F379572

General Info

Members Datasets Scaffolds Average Seq Length
274 225 548 260

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100060931|Ga0070679_1000609313
Length 282
Sequence MIRKSVQRFSEKIMRQLKGGEMLDVNQIAAASRTLQSHWRAGTKLESLDAAERPKSRGEGYAIQAEIEHLSNEKLFGWKIAATSEAGQKHINVPGPMAGRILKETLIEDGGTAPMAGNEMRVAEPEFAFRMRIDLPPRPQAYSVREVLDATGTLHPAIEIPDSRFADFMHAGEAQIIADNACAHLFVLGAATPANWRALDLIEEHPVITMRAQRYVGHGKNVLGDPRVALTWLANELRRLGIPLRAGEVVTTGTCHPPLPIQSGDRMEADFGVLGKVSVGFE

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
35 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
37 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
62 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
63 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
64 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
74 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
159 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
160 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
161 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
162 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
163 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
164 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
167 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
168 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
169 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
170 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
171 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
172 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
173 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
174 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
175 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
176 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
177 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
178 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
179 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
180 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
181 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
182 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
183 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
184 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
185 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
186 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
187 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
188 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
189 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
190 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
191 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
192 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
193 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
194 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
195 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
196 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
197 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
198 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
199 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
200 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
201 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
202 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
203 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
204 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
205 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
206 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
207 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
208 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
209 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
210 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
211 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
212 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
213 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
214 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
215 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
216 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
217 2906610324
218 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
219 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
220 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
221 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
222 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
223 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
224 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
225 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.95
Metatranscriptomes 0.37
Isolates 18.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.23
Nodule 13.5
Rhizoplane 1.09
Rhizosphere 53.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100060931 3300005530 Bacteria 3761
2 JGI25153J46596_10003813 3300003215 Bacteria 8318
3 Ga0055542_1004981 3300003762 Bacteria 3087
4 Ga0065165_1018015 3300005262 Bacteria 2576
5 Ga0070658_10031291 3300005327 Bacteria 4273
6 Ga0070683_100312069 3300005329 Bacteria 1496
7 Ga0070680_100133777 3300005336 Bacteria 2076
8 Ga0070661_100412016 3300005344 Bacteria 1070
9 Ga0070668_100042269 3300005347 Bacteria 3493
10 Ga0070714_100036978 3300005435 Bacteria 4099
11 Ga0070713_100121925 3300005436 Bacteria 2288
12 Ga0070663_100114392 3300005455 Bacteria 2031
13 Ga0070681_10050692 3300005458 Bacteria 4141
14 Ga0068867_100160801 3300005459 Bacteria 1771
15 Ga0070684_100028480 3300005535 Bacteria 4726
16 Ga0070665_100246906 3300005548 Bacteria 1785
17 Ga0068857_100064139 3300005577 Bacteria 3266
18 Ga0068856_100005093 3300005614 Bacteria 12992
19 Ga0068856_100137852 3300005614 Bacteria 2446
20 Ga0068852_100036955 3300005616 Bacteria 4092
21 Ga0068860_100001450 3300005843 Bacteria 25677
22 Ga0081538_10158526 3300005981 Bacteria 1010
23 Ga0099822_1000007 3300006943 Bacteria 77453
24 Ga0075435_100022140 3300007076 Bacteria 4900
25 Ga0105240_10060313 3300009093 Bacteria 4729
26 Ga0105240_10077742 3300009093 Bacteria 4088
27 Ga0105240_10461399 3300009093 Bacteria 1419
28 Ga0105245_10109937 3300009098 Bacteria 2562
29 Ga0105241_10112712 3300009174 Bacteria 2179
30 Ga0105237_10010818 3300009545 Bacteria 9684
31 Ga0105237_10063364 3300009545 Bacteria 3694
32 Ga0105237_11025126 3300009545 Bacteria 832
33 Ga0105238_10146074 3300009551 Bacteria 2341
34 Ga0105249_10329998 3300009553 Bacteria 1539
35 Ga0105239_10184109 3300010375 Bacteria 2337
36 Ga0105239_10438223 3300010375 Bacteria 1481
37 Ga0157369_10012163 3300013105 Bacteria 9768
38 Ga0157369_10012723 3300013105 Bacteria 9543
39 Ga0206354_11030036 3300020081 Bacteria 1585
40 Ga0213875_10006926 3300021388 Bacteria 5904
41 Ga0213875_10038914 3300021388 Bacteria 2241
42 Ga0207425_1011367 3300025245 Bacteria 2128
43 Ga0209148_1000282 3300025254 Bacteria 78016
44 Ga0209233_1000774 3300025261 Bacteria 14413
45 Ga0209233_1003656 3300025261 Bacteria 5381
46 Ga0209455_1008034 3300025272 Bacteria 2912
47 Ga0209455_1009197 3300025272 Bacteria 2612
48 Ga0209564_1042411 3300025295 Bacteria 1207
49 Ga0209758_1000069 3300025297 Bacteria 286161
50 Ga0209758_1000635 3300025297 Bacteria 53736
51 Ga0209758_1004028 3300025297 Bacteria 12675
52 Ga0209758_1027951 3300025297 Bacteria 2398
53 Ga0209256_1003057 3300025299 Bacteria 12322
54 Ga0209051_1042949 3300025303 Bacteria 1592
55 Ga0209257_1000473 3300025304 Bacteria 73323
56 Ga0209257_1027288 3300025304 Bacteria 1904
57 Ga0207699_10429593 3300025906 Bacteria 945
58 Ga0207707_10109818 3300025912 Bacteria 2411
59 Ga0207695_10000107 3300025913 Bacteria 252606
60 Ga0207695_10320341 3300025913 Bacteria 1440
61 Ga0207671_10010799 3300025914 Bacteria 7492
62 Ga0207693_10036014 3300025915 Bacteria 3900
63 Ga0207660_10096914 3300025917 Bacteria 2197
64 Ga0207652_10038743 3300025921 Bacteria 4042
65 Ga0207694_10176227 3300025924 Bacteria 1733
66 Ga0207687_10049088 3300025927 Bacteria 2933
67 Ga0207700_10111110 3300025928 Bacteria 2205
68 Ga0207664_10044502 3300025929 Bacteria 3476
69 Ga0207665_10235112 3300025939 Bacteria 1348
70 Ga0207668_10202039 3300025972 Bacteria 1583
71 Ga0207640_10048345 3300025981 Bacteria 2749
72 Ga0207703_10619279 3300026035 Bacteria 1025
73 Ga0207703_10717859 3300026035 Bacteria 951
74 Ga0207702_10000559 3300026078 Bacteria 41394
75 Ga0207702_10114130 3300026078 Bacteria 2407
76 Ga0207641_10567980 3300026088 Bacteria 1108
77 Ga0207674_10072505 3300026116 Bacteria 3460
78 Ga0209389_1000071 3300027296 Bacteria 97411
79 Ga0209589_1000021 3300027357 Bacteria 186431
80 Ga0209489_100028 3300027361 Bacteria 186431
81 Ga0209489_100209 3300027361 Bacteria 96349
82 Ga0209700_100011 3300027363 Bacteria 362159
83 Ga0209700_100037 3300027363 Bacteria 186431
84 Ga0268266_10026628 3300028379 Bacteria 4920
85 Ga0268264_10000062 3300028381 Bacteria 302110
86 Ga0307511_10039998 3300030521 Bacteria 3992
87 Ga0265340_10004461 3300031247 Bacteria 7825
88 Ga0307509_10161763 3300031507 Bacteria 2134
89 Ga0307508_10084321 3300031616 Bacteria 2759
90 Ga0265314_10011497 3300031711 Bacteria 7301
91 Ga0307516_10032893 3300031730 Bacteria 5222
92 Ga0307516_10199217 3300031730 Bacteria 1723
93 Ga0307507_10145478 3300033179 Bacteria 1802
94 Ga0315911_1000008 3300033442 Bacteria 381285
95 Ga0373936_0014788 3300035113 Bacteria 2987
96 Ga0373945_0027218 3300035116 Bacteria 1996
97 Ga0373943_0001945 3300035170 Bacteria 9358
98 Ga0373946_0009231 3300035171 Bacteria 3629
99 Ga0373955_0070060 3300035172 Bacteria 1958
100 Ga0373935_0000557 3300035692 Bacteria 19409
101 Ga0373927_0003023 3300035695 Bacteria 12202
102 Ga0373933_0246241 3300035724 Bacteria 1150
103 Ga0373947_0000509 3300035725 Bacteria 22579
104 Ga0373925_0004758 3300037068 Bacteria 10224
105 Ga0373925_0004970 3300037068 Bacteria 9983
106 Ga0395900_0001984 3300037418 Bacteria 23107
107 Ga0395900_0072969 3300037418 Bacteria 3528
108 Ga0395905_0005856 3300037471 Bacteria 12492
109 Ga0395905_0177819 3300037471 Bacteria 1997
110 Ga0395905_0350499 3300037471 Bacteria 1368
111 Ga0436364_0577246 3300037853 Bacteria 1935
112 Ga0436364_0707697 3300037853 Bacteria 10282
113 Ga0436364_1438024 3300037853 Bacteria 2957
114 Ga0436364_1500232 3300037853 Bacteria 1056
115 Ga0395901_0107414 3300038443 Bacteria 2929
116 Ga0395901_0169505 3300038443 Bacteria 2291
117 Ga0395901_0426389 3300038443 Bacteria 1359
118 Ga0436365_1413028 3300039437 Bacteria 1016
119 Ga0466969_0049549 3300044656 Bacteria 2072
120 Ga0466972_0049436 3300044658 Bacteria 2031
121 Ga0466966_0127463 3300044684 Bacteria 1560
122 Ga0466971_0047447 3300044719 Bacteria 1931
123 Ga0466957_0059171 3300044842 Bacteria 2348
124 Ga0466959_0009300 3300045049 Bacteria 6983
125 Ga0466967_0109024 3300045976 Bacteria 2541
126 Ga0466967_0304394 3300045976 Bacteria 1534
127 Ga0495592_0067710 3300046454 Bacteria 2608
128 Ga0495603_0000047 3300046455 Bacteria 53081
129 Ga0495629_0000412 3300046459 Bacteria 35827
130 Ga0495641_0024233 3300046461 Bacteria 2998
131 Ga0495651_0001844 3300046462 Bacteria 16386
132 Ga0495651_0100712 3300046462 Bacteria 2151
133 Ga0495650_0149469 3300046471 Bacteria 840
134 Ga0495580_0001798 3300046472 Bacteria 18843
135 Ga0495582_0000043 3300046473 Bacteria 63647
136 Ga0495639_0000091 3300046475 Bacteria 44027
137 Ga0495662_0000128 3300046476 Bacteria 28645
138 Ga0495664_0018008 3300046477 Bacteria 4040
139 Ga0495664_0018674 3300046477 Bacteria 3977
140 Ga0495664_0036626 3300046477 Bacteria 2892
141 Ga0495594_0000710 3300046499 Bacteria 17143
142 Ga0495608_0064744 3300046511 Bacteria 2396
143 Ga0495628_0055934 3300046516 Bacteria 3107
144 Ga0495630_0000409 3300046517 Bacteria 33418
145 Ga0495643_0066401 3300046522 Bacteria 1903
146 Ga0495648_0256483 3300046524 Bacteria 841
147 Ga0495642_0149014 3300046528 Bacteria 1012
148 Ga0495652_0016312 3300046529 Bacteria 6644
149 Ga0495665_0000051 3300046531 Bacteria 46836
150 Ga0495640_0018056 3300046533 Bacteria 5243
151 Ga0495640_0031307 3300046533 Bacteria 3798
152 Ga0495587_0016155 3300046536 Bacteria 4646
153 Ga0495645_0006035 3300046543 Bacteria 8380
154 Ga0495622_0001949 3300046557 Bacteria 10132
155 Ga0495622_0031949 3300046557 Bacteria 2459
156 Ga0495667_0011016 3300046559 Bacteria 6113
157 Ga0495634_0000400 3300046642 Bacteria 42620
158 Ga0495634_0078140 3300046642 Bacteria 2169
159 Ga0495635_0000620 3300046663 Bacteria 22835
160 Ga0495635_0047375 3300046663 Bacteria 2965
161 Ga0495588_0002713 3300046674 Bacteria 7586
162 Ga0495657_0015606 3300046675 Bacteria 5551
163 Ga0495623_0021952 3300046679 Bacteria 4123
164 Ga0495646_0082354 3300046680 Bacteria 1872
165 Ga0495647_0019554 3300046681 Bacteria 2422
166 Ga0495658_0000499 3300046683 Bacteria 21574
167 Ga0495613_0001280 3300046689 Bacteria 19201
168 Ga0495624_0003551 3300046690 Bacteria 11552
169 Ga0495600_0010354 3300046809 Bacteria 5786
170 Ga0495600_0131297 3300046809 Bacteria 1628
171 Ga0495581_0003073 3300047315 Bacteria 9546
172 Ga0495604_0005813 3300047317 Bacteria 9784
173 Ga0495674_0016652 3300047319 Bacteria 6858
174 Ga0495672_0050522 3300047320 Bacteria 2453
175 Ga0495680_0000689 3300047322 Bacteria 37846
176 Ga0495675_0005931 3300047444 Bacteria 7465
177 Ga0495673_0034801 3300047469 Bacteria 2327
178 Ga0495684_0033360 3300047471 Bacteria 3949
179 Ga0495686_0131283 3300047472 Bacteria 1485
180 Ga0495593_0000222 3300047673 Bacteria 30282
181 Ga0495602_0018371 3300048088 Bacteria 6986
182 Ga0495614_0006067 3300048089 Bacteria 5431
183 Ga0496106_0003846 3300048909 Bacteria 11192
184 Ga0496109_0035253 3300048912 Bacteria 4512
185 Ga0496117_0020421 3300048920 Bacteria 5400
186 Ga0496117_0129641 3300048920 Bacteria 1531
187 Ga0496118_0001523 3300048921 Bacteria 34516
188 Ga0496118_0098709 3300048921 Bacteria 1982
189 Ga0496119_0194963 3300048922 Bacteria 1053
190 Ga0496121_0000203 3300048924 Bacteria 130984
191 Ga0496121_0096500 3300048924 Bacteria 2293
192 Ga0496121_0227153 3300048924 Bacteria 1310
193 Ga0496124_0013478 3300048927 Bacteria 7978
194 Ga0496125_0008168 3300048928 Bacteria 11019
195 Ga0496125_0099483 3300048928 Bacteria 2148
196 Ga0496126_0017204 3300048929 Bacteria 7208
197 Ga0496126_0030834 3300048929 Bacteria 5075
198 Ga0496126_0040699 3300048929 Bacteria 4307
199 Ga0501083_0201921 3300049744 Bacteria 1296
200 nmdc:mga0rr50_87816_c1 3300050513 Bacteria 2414
201 Ga0500635_0032671 3300053080 Bacteria 1693
202 Ga0495619_0018307 3300053085 Bacteria 4445
203 Ga0500647_0050410 3300053091 Bacteria 2002
204 Ga0500566_0000524 3300053094 Bacteria 21491
205 Ga0500566_0098613 3300053094 Bacteria 1605
206 Ga0500640_049290 3300053095 Bacteria 1844
207 Ga0500572_001378 3300053111 Bacteria 6707
208 Ga0500591_091929 3300053115 Bacteria 1322
209 Ga0500608_001167 3300053122 Bacteria 9352
210 Ga0500614_018032 3300053123 Bacteria 1602
211 Ga0500559_0002732 3300053136 Bacteria 8957
212 Ga0500603_000446 3300053150 Bacteria 10658
213 Ga0500630_004139 3300053159 Bacteria 7055
214 Ga0500638_015608 3300053162 Bacteria 3488
215 Ga0500638_140260 3300053162 Bacteria 1086
216 Ga0500639_001790 3300053163 Bacteria 10765
217 Ga0500636_0011956 3300053177 Bacteria 5084
218 Ga0500636_0017492 3300053177 Bacteria 4236
219 Ga0500636_0175360 3300053177 Bacteria 1156
220 Ga0500637_0148314 3300053178 Bacteria 1356
221 Ga0500576_086475 3300053725 Bacteria 1312
222 Ga0500596_000309 3300053735 Bacteria 8710
223 2513651508 2513237095 Bacteria 8976980
224 2513720298 2513237104 Bacteria 10034502
225 2513860826 2513237137 Bacteria 9558895
226 2514012492 2513237161 Bacteria 8871253
227 2517107704 2517093001 Bacteria 9002274
228 2671122454 2667528175 Bacteria 7532676
229 2793062049 2791355196 Bacteria 7323613
230 2793072936 2791355197 Bacteria 8420563
231 2818237657 2816332527 Bacteria 8933356
232 2824604577 2824600985 Bacteria 8488197
233 2824612332 2824609381 Bacteria 8672835
234 2824655197 2824653114 Bacteria 8493680
235 2824674433 2824671348 Bacteria 8369588
236 2824691069 2824687955 Bacteria 8360029
237 2824775515 2824773399 Bacteria 8360218
238 2838124520 2838122688 Bacteria 8803140
239 2841945207 2841941048 Bacteria 8688029
240 2841951988 2841949485 Bacteria 8680857
241 2841965441 2841957949 Bacteria 8652217
242 2841970616 2841966195 Bacteria 8673214
243 2841979965 2841974524 Bacteria 8931498
244 2841985145 2841983080 Bacteria 8395090
245 2842043502 2842038055 Bacteria 8002051
246 2842052508 2842045827 Bacteria 8006841
247 2844315343 2844315083 Bacteria 8138177
248 2847931080 2847930680 Bacteria 9342022
249 2874594451 2874590934 Bacteria 8299676
250 2874613429 2874612657 Bacteria 8252029
251 2874624789 2874620515 Bacteria 8290088
252 2874649824 2874645413 Bacteria 8214782
253 2876768934 2876761206 Bacteria 10111113
254 2876773943 2876771140 Bacteria 8287509
255 2876821823 2876818435 Bacteria 8274608
256 2879078333 2879074833 Bacteria 8279565
257 2879085914 2879083081 Bacteria 8587928
258 2885371021 2885366525 Bacteria 8326213
259 2885382843 2885374607 Bacteria 8927485
260 2885411655 2885409591 Bacteria 9235467
261 2888379585 2888378607 Bacteria 9652610
262 2888420299 2888419890 Bacteria 7857137
263 2889035483 2889033259 Bacteria 9099371
264 2904670256 2904666416 Bacteria 8226587
265 2906604281 2906602504 Bacteria 8295279
266 2906613881
267 2906642326 2906635258 Bacteria 8601019
268 2906648171 2906643746 Bacteria 8722424
269 2906667354 2906660503 Bacteria 8595048
270 2932794311 2932794094 Bacteria 7915132
271 3005595057 3005594810 Bacteria 8716512
272 8019652462 8019648815 Bacteria 10014479
273 8056690964 8056689827 Bacteria 6712655
274 8056971295 8056967851 Bacteria 9038162
275 Ga0070679_100060931
276 JGI25153J46596_10003813
277 Ga0055542_1004981
278 Ga0065165_1018015
279 Ga0070658_10031291
280 Ga0070683_100312069
281 Ga0070680_100133777
282 Ga0070661_100412016
283 Ga0070668_100042269
284 Ga0070714_100036978
285 Ga0070713_100121925
286 Ga0070663_100114392
287 Ga0070681_10050692
288 Ga0068867_100160801
289 Ga0070684_100028480
290 Ga0070665_100246906
291 Ga0068857_100064139
292 Ga0068856_100005093
293 Ga0068856_100137852
294 Ga0068852_100036955
295 Ga0068860_100001450
296 Ga0081538_10158526
297 Ga0099822_1000007
298 Ga0075435_100022140
299 Ga0105240_10060313
300 Ga0105240_10077742
301 Ga0105240_10461399
302 Ga0105245_10109937
303 Ga0105241_10112712
304 Ga0105237_10010818
305 Ga0105237_10063364
306 Ga0105237_11025126
307 Ga0105238_10146074
308 Ga0105249_10329998
309 Ga0105239_10184109
310 Ga0105239_10438223
311 Ga0157369_10012163
312 Ga0157369_10012723
313 Ga0206354_11030036
314 Ga0213875_10006926
315 Ga0213875_10038914
316 Ga0207425_1011367
317 Ga0209148_1000282
318 Ga0209233_1000774
319 Ga0209233_1003656
320 Ga0209455_1008034
321 Ga0209455_1009197
322 Ga0209564_1042411
323 Ga0209758_1000069
324 Ga0209758_1000635
325 Ga0209758_1004028
326 Ga0209758_1027951
327 Ga0209256_1003057
328 Ga0209051_1042949
329 Ga0209257_1000473
330 Ga0209257_1027288
331 Ga0207699_10429593
332 Ga0207707_10109818
333 Ga0207695_10000107
334 Ga0207695_10320341
335 Ga0207671_10010799
336 Ga0207693_10036014
337 Ga0207660_10096914
338 Ga0207652_10038743
339 Ga0207694_10176227
340 Ga0207687_10049088
341 Ga0207700_10111110
342 Ga0207664_10044502
343 Ga0207665_10235112
344 Ga0207668_10202039
345 Ga0207640_10048345
346 Ga0207703_10619279
347 Ga0207703_10717859
348 Ga0207702_10000559
349 Ga0207702_10114130
350 Ga0207641_10567980
351 Ga0207674_10072505
352 Ga0209389_1000071
353 Ga0209589_1000021
354 Ga0209489_100028
355 Ga0209489_100209
356 Ga0209700_100011
357 Ga0209700_100037
358 Ga0268266_10026628
359 Ga0268264_10000062
360 Ga0307511_10039998
361 Ga0265340_10004461
362 Ga0307509_10161763
363 Ga0307508_10084321
364 Ga0265314_10011497
365 Ga0307516_10032893
366 Ga0307516_10199217
367 Ga0307507_10145478
368 Ga0315911_1000008
369 Ga0373936_0014788
370 Ga0373945_0027218
371 Ga0373943_0001945
372 Ga0373946_0009231
373 Ga0373955_0070060
374 Ga0373935_0000557
375 Ga0373927_0003023
376 Ga0373933_0246241
377 Ga0373947_0000509
378 Ga0373925_0004758
379 Ga0373925_0004970
380 Ga0395900_0001984
381 Ga0395900_0072969
382 Ga0395905_0005856
383 Ga0395905_0177819
384 Ga0395905_0350499
385 Ga0436364_0577246
386 Ga0436364_0707697
387 Ga0436364_1438024
388 Ga0436364_1500232
389 Ga0395901_0107414
390 Ga0395901_0169505
391 Ga0395901_0426389
392 Ga0436365_1413028
393 Ga0466969_0049549
394 Ga0466972_0049436
395 Ga0466966_0127463
396 Ga0466971_0047447
397 Ga0466957_0059171
398 Ga0466959_0009300
399 Ga0466967_0109024
400 Ga0466967_0304394
401 Ga0495592_0067710
402 Ga0495603_0000047
403 Ga0495629_0000412
404 Ga0495641_0024233
405 Ga0495651_0001844
406 Ga0495651_0100712
407 Ga0495650_0149469
408 Ga0495580_0001798
409 Ga0495582_0000043
410 Ga0495639_0000091
411 Ga0495662_0000128
412 Ga0495664_0018008
413 Ga0495664_0018674
414 Ga0495664_0036626
415 Ga0495594_0000710
416 Ga0495608_0064744
417 Ga0495628_0055934
418 Ga0495630_0000409
419 Ga0495643_0066401
420 Ga0495648_0256483
421 Ga0495642_0149014
422 Ga0495652_0016312
423 Ga0495665_0000051
424 Ga0495640_0018056
425 Ga0495640_0031307
426 Ga0495587_0016155
427 Ga0495645_0006035
428 Ga0495622_0001949
429 Ga0495622_0031949
430 Ga0495667_0011016
431 Ga0495634_0000400
432 Ga0495634_0078140
433 Ga0495635_0000620
434 Ga0495635_0047375
435 Ga0495588_0002713
436 Ga0495657_0015606
437 Ga0495623_0021952
438 Ga0495646_0082354
439 Ga0495647_0019554
440 Ga0495658_0000499
441 Ga0495613_0001280
442 Ga0495624_0003551
443 Ga0495600_0010354
444 Ga0495600_0131297
445 Ga0495581_0003073
446 Ga0495604_0005813
447 Ga0495674_0016652
448 Ga0495672_0050522
449 Ga0495680_0000689
450 Ga0495675_0005931
451 Ga0495673_0034801
452 Ga0495684_0033360
453 Ga0495686_0131283
454 Ga0495593_0000222
455 Ga0495602_0018371
456 Ga0495614_0006067
457 Ga0496106_0003846
458 Ga0496109_0035253
459 Ga0496117_0020421
460 Ga0496117_0129641
461 Ga0496118_0001523
462 Ga0496118_0098709
463 Ga0496119_0194963
464 Ga0496121_0000203
465 Ga0496121_0096500
466 Ga0496121_0227153
467 Ga0496124_0013478
468 Ga0496125_0008168
469 Ga0496125_0099483
470 Ga0496126_0017204
471 Ga0496126_0030834
472 Ga0496126_0040699
473 Ga0501083_0201921
474 nmdc:mga0rr50_87816_c1
475 Ga0500635_0032671
476 Ga0495619_0018307
477 Ga0500647_0050410
478 Ga0500566_0000524
479 Ga0500566_0098613
480 Ga0500640_049290
481 Ga0500572_001378
482 Ga0500591_091929
483 Ga0500608_001167
484 Ga0500614_018032
485 Ga0500559_0002732
486 Ga0500603_000446
487 Ga0500630_004139
488 Ga0500638_015608
489 Ga0500638_140260
490 Ga0500639_001790
491 Ga0500636_0011956
492 Ga0500636_0017492
493 Ga0500636_0175360
494 Ga0500637_0148314
495 Ga0500576_086475
496 Ga0500596_000309
497 2513651508
498 2513720298
499 2513860826
500 2514012492
501 2517107704
502 2671122454
503 2793062049
504 2793072936
505 2818237657
506 2824604577
507 2824612332
508 2824655197
509 2824674433
510 2824691069
511 2824775515
512 2838124520
513 2841945207
514 2841951988
515 2841965441
516 2841970616
517 2841979965
518 2841985145
519 2842043502
520 2842052508
521 2844315343
522 2847931080
523 2874594451
524 2874613429
525 2874624789
526 2874649824
527 2876768934
528 2876773943
529 2876821823
530 2879078333
531 2879085914
532 2885371021
533 2885382843
534 2885411655
535 2888379585
536 2888420299
537 2889035483
538 2904670256
539 2906604281
540 2906613881
541 2906642326
542 2906648171
543 2906667354
544 2932794311
545 3005595057
546 8019652462
547 8056690964
548 8056971295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d2i-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with calcium and acetate 0.8828 1 261
5d2k-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium and 2-oxoadipate 0.8756 1 261
5d2i-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with calcium and acetate 0.8733 1 261
5d2k-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium and 2-oxoadipate 0.8725 1 261
2eb6-assembly1.cif.gz_A crystal structure of hpcg complexed with mg ion 0.8721 1 261
ID Description Score Start End Superfamily
af_I6XHH5_1_260_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8832 1 260 3.90.850.10
af_I6XHH5_1_260_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8801 1 260 3.90.850.10
5d2kB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8756 1 261 3.90.850.10
5d2kB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8725 1 261 3.90.850.10
2wqtB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8718 1 261 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A5C9CGW4-F1-model_v4 Putative hydratase 0.9836 3 261 GO:0005737
GO:0008684
AF-A0A424HJP1-F1-model_v4 Hydratase 0.978 3 261 GO:0005737
GO:0008684
AF-A0A4P8HBT1-F1-model_v4 Hydratase 0.9741 2 261 GO:0005737
GO:0008684
AF-A0A3D1GU80-F1-model_v4 Hydratase 0.9738 3 261 GO:0005737
GO:0008684
AF-A0A2E3KBT9-F1-model_v4 ABC transporter permease 0.9736 9 261 GO:0005737
GO:0008684

Map