_100206101 | Ga0070682_1002061012 | 206 |
| 67 | 3300005339 | Ga0070660_100336499 | Ga0070660_1003364992 | 206 |
| 68 | 3300005341 | Ga0070691_10181942 | Ga0070691_101819422 | 206 |
| 69 | 3300005344 | Ga0070661_100242336 | Ga0070661_1002423362 | 206 |
| 70 | 3300005353 | Ga0070669_100100446 | Ga0070669_1001004462 | 206 |
| 71 | 3300005354 | Ga0070675_100380734 | Ga0070675_1003807342 | 206 |
| 72 | 3300005366 | Ga0070659_100040753 | Ga0070659_1000407534 | 206 |
| 73 | 3300005456 | Ga0070678_100131994 | Ga0070678_1001319942 | 206 |
| 74 | 3300005457 | Ga0070662_100533840 | Ga0070662_1005338402 | 206 |
| 75 | 3300005459 | Ga0068867_100144196 | Ga0068867_1001441961 | 206 |
| 76 | 3300005466 | Ga0070685_10045195 | Ga0070685_100451953 | 206 |
| 77 | 3300005535 | Ga0070684_100026148 | Ga0070684_1000261486 | 206 |
| 78 | 3300005539 | Ga0068853_100676035 | Ga0068853_1006760351 | 206 |
| 79 | 3300005544 | Ga0070686_100083332 | Ga0070686_1000833322 | 206 |
| 80 | 3300005545 | Ga0070695_100239038 | Ga0070695_1002390381 | 206 |
| 81 | 3300005547 | Ga0070693_100193946 | Ga0070693_1001939462 | 206 |
| 82 | 3300005564 | Ga0070664_100220817 | Ga0070664_1002208172 | 206 |
| 83 | 3300005577 | Ga0068857_100153033 | Ga0068857_1001530332 | 206 |
| 84 | 3300005615 | Ga0070702_100204658 | Ga0070702_1002046581 | 206 |
| 85 | 3300005616 | Ga0068852_100586863 | Ga0068852_1005868631 | 206 |
| 86 | 3300005618 | Ga0068864_100191224 | Ga0068864_1001912242 | 206 |
| 87 | 3300005618 | Ga0068864_100341633 | Ga0068864_1003416332 | 206 |
| 88 | 3300005718 | Ga0068866_10277933 | Ga0068866_102779332 | 206 |
| 89 | 3300005840 | Ga0068870_10084428 | Ga0068870_100844282 | 206 |
| 90 | 3300005937 | Ga0081455_10215557 | Ga0081455_102155571 | 206 |
| 91 | 3300006058 | Ga0075432_10004464 | Ga0075432_100044642 | 206 |
| 92 | 3300006237 | Ga0097621_100230516 | Ga0097621_1002305162 | 206 |
| 93 | 3300006358 | Ga0068871_100480184 | Ga0068871_1004801842 | 206 |
| 94 | 3300006847 | Ga0075431_100385826 | Ga0075431_1003858262 | 206 |
| 95 | 3300006871 | Ga0075434_100287292 | Ga0075434_1002872922 | 206 |
| 96 | 3300009094 | Ga0111539_10145262 | Ga0111539_101452622 | 206 |
| 97 | 3300009094 | Ga0111539_10517300 | Ga0111539_105173002 | 206 |
| 98 | 3300009098 | Ga0105245_11054701 | Ga0105245_110547012 | 206 |
| 99 | 3300009101 | Ga0105247_10043281 | Ga0105247_100432811 | 206 |
| 100 | 3300009174 | Ga0105241_10090538 | Ga0105241_100905383 | 206 |
| 101 | 3300009177 | Ga0105248_10445835 | Ga0105248_104458352 | 206 |
| 102 | 3300009551 | Ga0105238_10264423 | Ga0105238_102644232 | 206 |
| 103 | 3300013306 | Ga0163162_10381020 | Ga0163162_103810202 | 206 |
| 104 | 3300014325 | Ga0163163_10230661 | Ga0163163_102306612 | 206 |
| 105 | 3300014325 | Ga0163163_10594233 | Ga0163163_105942332 | 206 |
| 106 | 3300014745 | Ga0157377_10141841 | Ga0157377_101418412 | 206 |
| 107 | 3300014968 | Ga0157379_10131330 | Ga0157379_101313302 | 206 |
| 108 | 3300014969 | Ga0157376_10271904 | Ga0157376_102719042 | 206 |
| 109 | 3300025901 | Ga0207688_10017322 | Ga0207688_100173223 | 206 |
| 110 | 3300025907 | Ga0207645_10138715 | Ga0207645_101387152 | 206 |
| 111 | 3300025908 | Ga0207643_10059708 | Ga0207643_100597083 | 206 |
| 112 | 3300025918 | Ga0207662_10003675 | Ga0207662_100036752 | 206 |
| 113 | 3300025919 | Ga0207657_10021351 | Ga0207657_100213516 | 206 |
| 114 | 3300025923 | Ga0207681_10278231 | Ga0207681_102782312 | 206 |
| 115 | 3300025926 | Ga0207659_10295098 | Ga0207659_102950982 | 206 |
| 116 | 3300025927 | Ga0207687_10110380 | Ga0207687_101103802 | 206 |
| 117 | 3300025932 | Ga0207690_10158831 | Ga0207690_101588312 | 206 |
| 118 | 3300025935 | Ga0207709_10081850 | Ga0207709_100818502 | 206 |
| 119 | 3300025938 | Ga0207704_10071013 | Ga0207704_100710132 | 206 |
| 120 | 3300025940 | Ga0207691_10118035 | Ga0207691_101180352 | 206 |
| 121 | 3300025945 | Ga0207679_10364369 | Ga0207679_103643692 | 206 |
| 122 | 3300025961 | Ga0207712_10242674 | Ga0207712_102426742 | 206 |
| 123 | 3300025981 | Ga0207640_10101673 | Ga0207640_101016732 | 206 |
| 124 | 3300025986 | Ga0207658_10249772 | Ga0207658_102497722 | 206 |
| 125 | 3300026041 | Ga0207639_10329772 | Ga0207639_103297722 | 206 |
| 126 | 3300026067 | Ga0207678_10157999 | Ga0207678_101579992 | 206 |
| 127 | 3300026075 | Ga0207708_10148213 | Ga0207708_101482132 | 206 |
| 128 | 3300026075 | Ga0207708_10315222 | Ga0207708_103152222 | 206 |
| 129 | 3300026088 | Ga0207641_10411337 | Ga0207641_104113372 | 206 |
| 130 | 3300026095 | Ga0207676_10179822 | Ga0207676_101798222 | 206 |
| 131 | 3300026121 | Ga0207683_10075801 | Ga0207683_100758013 | 206 |
| 132 | 3300027907 | Ga0207428_10018527 | Ga0207428_100185272 | 206 |
| 133 | 3300027907 | Ga0207428_10130074 | Ga0207428_101300742 | 206 |
| 134 | 3300028381 | Ga0268264_10354156 | Ga0268264_103541562 | 206 |
| 135 | 3300031731 | Ga0307405_10036864 | Ga0307405_100368643 | 206 |
| 136 | 3300031901 | Ga0307406_10043696 | Ga0307406_100436962 | 206 |
| 137 | 3300031901 | Ga0307406_10129846 | Ga0307406_101298462 | 206 |
| 138 | 3300031901 | Ga0307406_10572196 | Ga0307406_105721962 | 206 |
| 139 | 3300031995 | Ga0307409_100027847 | Ga0307409_1000278471 | 206 |
| 140 | 3300031995 | Ga0307409_100231243 | Ga0307409_1002312432 | 206 |
| 141 | 3300032002 | Ga0307416_100294224 | Ga0307416_1002942242 | 206 |
| 142 | 3300032005 | Ga0307411_10020394 | Ga0307411_100203942 | 206 |
| 143 | 3300032126 | Ga0307415_100011377 | Ga0307415_1000113772 | 206 |
| 144 | 3300032126 | Ga0307415_100443764 | Ga0307415_1004437642 | 206 |
| 145 | 3300034816 | Ga0373930_0008608 | Ga0373930_0008608_253_888 | 206 |
| 146 | 3300034819 | Ga0373958_0024488 | Ga0373958_0024488_336_971 | 206 |
| 147 | 3300035115 | Ga0373941_0050081 | Ga0373941_0050081_545_1180 | 206 |
| 148 | 3300035121 | Ga0373960_0005971 | Ga0373960_0005971_1246_1881 | 206 |
| 149 | 3300035725 | Ga0373947_0350741 | Ga0373947_0350741_175_810 | 206 |
| 150 | 3300037418 | Ga0395900_0063408 | Ga0395900_0063408_801_1436 | 206 |
| 151 | 3300045976 | Ga0466967_0049652 | Ga0466967_0049652_2350_3012 | 206 |
| 152 | 3300047321 | Ga0495676_0270851 | Ga0495676_0270851_85_720 | 206 |
| 153 | 3300048903 | Ga0496100_0084354 | Ga0496100_0084354_619_1302 | 206 |
| 154 | 3300048904 | Ga0496101_0242622 | Ga0496101_0242622_648_1331 | 206 |
| 155 | 3300048907 | Ga0496104_0391725 | Ga0496104_0391725_54_737 | 206 |
| 156 | 3300048908 | Ga0496105_0298448 | Ga0496105_0298448_429_1112 | 206 |
| 157 | 3300048912 | Ga0496109_0069720 | Ga0496109_0069720_480_1145 | 206 |
| 158 | 3300048915 | Ga0496112_0442615 | Ga0496112_0442615_32_715 | 206 |
| 159 | 3300048916 | Ga0496113_0081019 | Ga0496113_0081019_943_1626 | 206 |
| 160 | 3300048918 | Ga0496115_0097850 | Ga0496115_0097850_512_1195 | 206 |
| 161 | 3300050510 | nmdc:mga06r32_285373_c1 | nmdc:mga06r32_285373_c1_435_1073 | 206 |
| 162 | 3300050515 | nmdc:mga0a205_431909_c1 | nmdc:mga0a205_431909_c1_250_885 | 206 |
| 163 | 3300003373 | JGI25407J50210_10003952 | JGI25407J50210_100039524 | 207 |
| 164 | 3300003373 | JGI25407J50210_10008204 | JGI25407J50210_100082043 | 207 |
| 165 | 3300003373 | JGI25407J50210_10034408 | JGI25407J50210_100344082 | 207 |
| 166 | 3300005347 | Ga0070668_100041585 | Ga0070668_1000415853 | 207 |
| 167 | 3300005441 | Ga0070700_100179875 | Ga0070700_1001798752 | 207 |
| 168 | 3300005457 | Ga0070662_100000228 | Ga0070662_10000022821 | 207 |
| 169 | 3300005535 | Ga0070684_100518232 | Ga0070684_1005182322 | 207 |
| 170 | 3300005546 | Ga0070696_100055471 | Ga0070696_1000554712 | 207 |
| 171 | 3300005615 | Ga0070702_100244525 | Ga0070702_1002445252 | 207 |
| 172 | 3300005718 | Ga0068866_10477817 | Ga0068866_104778171 | 207 |
| 173 | 3300005719 | Ga0068861_100027333 | Ga0068861_1000273334 | 207 |
| 174 | 3300005937 | Ga0081455_10325458 | Ga0081455_103254582 | 207 |
| 175 | 3300005981 | Ga0081538_10000228 | Ga0081538_100002282 | 207 |
| 176 | 3300005981 | Ga0081538_10000360 | Ga0081538_100003605 | 207 |
| 177 | 3300005981 | Ga0081538_10000752 | Ga0081538_100007527 | 207 |
| 178 | 3300005981 | Ga0081538_10000910 | Ga0081538_1000091011 | 207 |
| 179 | 3300005981 | Ga0081538_10004604 | Ga0081538_100046045 | 207 |
| 180 | 3300005981 | Ga0081538_10004702 | Ga0081538_100047023 | 207 |
| 181 | 3300005981 | Ga0081538_10007448 | Ga0081538_100074488 | 207 |
| 182 | 3300005981 | Ga0081538_10011687 | Ga0081538_100116873 | 207 |
| 183 | 3300005981 | Ga0081538_10028306 | Ga0081538_100283065 | 207 |
| 184 | 3300005981 | Ga0081538_10034670 | Ga0081538_100346702 | 207 |
| 185 | 3300005981 | Ga0081538_10054702 | Ga0081538_100547023 | 207 |
| 186 | 3300005981 | Ga0081538_10065793 | Ga0081538_100657932 | 207 |
| 187 | 3300005981 | Ga0081538_10107608 | Ga0081538_101076081 | 207 |
| 188 | 3300005981 | Ga0081538_10138781 | Ga0081538_101387811 | 207 |
| 189 | 3300005981 | Ga0081538_10157860 | Ga0081538_101578602 | 207 |
| 190 | 3300005983 | Ga0081540_1086144 | Ga0081540_10861442 | 207 |
| 191 | 3300006844 | Ga0075428_100070743 | Ga0075428_1000707432 | 207 |
| 192 | 3300006844 | Ga0075428_100141536 | Ga0075428_1001415362 | 207 |
| 193 | 3300006844 | Ga0075428_100565722 | Ga0075428_1005657222 | 207 |
| 194 | 3300006846 | Ga0075430_100000245 | Ga0075430_10000024520 | 207 |
| 195 | 3300006846 | Ga0075430_100003035 | Ga0075430_10000303512 | 207 |
| 196 | 3300006846 | Ga0075430_100607255 | Ga0075430_1006072552 | 207 |
| 197 | 3300006847 | Ga0075431_100009559 | Ga0075431_1000095594 | 207 |
| 198 | 3300006847 | Ga0075431_100079389 | Ga0075431_1000793893 | 207 |
| 199 | 3300006847 | Ga0075431_100129732 | Ga0075431_1001297323 | 207 |
| 200 | 3300006847 | Ga0075431_100334491 | Ga0075431_1003344912 | 207 |
| 201 | 3300006880 | Ga0075429_100234666 | Ga0075429_1002346662 | 207 |
| 202 | 3300006880 | Ga0075429_100412647 | Ga0075429_1004126472 | 207 |
| 203 | 3300009094 | Ga0111539_10644440 | Ga0111539_106444402 | 207 |
| 204 | 3300009094 | Ga0111539_10878499 | Ga0111539_108784992 | 207 |
| 205 | 3300009098 | Ga0105245_10003111 | Ga0105245_100031114 | 207 |
| 206 | 3300009147 | Ga0114129_10013759 | Ga0114129_100137592 | 207 |
| 207 | 3300009147 | Ga0114129_10665714 | Ga0114129_106657142 | 207 |
| 208 | 3300009147 | Ga0114129_10725247 | Ga0114129_107252472 | 207 |
| 209 | 3300009551 | Ga0105238_10396373 | Ga0105238_103963732 | 207 |
| 210 | 3300009553 | Ga0105249_10008979 | Ga0105249_100089798 | 207 |
| 211 | 3300010375 | Ga0105239_10020000 | Ga0105239_100200004 | 207 |
| 212 | 3300017792 | Ga0163161_10133323 | Ga0163161_101333232 | 207 |
| 213 | 3300021388 | Ga0213875_10221445 | Ga0213875_102214451 | 207 |
| 214 | 3300025899 | Ga0207642_10340724 | Ga0207642_103407241 | 207 |
| 215 | 3300025901 | Ga0207688_10053764 | Ga0207688_100537642 | 207 |
| 216 | 3300025924 | Ga0207694_10448631 | Ga0207694_104486311 | 207 |
| 217 | 3300025927 | Ga0207687_10062742 | Ga0207687_100627422 | 207 |
| 218 | 3300025933 | Ga0207706_10001194 | Ga0207706_100011944 | 207 |
| 219 | 3300025961 | Ga0207712_10011336 | Ga0207712_100113364 | 207 |
| 220 | 3300025972 | Ga0207668_10252316 | Ga0207668_102523162 | 207 |
| 221 | 3300026075 | Ga0207708_10048416 | Ga0207708_100484162 | 207 |
| 222 | 3300026078 | Ga0207702_10229766 | Ga0207702_102297661 | 207 |
| 223 | 3300026118 | Ga0207675_100015096 | Ga0207675_1000150966 | 207 |
| 224 | 3300031731 | Ga0307405_10517202 | Ga0307405_105172022 | 207 |
| 225 | 3300031901 | Ga0307406_10294756 | Ga0307406_102947562 | 207 |
| 226 | 3300031903 | Ga0307407_10058249 | Ga0307407_100582492 | 207 |
| 227 | 3300032002 | Ga0307416_100053586 | Ga0307416_1000535862 | 207 |
| 228 | 3300032002 | Ga0307416_100403444 | Ga0307416_1004034442 | 207 |
| 229 | 3300037853 | Ga0436364_0371372 | Ga0436364_0371372_20_664 | 207 |
| 230 | 3300039453 | Ga0436362_0275857 | Ga0436362_0275857_1828_2481 | 207 |
| 231 | 3300042016 | Ga0439463_008576 | Ga0439463_008576_1408_2064 | 207 |
| 232 | 3300042461 | Ga0439460_0066748 | Ga0439460_0066748_417_1073 | 207 |
| 233 | 3300044842 | Ga0466957_0413296 | Ga0466957_0413296_154_819 | 207 |
| 234 | 3300046500 | Ga0495596_0064309 | Ga0495596_0064309_267_905 | 207 |
| 235 | 3300046518 | Ga0495631_0141741 | Ga0495631_0141741_218_898 | 207 |
| 236 | 3300046615 | Ga0495656_0197932 | Ga0495656_0197932_14_655 | 207 |
| 237 | 3300048903 | Ga0496100_0019343 | Ga0496100_0019343_113_814 | 207 |
| 238 | 3300048905 | Ga0496102_0650226 | Ga0496102_0650226_59_760 | 207 |
| 239 | 3300048907 | Ga0496104_0009750 | Ga0496104_0009750_3633_4334 | 207 |
| 240 | 3300048908 | Ga0496105_0042101 | Ga0496105_0042101_2990_3691 | 207 |
| 241 | 3300048911 | Ga0496108_0604442 | Ga0496108_0604442_241_942 | 207 |
| 242 | 3300048912 | Ga0496109_0001323 | Ga0496109_0001323_15999_16700 | 207 |
| 243 | 3300049572 | Ga0501036_0450438 | Ga0501036_0450438_240_896 | 207 |
| 244 | 3300049576 | Ga0501040_0165302 | Ga0501040_0165302_685_1365 | 207 |
| 245 | 3300049578 | Ga0501042_0183129 | Ga0501042_0183129_11_667 | 207 |
| 246 | 3300049578 | Ga0501042_0517908 | Ga0501042_0517908_86_766 | 207 |
| 247 | 3300049582 | Ga0501048_0036906 | Ga0501048_0036906_1000_1656 | 207 |
| 248 | 3300049582 | Ga0501048_0338682 | Ga0501048_0338682_193_831 | 207 |
| 249 | 3300049583 | Ga0501067_0284311 | Ga0501067_0284311_98_736 | 207 |
| 250 | 3300049587 | Ga0501071_0276223 | Ga0501071_0276223_32_712 | 207 |
| 251 | 3300049588 | Ga0501072_0082417 | Ga0501072_0082417_1282_1983 | 207 |
| 252 | 3300049588 | Ga0501072_0118842 | Ga0501072_0118842_78_734 | 207 |
| 253 | 3300049591 | Ga0501075_0097495 | Ga0501075_0097495_761_1441 | 207 |
| 254 | 3300049592 | Ga0501076_0273644 | Ga0501076_0273644_62_742 | 207 |
| 255 | 3300049741 | Ga0501079_0049483 | Ga0501079_0049483_1954_2610 | 207 |
| 256 | 3300049743 | Ga0501081_0061642 | Ga0501081_0061642_1355_2035 | 207 |
| 257 | 3300049743 | Ga0501081_0112524 | Ga0501081_0112524_24_680 | 207 |
| 258 | 3300049824 | Ga0501045_0027965 | Ga0501045_0027965_1435_2091 | 207 |
| 259 | 3300050507 | nmdc:mga05p37_162238_c1 | nmdc:mga05p37_162238_c1_1386_2024 | 207 |
| 260 | 3300050507 | nmdc:mga05p37_745193_c1 | nmdc:mga05p37_745193_c1_120_758 | 207 |
| 261 | 3300050508 | nmdc:mga09592_343529_c1 | nmdc:mga09592_343529_c1_343_981 | 207 |
| 262 | 3300050508 | nmdc:mga09592_610349_c1 | nmdc:mga09592_610349_c1_221_859 | 207 |
| 263 | 3300050509 | nmdc:mga0qj67_29055_c1 | nmdc:mga0qj67_29055_c1_1564_2202 | 207 |
| 264 | 3300050509 | nmdc:mga0qj67_7333_c1 | nmdc:mga0qj67_7333_c1_1410_2057 | 207 |
| 265 | 3300050510 | nmdc:mga06r32_105341_c1 | nmdc:mga06r32_105341_c1_637_1311 | 207 |
| 266 | 3300050510 | nmdc:mga06r32_340023_c1 | nmdc:mga06r32_340023_c1_442_1089 | 207 |
| 267 | 3300050510 | nmdc:mga06r32_94274_c1 | nmdc:mga06r32_94274_c1_340_987 | 207 |
| 268 | 3300050511 | nmdc:mga08y16_314978_c1 | nmdc:mga08y16_314978_c1_774_1451 | 207 |
| 269 | 3300054114 | Ga0501084_0200259 | Ga0501084_0200259_401_1039 | 207 |
| 270 | 3300054114 | Ga0501084_0287177 | Ga0501084_0287177_38_718 | 207 |
| 271 | 3300060353 | Ga0501082_0039415 | Ga0501082_0039415_1341_1997 | 207 |
| 272 | 3300060353 | Ga0501082_0446985 | Ga0501082_0446985_43_681 | 207 |
| 273 | 3300061734 | Ga0530510_0011926 | Ga0530510_0011926_162_818 | 207 |
| 274 | 3300061734 | Ga0530510_0120832 | Ga0530510_0120832_55_735 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v5x-assembly1.cif.gz_B | crystal structure of phosphoribosyl anthranilate isomerase from thermus thermophilus | 0.9074 | 2 | 201 |
| 1v5x-assembly1.cif.gz_B | crystal structure of phosphoribosyl anthranilate isomerase from thermus thermophilus | 0.8944 | 2 | 201 |
| 1dl3-assembly2.cif.gz_B | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.889 | 1 | 201 |
| 1nsj-assembly1.cif.gz_A-2 | crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima | 0.886 | 1 | 201 |
| 1dl3-assembly2.cif.gz_B | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.8802 | 1 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8LPI9_65_212_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.914 | 1 | 106 | 3.20.20.70 |
| 1v5xB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9074 | 2 | 201 | 3.20.20.70 |
| af_P00909_260_447_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9057 | 7 | 196 | 3.20.20.70 |
| af_P00909_260_447_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8966 | 7 | 196 | 3.20.20.70 |
| 1v5xB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8944 | 2 | 201 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838UYB3-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9794 | 2 | 200 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A7J9YSZ1-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9763 | 2 | 202 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A537YV11-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9762 | 2 | 207 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A7V9HRX4-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9734 | 2 | 205 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A2H6B764-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9699 | 1 | 206 |
GO:0000162
GO:0004640 GO:0006568 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar