F379605

General Info

Members Datasets Scaffolds Average Seq Length
274 151 548 182

Family's Representative Sequence

Representative Sequence 3300005718|Ga0068866_10334455|Ga0068866_103344552
Length 199
Sequence MVRGFSAARGHCHDGDVSTPSADVSVRVAWADDAEAIAAVQARAWATSYAALVPAAGELREADFVQLWRDALAHPADARHRALVALARNRIVGFAITTPATDPDCDPVTDGELMELTVDAGERGKGHGSRLLQAAADTLASDRFTRGVTWVLADDDVTRSFLTEAGWAADTAHRTLDLDGTGAVQVKQVRLHTALGEPT

Samples

Sample ID Description Type Environment
1 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
148 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.36
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.33
Nodule 0
Rhizoplane 16.79
Rhizosphere 65.33
Stem 0
Stem Tuber 0
Unclassified 4.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068866_10334455 3300005718 Bacteria 957
2 rootL2_10064693 3300003322 Bacteria 1635
3 rootL2_10130468 3300003322 Bacteria 1104
4 Ga0070658_10044781 3300005327 Bacteria 3577
5 Ga0070658_10045928 3300005327 Bacteria 3534
6 Ga0070683_100005477 3300005329 Bacteria 10604
7 Ga0070690_100143918 3300005330 Bacteria 1620
8 Ga0070680_100089703 3300005336 Bacteria 2544
9 Ga0070682_100244588 3300005337 Unclassified 1290
10 Ga0070682_100321584 3300005337 Bacteria 1143
11 Ga0070682_100478465 3300005337 Bacteria 960
12 Ga0068868_100398810 3300005338 Bacteria 1187
13 Ga0070660_100029776 3300005339 Bacteria 4094
14 Ga0070661_100449710 3300005344 Bacteria 1025
15 Ga0070675_100414675 3300005354 Unclassified 1203
16 Ga0070671_100357935 3300005355 Bacteria 1246
17 Ga0070659_100125746 3300005366 Bacteria 2080
18 Ga0070659_100221141 3300005366 Bacteria 1563
19 Ga0070667_100022238 3300005367 Bacteria 5261
20 Ga0070667_100280137 3300005367 Bacteria 1497
21 Ga0070667_101070370 3300005367 Unclassified 753
22 Ga0070663_100514379 3300005455 Bacteria 996
23 Ga0070679_100948822 3300005530 Bacteria 804
24 Ga0070684_100006208 3300005535 Bacteria 9222
25 Ga0070684_100173919 3300005535 Bacteria 1956
26 Ga0070684_101148895 3300005535 Bacteria 730
27 Ga0068853_100030326 3300005539 Bacteria 4567
28 Ga0070695_100645981 3300005545 Bacteria 835
29 Ga0070665_100000865 3300005548 Bacteria 39234
30 Ga0068855_100103357 3300005563 Bacteria 3278
31 Ga0068857_100303767 3300005577 Bacteria 1471
32 Ga0068856_100445851 3300005614 Bacteria 1315
33 Ga0068852_100322808 3300005616 Bacteria 1500
34 Ga0068864_101088589 3300005618 Unclassified 795
35 Ga0068870_10493399 3300005840 Bacteria 815
36 Ga0068858_100000002 3300005842 Bacteria 351633
37 Ga0068858_100053400 3300005842 Bacteria 3738
38 Ga0068860_100002948 3300005843 Bacteria 17594
39 Ga0075365_10023410 3300006038 Bacteria 3884
40 Ga0075365_10067792 3300006038 Bacteria 2396
41 Ga0075365_10110334 3300006038 Bacteria 1890
42 Ga0075365_10176982 3300006038 Bacteria 1490
43 Ga0075365_10228045 3300006038 Bacteria 1307
44 Ga0075365_10307263 3300006038 Bacteria 1116
45 Ga0075365_10380605 3300006038 Bacteria 996
46 Ga0075365_10691882 3300006038 Bacteria 720
47 Ga0075368_10012345 3300006042 Bacteria 3120
48 Ga0075363_100002353 3300006048 Bacteria 7690
49 Ga0075363_100152033 3300006048 Bacteria 1307
50 Ga0075363_100172893 3300006048 Bacteria 1227
51 Ga0075364_10013396 3300006051 Bacteria 5039
52 Ga0075364_10114255 3300006051 Bacteria 1804
53 Ga0075364_10181161 3300006051 Bacteria 1426
54 Ga0075362_10200082 3300006177 Bacteria 972
55 Ga0075367_10041008 3300006178 Bacteria 2704
56 Ga0075367_10052475 3300006178 Bacteria 2413
57 Ga0075367_10057777 3300006178 Bacteria 2307
58 Ga0075370_10008787 3300006353 Bacteria 5214
59 Ga0075370_10397447 3300006353 Bacteria 827
60 Ga0105245_10004166 3300009098 Bacteria 12841
61 Ga0105245_10444808 3300009098 Bacteria 1303
62 Ga0105245_10583326 3300009098 Bacteria 1143
63 Ga0105245_11475546 3300009098 Bacteria 731
64 Ga0105247_10267892 3300009101 Bacteria 1174
65 Ga0105243_10132836 3300009148 Bacteria 2114
66 Ga0105242_10192536 3300009176 Bacteria 1806
67 Ga0105242_10414916 3300009176 Bacteria 1260
68 Ga0105248_10043473 3300009177 Bacteria 5037
69 Ga0105238_10471485 3300009551 Bacteria 1254
70 Ga0105249_10563298 3300009553 Bacteria 1191
71 Ga0105239_10003785 3300010375 Bacteria 18414
72 Ga0105246_10003879 3300011119 Bacteria 9062
73 Ga0105246_10672744 3300011119 Bacteria 904
74 Ga0105246_10796012 3300011119 Bacteria 838
75 Ga0157371_10273628 3300013102 Unclassified 1219
76 Ga0157369_10105505 3300013105 Bacteria 3000
77 Ga0157369_10869861 3300013105 Bacteria 925
78 Ga0157374_10665488 3300013296 Bacteria 1053
79 Ga0163162_10046206 3300013306 Bacteria 4364
80 Ga0157372_10062757 3300013307 Bacteria 4164
81 Ga0157372_10433377 3300013307 Bacteria 1532
82 Ga0157372_10732465 3300013307 Bacteria 1150
83 Ga0157372_11124393 3300013307 Bacteria 908
84 Ga0157375_10414429 3300013308 Bacteria 1513
85 Ga0157375_10493796 3300013308 Bacteria 1388
86 Ga0157375_10864378 3300013308 Bacteria 1050
87 Ga0163163_10086433 3300014325 Bacteria 3145
88 Ga0163163_10088322 3300014325 Bacteria 3111
89 Ga0163163_10776275 3300014325 Bacteria 1022
90 Ga0157380_10623251 3300014326 Bacteria 1071
91 Ga0157377_10117585 3300014745 Bacteria 1607
92 Ga0157379_10054024 3300014968 Bacteria 3589
93 Ga0163161_10125188 3300017792 Bacteria 1934
94 Ga0206354_10688153 3300020081 Bacteria 728
95 Ga0213876_10212955 3300021384 Bacteria 1027
96 Ga0207688_10087568 3300025901 Bacteria 1785
97 Ga0207647_10012942 3300025904 Bacteria 5798
98 Ga0207643_10598144 3300025908 Bacteria 710
99 Ga0207705_10043065 3300025909 Bacteria 3242
100 Ga0207705_10162532 3300025909 Bacteria 1678
101 Ga0207660_10072031 3300025917 Bacteria 2516
102 Ga0207657_10116717 3300025919 Bacteria 2199
103 Ga0207652_10263242 3300025921 Bacteria 1555
104 Ga0207652_10847206 3300025921 Bacteria 810
105 Ga0207659_10587787 3300025926 Unclassified 948
106 Ga0207687_10022961 3300025927 Bacteria 4153
107 Ga0207687_10374567 3300025927 Bacteria 1165
108 Ga0207644_10808102 3300025931 Unclassified 784
109 Ga0207690_10382906 3300025932 Unclassified 1118
110 Ga0207690_10483206 3300025932 Bacteria 1000
111 Ga0207686_10144655 3300025934 Bacteria 1648
112 Ga0207686_10343051 3300025934 Bacteria 1122
113 Ga0207704_10034885 3300025938 Bacteria 2876
114 Ga0207704_11377083 3300025938 Bacteria 604
115 Ga0207667_10660586 3300025949 Unclassified 1050
116 Ga0207712_10511880 3300025961 Bacteria 1027
117 Ga0207658_10024181 3300025986 Bacteria 4248
118 Ga0207658_10230538 3300025986 Bacteria 1563
119 Ga0207658_10994240 3300025986 Unclassified 765
120 Ga0207703_10000001 3300026035 Bacteria 822925
121 Ga0207703_10092146 3300026035 Bacteria 2550
122 Ga0207639_11058508 3300026041 Bacteria 760
123 Ga0207676_10008379 3300026095 Bacteria 7348
124 Ga0207674_10009443 3300026116 Bacteria 11145
125 Ga0268266_10001168 3300028379 Bacteria 32486
126 Ga0268266_10251473 3300028379 Bacteria 1635
127 Ga0268264_10009815 3300028381 Bacteria 7923
128 Ga0268264_10491638 3300028381 Bacteria 1195
129 Ga0307413_10609678 3300031824 Bacteria 895
130 Ga0307410_11152829 3300031852 Bacteria 674
131 Ga0307415_100342755 3300032126 Bacteria 1255
132 Ga0307415_100688781 3300032126 Bacteria 921
133 Ga0373947_0580006 3300035725 Bacteria 764
134 Ga0395898_0622798 3300037466 Bacteria 1022
135 Ga0395898_0825544 3300037466 Bacteria 867
136 Ga0395905_0004534 3300037471 Bacteria 14385
137 Ga0436364_0087780 3300037853 Bacteria 1812
138 Ga0395901_0741707 3300038443 Bacteria 976
139 Ga0436365_1807217 3300039437 Bacteria 2853
140 Ga0451793_0797334 3300041452 Bacteria 592
141 Ga0466965_0044235 3300044683 Bacteria 2200
142 Ga0466966_0123822 3300044684 Bacteria 1587
143 Ga0466961_0026741 3300044693 Bacteria 3710
144 Ga0466963_0025982 3300044694 Bacteria 3741
145 Ga0466963_0129228 3300044694 Bacteria 1744
146 Ga0466963_0921843 3300044694 Bacteria 615
147 Ga0466964_0032360 3300044706 Bacteria 2078
148 Ga0466970_0017822 3300044765 Bacteria 3672
149 Ga0466970_0039666 3300044765 Bacteria 2499
150 Ga0466970_0422051 3300044765 Bacteria 763
151 Ga0466957_0155681 3300044842 Bacteria 1481
152 Ga0466957_0257165 3300044842 Bacteria 1163
153 Ga0466957_0483289 3300044842 Bacteria 857
154 Ga0466960_0033686 3300044901 Bacteria 2382
155 Ga0466959_0191139 3300045049 Bacteria 1429
156 Ga0451576_0631784 3300045051 Bacteria 1125
157 Ga0466967_0031186 3300045976 Bacteria 4484
158 Ga0466967_0042012 3300045976 Bacteria 3947
159 Ga0466967_0066294 3300045976 Bacteria 3216
160 Ga0466967_0067632 3300045976 Bacteria 3187
161 Ga0466967_0075336 3300045976 Bacteria 3033
162 Ga0466967_0106477 3300045976 Bacteria 2570
163 Ga0466967_0686050 3300045976 Bacteria 1014
164 Ga0466967_0902499 3300045976 Bacteria 879
165 Ga0495639_0016066 3300046475 Bacteria 3247
166 Ga0495658_0113679 3300046683 Bacteria 1630
167 Ga0495600_0322173 3300046809 Bacteria 972
168 Ga0495581_0068864 3300047315 Bacteria 2046
169 Ga0496101_0009135 3300048904 Bacteria 6506
170 Ga0496101_0284794 3300048904 Bacteria 1292
171 Ga0496102_0010967 3300048905 Bacteria 7809
172 Ga0496102_0031707 3300048905 Bacteria 4743
173 Ga0496102_0036573 3300048905 Bacteria 4424
174 Ga0496102_0141807 3300048905 Bacteria 2253
175 Ga0496102_0270667 3300048905 Bacteria 1602
176 Ga0496103_0117668 3300048906 Bacteria 1692
177 Ga0496103_0154972 3300048906 Bacteria 1468
178 Ga0496103_0323942 3300048906 Bacteria 991
179 Ga0496103_0399842 3300048906 Bacteria 882
180 Ga0496104_0053181 3300048907 Bacteria 3825
181 Ga0496104_0069838 3300048907 Bacteria 3339
182 Ga0496104_0131535 3300048907 Bacteria 2404
183 Ga0496104_0713188 3300048907 Bacteria 911
184 Ga0496105_0013575 3300048908 Bacteria 6470
185 Ga0496106_0076925 3300048909 Bacteria 2558
186 Ga0496107_0011728 3300048910 Bacteria 6114
187 Ga0496107_0155401 3300048910 Bacteria 1693
188 Ga0496108_0023071 3300048911 Bacteria 5119
189 Ga0496108_0168792 3300048911 Bacteria 1893
190 Ga0496108_0255735 3300048911 Bacteria 1524
191 Ga0496108_0286930 3300048911 Bacteria 1433
192 Ga0496108_0475044 3300048911 Bacteria 1092
193 Ga0496109_0011804 3300048912 Bacteria 7520
194 Ga0496109_0044123 3300048912 Bacteria 4044
195 Ga0496109_0080861 3300048912 Bacteria 2994
196 Ga0496109_0157580 3300048912 Bacteria 2127
197 Ga0496109_0171686 3300048912 Bacteria 2034
198 Ga0496109_0266122 3300048912 Bacteria 1615
199 Ga0496110_0028669 3300048913 Bacteria 4784
200 Ga0496110_0187831 3300048913 Bacteria 1876
201 Ga0496111_0226562 3300048914 Bacteria 1388
202 Ga0496112_1002819 3300048915 Bacteria 755
203 Ga0496112_1002993 3300048915 Unclassified 755
204 Ga0496113_0075303 3300048916 Bacteria 2576
205 Ga0496113_0176478 3300048916 Bacteria 1693
206 Ga0496114_0003085 3300048917 Bacteria 12765
207 Ga0496114_0048725 3300048917 Bacteria 3524
208 Ga0496114_0092346 3300048917 Bacteria 2572
209 Ga0496114_0327888 3300048917 Bacteria 1353
210 Ga0496114_0777262 3300048917 Bacteria 836
211 Ga0496115_0022401 3300048918 Bacteria 4894
212 Ga0496115_0029478 3300048918 Bacteria 4310
213 Ga0496115_0066504 3300048918 Bacteria 2913
214 Ga0496124_0088105 3300048927 Bacteria 2538
215 Ga0501032_0465738 3300049569 Bacteria 809
216 Ga0501034_0037152 3300049571 Bacteria 4932
217 Ga0501036_0563776 3300049572 Bacteria 946
218 Ga0501037_0213521 3300049573 Bacteria 1360
219 Ga0501038_0217091 3300049574 Bacteria 1528
220 Ga0501043_0248607 3300049579 Bacteria 1370
221 Ga0501047_0533569 3300049581 Bacteria 999
222 Ga0501067_0001116 3300049583 Bacteria 14530
223 Ga0501067_0001853 3300049583 Bacteria 11627
224 Ga0501068_0018044 3300049584 Bacteria 4086
225 Ga0501068_0242885 3300049584 Bacteria 1146
226 Ga0501069_0006115 3300049585 Bacteria 6283
227 Ga0501069_0018043 3300049585 Bacteria 3806
228 Ga0501070_0013917 3300049586 Bacteria 6773
229 Ga0501070_0054072 3300049586 Bacteria 3329
230 Ga0501070_0310660 3300049586 Bacteria 1283
231 Ga0501071_0102343 3300049587 Bacteria 2112
232 Ga0501072_0011045 3300049588 Bacteria 6891
233 Ga0501072_0028146 3300049588 Bacteria 4388
234 Ga0501072_0159336 3300049588 Bacteria 1800
235 Ga0501072_0321821 3300049588 Bacteria 1229
236 Ga0501073_0005484 3300049589 Bacteria 9506
237 Ga0501073_0182468 3300049589 Bacteria 1452
238 Ga0501074_0000838 3300049590 Bacteria 19549
239 Ga0501074_0005285 3300049590 Bacteria 9297
240 Ga0501074_0021357 3300049590 Bacteria 4701
241 Ga0501076_0934367 3300049592 Bacteria 715
242 Ga0501077_0010216 3300049593 Bacteria 5845
243 Ga0501079_0971105 3300049741 Bacteria 669
244 Ga0501080_0126750 3300049742 Bacteria 2364
245 Ga0501080_0170190 3300049742 Bacteria 2009
246 Ga0501083_0004571 3300049744 Bacteria 9774
247 Ga0501083_0014460 3300049744 Bacteria 5519
248 nmdc:mga03n38_10188_c1 3300050490 Bacteria 3449
249 nmdc:mga03n38_176526_c1 3300050490 Bacteria 1092
250 nmdc:mga03n38_192400_c1 3300050490 Bacteria 1051
251 nmdc:mga03n38_458653_c1 3300050490 Bacteria 710
252 nmdc:mga00v17_34196_c1 3300050491 Bacteria 3017
253 nmdc:mga00v17_36542_c1 3300050491 Bacteria 2928
254 nmdc:mga0yw44_123570_c1 3300050492 Bacteria 1669
255 nmdc:mga0yw44_211793_c1 3300050492 Bacteria 1282
256 nmdc:mga0yw44_276377_c1 3300050492 Bacteria 1122
257 nmdc:mga0yw44_30973_c1 3300050492 Bacteria 3107
258 nmdc:mga0yw44_349730_c1 3300050492 Bacteria 995
259 nmdc:mga0yw44_365729_c1 3300050492 Bacteria 973
260 nmdc:mga0yw44_442463_c1 3300050492 Bacteria 881
261 nmdc:mga0yw44_4649_c1 3300050492 Bacteria 6340
262 nmdc:mga0yw44_538665_c1 3300050492 Bacteria 793
263 nmdc:mga0yw44_655667_c1 3300050492 Bacteria 713
264 nmdc:mga06z11_1022_c1 3300050494 Bacteria 10209
265 nmdc:mga06z11_33973_c1 3300050494 Bacteria 1932
266 nmdc:mga06z11_72025_c1 3300050494 Bacteria 1831
267 Ga0495595_0160123 3300053084 Bacteria 1110
268 Ga0495619_0010703 3300053085 Bacteria 5776
269 Ga0500644_0089259 3300053088 Bacteria 1150
270 Ga0500554_033009 3300053102 Bacteria 1541
271 Ga0501084_0085014 3300054114 Bacteria 2657
272 Ga0501084_0739970 3300054114 Bacteria 829
273 Ga0501082_0031460 3300060353 Bacteria 4576
274 2857483048 2857481737 Bacteria 4761446
275 Ga0068866_10334455
276 rootL2_10064693
277 rootL2_10130468
278 Ga0070658_10044781
279 Ga0070658_10045928
280 Ga0070683_100005477
281 Ga0070690_100143918
282 Ga0070680_100089703
283 Ga0070682_100244588
284 Ga0070682_100321584
285 Ga0070682_100478465
286 Ga0068868_100398810
287 Ga0070660_100029776
288 Ga0070661_100449710
289 Ga0070675_100414675
290 Ga0070671_100357935
291 Ga0070659_100125746
292 Ga0070659_100221141
293 Ga0070667_100022238
294 Ga0070667_100280137
295 Ga0070667_101070370
296 Ga0070663_100514379
297 Ga0070679_100948822
298 Ga0070684_100006208
299 Ga0070684_100173919
300 Ga0070684_101148895
301 Ga0068853_100030326
302 Ga0070695_100645981
303 Ga0070665_100000865
304 Ga0068855_100103357
305 Ga0068857_100303767
306 Ga0068856_100445851
307 Ga0068852_100322808
308 Ga0068864_101088589
309 Ga0068870_10493399
310 Ga0068858_100000002
311 Ga0068858_100053400
312 Ga0068860_100002948
313 Ga0075365_10023410
314 Ga0075365_10067792
315 Ga0075365_10110334
316 Ga0075365_10176982
317 Ga0075365_10228045
318 Ga0075365_10307263
319 Ga0075365_10380605
320 Ga0075365_10691882
321 Ga0075368_10012345
322 Ga0075363_100002353
323 Ga0075363_100152033
324 Ga0075363_100172893
325 Ga0075364_10013396
326 Ga0075364_10114255
327 Ga0075364_10181161
328 Ga0075362_10200082
329 Ga0075367_10041008
330 Ga0075367_10052475
331 Ga0075367_10057777
332 Ga0075370_10008787
333 Ga0075370_10397447
334 Ga0105245_10004166
335 Ga0105245_10444808
336 Ga0105245_10583326
337 Ga0105245_11475546
338 Ga0105247_10267892
339 Ga0105243_10132836
340 Ga0105242_10192536
341 Ga0105242_10414916
342 Ga0105248_10043473
343 Ga0105238_10471485
344 Ga0105249_10563298
345 Ga0105239_10003785
346 Ga0105246_10003879
347 Ga0105246_10672744
348 Ga0105246_10796012
349 Ga0157371_10273628
350 Ga0157369_10105505
351 Ga0157369_10869861
352 Ga0157374_10665488
353 Ga0163162_10046206
354 Ga0157372_10062757
355 Ga0157372_10433377
356 Ga0157372_10732465
357 Ga0157372_11124393
358 Ga0157375_10414429
359 Ga0157375_10493796
360 Ga0157375_10864378
361 Ga0163163_10086433
362 Ga0163163_10088322
363 Ga0163163_10776275
364 Ga0157380_10623251
365 Ga0157377_10117585
366 Ga0157379_10054024
367 Ga0163161_10125188
368 Ga0206354_10688153
369 Ga0213876_10212955
370 Ga0207688_10087568
371 Ga0207647_10012942
372 Ga0207643_10598144
373 Ga0207705_10043065
374 Ga0207705_10162532
375 Ga0207660_10072031
376 Ga0207657_10116717
377 Ga0207652_10263242
378 Ga0207652_10847206
379 Ga0207659_10587787
380 Ga0207687_10022961
381 Ga0207687_10374567
382 Ga0207644_10808102
383 Ga0207690_10382906
384 Ga0207690_10483206
385 Ga0207686_10144655
386 Ga0207686_10343051
387 Ga0207704_10034885
388 Ga0207704_11377083
389 Ga0207667_10660586
390 Ga0207712_10511880
391 Ga0207658_10024181
392 Ga0207658_10230538
393 Ga0207658_10994240
394 Ga0207703_10000001
395 Ga0207703_10092146
396 Ga0207639_11058508
397 Ga0207676_10008379
398 Ga0207674_10009443
399 Ga0268266_10001168
400 Ga0268266_10251473
401 Ga0268264_10009815
402 Ga0268264_10491638
403 Ga0307413_10609678
404 Ga0307410_11152829
405 Ga0307415_100342755
406 Ga0307415_100688781
407 Ga0373947_0580006
408 Ga0395898_0622798
409 Ga0395898_0825544
410 Ga0395905_0004534
411 Ga0436364_0087780
412 Ga0395901_0741707
413 Ga0436365_1807217
414 Ga0451793_0797334
415 Ga0466965_0044235
416 Ga0466966_0123822
417 Ga0466961_0026741
418 Ga0466963_0025982
419 Ga0466963_0129228
420 Ga0466963_0921843
421 Ga0466964_0032360
422 Ga0466970_0017822
423 Ga0466970_0039666
424 Ga0466970_0422051
425 Ga0466957_0155681
426 Ga0466957_0257165
427 Ga0466957_0483289
428 Ga0466960_0033686
429 Ga0466959_0191139
430 Ga0451576_0631784
431 Ga0466967_0031186
432 Ga0466967_0042012
433 Ga0466967_0066294
434 Ga0466967_0067632
435 Ga0466967_0075336
436 Ga0466967_0106477
437 Ga0466967_0686050
438 Ga0466967_0902499
439 Ga0495639_0016066
440 Ga0495658_0113679
441 Ga0495600_0322173
442 Ga0495581_0068864
443 Ga0496101_0009135
444 Ga0496101_0284794
445 Ga0496102_0010967
446 Ga0496102_0031707
447 Ga0496102_0036573
448 Ga0496102_0141807
449 Ga0496102_0270667
450 Ga0496103_0117668
451 Ga0496103_0154972
452 Ga0496103_0323942
453 Ga0496103_0399842
454 Ga0496104_0053181
455 Ga0496104_0069838
456 Ga0496104_0131535
457 Ga0496104_0713188
458 Ga0496105_0013575
459 Ga0496106_0076925
460 Ga0496107_0011728
461 Ga0496107_0155401
462 Ga0496108_0023071
463 Ga0496108_0168792
464 Ga0496108_0255735
465 Ga0496108_0286930
466 Ga0496108_0475044
467 Ga0496109_0011804
468 Ga0496109_0044123
469 Ga0496109_0080861
470 Ga0496109_0157580
471 Ga0496109_0171686
472 Ga0496109_0266122
473 Ga0496110_0028669
474 Ga0496110_0187831
475 Ga0496111_0226562
476 Ga0496112_1002819
477 Ga0496112_1002993
478 Ga0496113_0075303
479 Ga0496113_0176478
480 Ga0496114_0003085
481 Ga0496114_0048725
482 Ga0496114_0092346
483 Ga0496114_0327888
484 Ga0496114_0777262
485 Ga0496115_0022401
486 Ga0496115_0029478
487 Ga0496115_0066504
488 Ga0496124_0088105
489 Ga0501032_0465738
490 Ga0501034_0037152
491 Ga0501036_0563776
492 Ga0501037_0213521
493 Ga0501038_0217091
494 Ga0501043_0248607
495 Ga0501047_0533569
496 Ga0501067_0001116
497 Ga0501067_0001853
498 Ga0501068_0018044
499 Ga0501068_0242885
500 Ga0501069_0006115
501 Ga0501069_0018043
502 Ga0501070_0013917
503 Ga0501070_0054072
504 Ga0501070_0310660
505 Ga0501071_0102343
506 Ga0501072_0011045
507 Ga0501072_0028146
508 Ga0501072_0159336
509 Ga0501072_0321821
510 Ga0501073_0005484
511 Ga0501073_0182468
512 Ga0501074_0000838
513 Ga0501074_0005285
514 Ga0501074_0021357
515 Ga0501076_0934367
516 Ga0501077_0010216
517 Ga0501079_0971105
518 Ga0501080_0126750
519 Ga0501080_0170190
520 Ga0501083_0004571
521 Ga0501083_0014460
522 nmdc:mga03n38_10188_c1
523 nmdc:mga03n38_176526_c1
524 nmdc:mga03n38_192400_c1
525 nmdc:mga03n38_458653_c1
526 nmdc:mga00v17_34196_c1
527 nmdc:mga00v17_36542_c1
528 nmdc:mga0yw44_123570_c1
529 nmdc:mga0yw44_211793_c1
530 nmdc:mga0yw44_276377_c1
531 nmdc:mga0yw44_30973_c1
532 nmdc:mga0yw44_349730_c1
533 nmdc:mga0yw44_365729_c1
534 nmdc:mga0yw44_442463_c1
535 nmdc:mga0yw44_4649_c1
536 nmdc:mga0yw44_538665_c1
537 nmdc:mga0yw44_655667_c1
538 nmdc:mga06z11_1022_c1
539 nmdc:mga06z11_33973_c1
540 nmdc:mga06z11_72025_c1
541 Ga0495595_0160123
542 Ga0495619_0010703
543 Ga0500644_0089259
544 Ga0500554_033009
545 Ga0501084_0085014
546 Ga0501084_0739970
547 Ga0501082_0031460
548 2857483048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

28

167

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wk4-assembly1.cif.gz_A crystal structure of ttk003001606 0.8879 9 181
3fnc-assembly1.cif.gz_B crystal structure of a putative acetyltransferase from listeria innocua 0.8685 7 180
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8612 64 182
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.8544 7 180
1wk4-assembly1.cif.gz_A crystal structure of ttk003001606 0.8544 9 181
ID Description Score Start End Superfamily
2cy2A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8828 9 186 3.40.630.30
2cy2A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8733 9 186 3.40.630.30
af_A4I279_315_493_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.8689 68 84 2.60.40.150
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8613 56 160 3.40.630.30
af_Q2G0G4_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8598 8 177 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2D9H6K4-F1-model_v4 GNAT family N-acetyltransferase 0.9604 33 182 GO:0016747
AF-A0A1H4D667-F1-model_v4 L-amino acid N-acyltransferase YncA 0.9317 13 180 GO:0016747
AF-A0A2D9H6K4-F1-model_v4 GNAT family N-acetyltransferase 0.9303 33 182 GO:0016747
AF-A0A2W6CPI1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9259 68 180 GO:0016747
AF-A0A538JKM2-F1-model_v4 GNAT family N-acetyltransferase 0.923 6 180 GO:0016747

Map