F379562

General Info

Members Datasets Scaffolds Average Seq Length
274 169 272 259

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100015657|Ga0070663_1000156573
Length 292
Sequence MSAVINFRAVFIRQIQPLEHSNSNAGRKKAGASMDYQLQGKFAFINAGAHGIGEAIADLLTAEGASVIVADRDAAALDEKGHRWAGVVAADTATAEGVEHATSHALAVFGRAPDILINNLGVGTAAAFEELSDEDWARSIEINFMSCVRTCRTLVPRMAELGSASVVNMGSDLAKQPEPTLMDYGACKAALLYLTKAMATQYAPRVRINAVLPGPIWTRMWTRPGGIVDQLVASYGVDRDAAVKRFLEDRHMPLGIGEPKDVANAVVFLASPLAKFITGSSLDIGGTLRGLV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
3 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.92
Nodule 0.73
Rhizoplane 1.82
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10223444 2162886012 Bacteria 906
2 MBSR1b_contig_13078053 2162886012 Unclassified 1139
3 Ga0065712_10075080 3300005290 Bacteria 3940
4 Ga0065712_10079481 3300005290 Bacteria 3212
5 Ga0065715_10101404 3300005293 Bacteria 3182
6 Ga0065715_10192972 3300005293 Bacteria 1404
7 Ga0065707_10086054 3300005295 Bacteria 5694
8 Ga0065707_10158965 3300005295 Unclassified 1582
9 Ga0065707_10185062 3300005295 Bacteria 1394
10 Ga0070658_10120410 3300005327 Bacteria 2181
11 Ga0070658_10268503 3300005327 Unclassified 1450
12 Ga0070683_100022136 3300005329 Bacteria 5678
13 Ga0070670_100014713 3300005331 Bacteria 6718
14 Ga0068869_100074097 3300005334 Unclassified 2526
15 Ga0070680_100019666 3300005336 Bacteria 5356
16 Ga0068868_100036157 3300005338 Bacteria 3821
17 Ga0070660_100040358 3300005339 Bacteria 3551
18 Ga0070660_100267398 3300005339 Unclassified 1397
19 Ga0070692_10193211 3300005345 Unclassified 1187
20 Ga0070671_100147357 3300005355 Bacteria 1987
21 Ga0070671_100270598 3300005355 Bacteria 1444
22 Ga0070674_100039014 3300005356 Bacteria 3205
23 Ga0070674_100300576 3300005356 Bacteria 1279
24 Ga0070674_100568040 3300005356 Unclassified 954
25 Ga0070673_100002123 3300005364 Bacteria 12002
26 Ga0070659_100048249 3300005366 Bacteria 3344
27 Ga0070667_100072017 3300005367 Bacteria 2944
28 Ga0070713_100345872 3300005436 Unclassified 1379
29 Ga0070713_100478856 3300005436 Unclassified 1172
30 Ga0070711_100014615 3300005439 Unclassified 4948
31 Ga0070694_100019670 3300005444 Bacteria 4297
32 Ga0070663_100015657 3300005455 Bacteria 4903
33 Ga0070663_100082478 3300005455 Unclassified 2365
34 Ga0070663_100213770 3300005455 Bacteria 1511
35 Ga0070678_100111924 3300005456 Bacteria 2137
36 Ga0070662_100218347 3300005457 Bacteria 1520
37 Ga0070681_10239689 3300005458 Bacteria 1727
38 Ga0070681_10807647 3300005458 Unclassified 855
39 Ga0068867_100574737 3300005459 Bacteria 979
40 Ga0070685_10025616 3300005466 Bacteria 3247
41 Ga0070706_100093490 3300005467 Unclassified 2790
42 Ga0070699_100185110 3300005518 Bacteria 1849
43 Ga0070679_100064143 3300005530 Bacteria 3661
44 Ga0070679_100178822 3300005530 Bacteria 2094
45 Ga0070684_100055664 3300005535 Bacteria 3449
46 Ga0070684_100665892 3300005535 Bacteria 969
47 Ga0068853_100036714 3300005539 Bacteria 4168
48 Ga0068853_100076801 3300005539 Bacteria 2917
49 Ga0070672_100313154 3300005543 Bacteria 1333
50 Ga0070695_100059191 3300005545 Unclassified 2479
51 Ga0070665_100097452 3300005548 Unclassified 2946
52 Ga0070665_100254695 3300005548 Bacteria 1756
53 Ga0070704_100010688 3300005549 Bacteria 5591
54 Ga0068855_100108699 3300005563 Bacteria 3185
55 Ga0068855_100209625 3300005563 Unclassified 2190
56 Ga0068855_100248438 3300005563 Bacteria 1985
57 Ga0068857_100147239 3300005577 Bacteria 2131
58 Ga0068856_100016579 3300005614 Bacteria 7132
59 Ga0068852_100234876 3300005616 Bacteria 1750
60 Ga0068859_100005858 3300005617 Bacteria 12471
61 Ga0068859_100068362 3300005617 Bacteria 3587
62 Ga0068859_100158879 3300005617 Unclassified 2339
63 Ga0068860_100057001 3300005843 Bacteria 3713
64 Ga0068860_100161874 3300005843 Bacteria 2158
65 Ga0068860_100561498 3300005843 Bacteria 1144
66 Ga0068862_100038138 3300005844 Unclassified 4075
67 Ga0081539_10008532 3300005985 Bacteria 8884
68 Ga0081539_10186275 3300005985 Bacteria 970
69 Ga0070717_10091116 3300006028 Bacteria 2574
70 Ga0070712_100001501 3300006175 Bacteria 14243
71 Ga0075367_10073565 3300006178 Unclassified 2059
72 Ga0075367_10074487 3300006178 Bacteria 2047
73 Ga0075366_10032499 3300006195 Bacteria 3071
74 Ga0075370_10185805 3300006353 Unclassified 1224
75 Ga0075428_100000030 3300006844 Bacteria 119551
76 Ga0075428_100003218 3300006844 Bacteria 17867
77 Ga0075428_100003847 3300006844 Bacteria 16483
78 Ga0075430_100005753 3300006846 Bacteria 10461
79 Ga0075430_100034731 3300006846 Bacteria 4280
80 Ga0075431_100015919 3300006847 Bacteria 7629
81 Ga0075431_100018339 3300006847 Bacteria 7125
82 Ga0075431_100137194 3300006847 Bacteria 2522
83 Ga0075431_100299546 3300006847 Bacteria 1624
84 Ga0075431_100564743 3300006847 Bacteria 1124
85 Ga0075433_10016728 3300006852 Bacteria 6055
86 Ga0075433_10054141 3300006852 Unclassified 3500
87 Ga0075434_100033949 3300006871 Bacteria 5036
88 Ga0075429_100001278 3300006880 Bacteria 20473
89 Ga0075429_100008235 3300006880 Bacteria 9064
90 Ga0068865_100271618 3300006881 Unclassified 1346
91 Ga0097620_100005858 3300006931 Bacteria 12471
92 Ga0097620_100068364 3300006931 Bacteria 3587
93 Ga0097620_100158875 3300006931 Unclassified 2339
94 Ga0075435_100006233 3300007076 Bacteria 8420
95 Ga0105240_10076686 3300009093 Bacteria 4121
96 Ga0111539_10000015 3300009094 Bacteria 296576
97 Ga0111539_10000530 3300009094 Bacteria 48418
98 Ga0111539_10083397 3300009094 Bacteria 3759
99 Ga0111539_10754212 3300009094 Bacteria 1133
100 Ga0114129_10000204 3300009147 Bacteria 65893
101 Ga0114129_10002702 3300009147 Bacteria 24700
102 Ga0114129_10020594 3300009147 Bacteria 9379
103 Ga0114129_10088400 3300009147 Bacteria 4295
104 Ga0114129_10195213 3300009147 Bacteria 2745
105 Ga0114129_10294419 3300009147 Bacteria 2165
106 Ga0114129_10746955 3300009147 Bacteria 1253
107 Ga0105243_10241693 3300009148 Bacteria 1607
108 Ga0105243_10261110 3300009148 Unclassified 1551
109 Ga0105243_10676068 3300009148 Unclassified 1003
110 Ga0105248_10104447 3300009177 Bacteria 3194
111 Ga0105237_10047075 3300009545 Bacteria 4336
112 Ga0105238_10019898 3300009551 Bacteria 6832
113 Ga0105249_10100280 3300009553 Unclassified 2723
114 Ga0105249_10156649 3300009553 Bacteria 2197
115 Ga0157371_10020009 3300013102 Bacteria 4928
116 Ga0157371_10045078 3300013102 Unclassified 3139
117 Ga0157370_10009751 3300013104 Bacteria 10196
118 Ga0157370_10025468 3300013104 Bacteria 5857
119 Ga0157369_10005300 3300013105 Bacteria 15027
120 Ga0157369_10012682 3300013105 Bacteria 9558
121 Ga0157369_10039420 3300013105 Bacteria 5163
122 Ga0157369_10082717 3300013105 Bacteria 3435
123 Ga0157374_10003283 3300013296 Bacteria 13586
124 Ga0157374_10041014 3300013296 Unclassified 4263
125 Ga0157374_10570717 3300013296 Unclassified 1140
126 Ga0157372_10017778 3300013307 Bacteria 7633
127 Ga0157372_10040191 3300013307 Bacteria 5165
128 Ga0157372_10211383 3300013307 Bacteria 2248
129 Ga0163163_10150718 3300014325 Bacteria 2369
130 Ga0163163_11171104 3300014325 Unclassified 831
131 Ga0157380_10059000 3300014326 Bacteria 3061
132 Ga0157380_10312909 3300014326 Bacteria 1452
133 Ga0157380_10632340 3300014326 Bacteria 1064
134 Ga0157376_10253377 3300014969 Bacteria 1645
135 Ga0157376_10580566 3300014969 Unclassified 1113
136 Ga0207673_1003917 3300025290 Unclassified 1758
137 Ga0207697_10000943 3300025315 Bacteria 16396
138 Ga0207688_10012361 3300025901 Bacteria 4645
139 Ga0207647_10017524 3300025904 Unclassified 4868
140 Ga0207643_10173201 3300025908 Unclassified 1303
141 Ga0207705_10000619 3300025909 Bacteria 29672
142 Ga0207684_10085437 3300025910 Unclassified 2688
143 Ga0207707_10171444 3300025912 Unclassified 1896
144 Ga0207707_10233285 3300025912 Bacteria 1601
145 Ga0207693_10005520 3300025915 Bacteria 10526
146 Ga0207663_10004240 3300025916 Bacteria 7111
147 Ga0207657_10013459 3300025919 Bacteria 8026
148 Ga0207657_10097081 3300025919 Bacteria 2450
149 Ga0207649_10405196 3300025920 Unclassified 1021
150 Ga0207652_10012505 3300025921 Bacteria 6859
151 Ga0207646_10212664 3300025922 Unclassified 1746
152 Ga0207694_10028666 3300025924 Unclassified 4245
153 Ga0207650_10084882 3300025925 Bacteria 2408
154 Ga0207659_10091400 3300025926 Bacteria 2274
155 Ga0207700_10312173 3300025928 Unclassified 1360
156 Ga0207690_10115423 3300025932 Bacteria 1941
157 Ga0207706_10152799 3300025933 Bacteria 2030
158 Ga0207709_10325583 3300025935 Bacteria 1152
159 Ga0207709_10334041 3300025935 Unclassified 1138
160 Ga0207669_10076823 3300025937 Bacteria 2121
161 Ga0207669_10134186 3300025937 Bacteria 1707
162 Ga0207669_10301634 3300025937 Bacteria 1218
163 Ga0207669_10379647 3300025937 Unclassified 1101
164 Ga0207669_10550811 3300025937 Bacteria 931
165 Ga0207704_10132799 3300025938 Bacteria 1727
166 Ga0207691_10110002 3300025940 Bacteria 2451
167 Ga0207689_10107728 3300025942 Bacteria 2290
168 Ga0207661_10052593 3300025944 Bacteria 3254
169 Ga0207661_10058346 3300025944 Unclassified 3106
170 Ga0207667_10044145 3300025949 Bacteria 4725
171 Ga0207667_10054426 3300025949 Bacteria 4209
172 Ga0207667_10087971 3300025949 Bacteria 3213
173 Ga0207651_10007669 3300025960 Bacteria 5763
174 Ga0207712_10052192 3300025961 Unclassified 2863
175 Ga0207658_10031534 3300025986 Bacteria 3765
176 Ga0207677_10075443 3300026023 Bacteria 2396
177 Ga0207639_10067416 3300026041 Bacteria 2785
178 Ga0207678_10001594 3300026067 Bacteria 20861
179 Ga0207678_10007772 3300026067 Bacteria 9474
180 Ga0207702_10012139 3300026078 Bacteria 7166
181 Ga0207676_10176709 3300026095 Bacteria 1866
182 Ga0207674_10017530 3300026116 Bacteria 7812
183 Ga0207675_100070663 3300026118 Unclassified 3263
184 Ga0207683_10101559 3300026121 Bacteria 2568
185 Ga0207428_10000048 3300027907 Bacteria 180760
186 Ga0207428_10004136 3300027907 Bacteria 13912
187 Ga0268266_10322525 3300028379 Bacteria 1446
188 Ga0268266_10485548 3300028379 Bacteria 1178
189 Ga0268266_10804096 3300028379 Bacteria 908
190 Ga0268265_10055072 3300028380 Unclassified 3021
191 Ga0268264_10161887 3300028381 Bacteria 2017
192 Ga0265319_1039044 3300028563 Bacteria 1611
193 Ga0265338_10022724 3300028800 Bacteria 6478
194 Ga0265325_10007982 3300031241 Bacteria 6280
195 Ga0265325_10206967 3300031241 Unclassified 902
196 Ga0265329_10053483 3300031242 Bacteria 1283
197 Ga0265316_10010144 3300031344 Bacteria 8602
198 Ga0307408_100006290 3300031548 Bacteria 7882
199 Ga0307405_10052556 3300031731 Bacteria 2534
200 Ga0307416_100733702 3300032002 Bacteria 1079
201 Ga0451853_2250096 3300041512 Bacteria 1160
202 Ga0439450_031858 3300042008 Bacteria 1188
203 Ga0439435_0017157 3300042436 Bacteria 1826
204 Ga0439464_0002665 3300042439 Bacteria 4423
205 Ga0495603_0271742 3300046455 Bacteria 975
206 Ga0495636_0032604 3300047318 Bacteria 2138
207 Ga0496101_0345455 3300048904 Unclassified 1169
208 Ga0496108_0321909 3300048911 Unclassified 1348
209 Ga0496109_0094128 3300048912 Bacteria 2773
210 Ga0496112_0014903 3300048915 Bacteria 7235
211 Ga0496115_0214591 3300048918 Bacteria 1589
212 Ga0501291_031361 3300049514 Bacteria 898
213 Ga0501031_0338780 3300049568 Bacteria 974
214 Ga0501033_0014567 3300049570 Bacteria 5969
215 Ga0501033_0137301 3300049570 Unclassified 1769
216 Ga0501036_0173168 3300049572 Bacteria 1818
217 Ga0501038_0014005 3300049574 Bacteria 7309
218 Ga0501038_0053982 3300049574 Bacteria 3457
219 Ga0501040_0427301 3300049576 Bacteria 952
220 Ga0501043_0128285 3300049579 Bacteria 1988
221 Ga0501046_0435846 3300049580 Unclassified 943
222 Ga0501047_0125173 3300049581 Unclassified 2451
223 Ga0501048_0318857 3300049582 Bacteria 1107
224 Ga0501070_0249782 3300049586 Bacteria 1451
225 Ga0501071_0330445 3300049587 Bacteria 1159
226 Ga0501071_0435050 3300049587 Bacteria 1003
227 Ga0501072_0371154 3300049588 Bacteria 1136
228 Ga0501072_0404273 3300049588 Bacteria 1083
229 Ga0501072_0502963 3300049588 Unclassified 958
230 Ga0501073_0148846 3300049589 Bacteria 1622
231 Ga0501074_0271665 3300049590 Bacteria 1205
232 Ga0501075_0021693 3300049591 Unclassified 4685
233 Ga0501076_0046834 3300049592 Bacteria 3417
234 Ga0501080_0085413 3300049742 Bacteria 2932
235 Ga0501080_0427664 3300049742 Bacteria 1189
236 Ga0501044_0160928 3300049823 Bacteria 2222
237 Ga0501044_0284380 3300049823 Bacteria 1586
238 Ga0501045_0033904 3300049824 Bacteria 3704
239 nmdc:mga0k408_100586_c1 3300050493 Bacteria 1704
240 nmdc:mga0k408_38282_c1 3300050493 Bacteria 2752
241 nmdc:mga06z11_9159_c1 3300050494 Bacteria 4161
242 nmdc:mga05p37_350006_c1 3300050507 Bacteria 1740
243 nmdc:mga05p37_382_c1 3300050507 Bacteria 47795
244 nmdc:mga05p37_42707_c1 3300050507 Bacteria 5573
245 nmdc:mga05p37_64332_c1 3300050507 Bacteria 4514
246 nmdc:mga05p37_85720_c1 3300050507 Bacteria 3882
247 nmdc:mga09592_12628_c1 3300050508 Bacteria 6886
248 nmdc:mga09592_6583_c1 3300050508 Bacteria 9462
249 nmdc:mga09592_95755_c1 3300050508 Bacteria 2539
250 nmdc:mga0qj67_4210_c1 3300050509 Bacteria 10422
251 nmdc:mga0qj67_44262_c1 3300050509 Bacteria 3507
252 nmdc:mga06r32_1110_c1 3300050510 Bacteria 24142
253 nmdc:mga06r32_123776_c1 3300050510 Bacteria 2552
254 nmdc:mga06r32_164490_c1 3300050510 Bacteria 2201
255 nmdc:mga06r32_21203_c1 3300050510 Bacteria 5997
256 nmdc:mga06r32_273500_c1 3300050510 Bacteria 1677
257 nmdc:mga06r32_58728_c1 3300050510 Bacteria 3697
258 nmdc:mga08y16_108873_c1 3300050511 Bacteria 2885
259 nmdc:mga08y16_139175_c1 3300050511 Unclassified 2523
260 nmdc:mga08y16_186018_c1 3300050511 Bacteria 2155
261 nmdc:mga08y16_409715_c1 3300050511 Bacteria 1386
262 nmdc:mga08y16_5292_c1 3300050511 Bacteria 13496
263 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
264 nmdc:mga0n895_288589_c1 3300050512 Bacteria 1664
265 nmdc:mga0rr50_170840_c1 3300050513 Bacteria 1771
266 nmdc:mga0rr50_4764_c1 3300050513 Bacteria 8005
267 nmdc:mga0a205_18236_c1 3300050515 Bacteria 6594
268 nmdc:mga0a205_6356_c1 3300050515 Bacteria 10672
269 nmdc:mga0a205_68643_c1 3300050515 Bacteria 3423
270 Ga0500568_0000827 3300053139 Bacteria 21776
271 Ga0501084_0050481 3300054114 Bacteria 3482
272 Ga0501082_0154058 3300060353 Bacteria 1997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100254695 Ga0070665_1002546952 239
2 3300028379 Ga0268266_10485548 Ga0268266_104855481 239
3 3300049568 Ga0501031_0338780 Ga0501031_0338780_159_938 241
4 3300053139 Ga0500568_0000827 Ga0500568_0000827_13808_14587 244
5 iso_pu_bacteria 2728368998 2728748165 244
6 iso_pu_bacteria 2903748898 2903749712 244
7 3300006852 Ga0075433_10054141 Ga0075433_100541412 248
8 3300050515 nmdc:mga0a205_68643_c1 nmdc:mga0a205_68643_c1_890_1669 248
9 3300005617 Ga0068859_100158879 Ga0068859_1001588794 250
10 3300006931 Ga0097620_100158875 Ga0097620_1001588754 250
11 3300013307 Ga0157372_10211383 Ga0157372_102113832 250
12 3300006844 Ga0075428_100000030 Ga0075428_10000003099 258
13 3300006847 Ga0075431_100137194 Ga0075431_1001371942 258
14 3300006847 Ga0075431_100564743 Ga0075431_1005647432 258
15 3300009094 Ga0111539_10000015 Ga0111539_1000001542 258
16 3300025937 Ga0207669_10301634 Ga0207669_103016342 258
17 3300027907 Ga0207428_10000048 Ga0207428_1000004842 258
18 3300049570 Ga0501033_0137301 Ga0501033_0137301_607_1383 258
19 3300049574 Ga0501038_0053982 Ga0501038_0053982_1882_2658 258
20 3300049581 Ga0501047_0125173 Ga0501047_0125173_1145_1921 258
21 3300049742 Ga0501080_0427664 Ga0501080_0427664_352_1128 258
22 3300049823 Ga0501044_0160928 Ga0501044_0160928_1039_1815 258
23 3300050510 nmdc:mga06r32_164490_c1 nmdc:mga06r32_164490_c1_1087_1863 258
24 3300050511 nmdc:mga08y16_8_c1 nmdc:mga08y16_8_c1_506901_507677 258
25 2162886012 MBSR1b_contig_10223444 MBSR1b_0760.00000800 259
26 2162886012 MBSR1b_contig_13078053 MBSR1b_0029.00006160 259
27 3300005290 Ga0065712_10075080 Ga0065712_100750802 259
28 3300005290 Ga0065712_10079481 Ga0065712_100794813 259
29 3300005293 Ga0065715_10101404 Ga0065715_101014043 259
30 3300005293 Ga0065715_10192972 Ga0065715_101929721 259
31 3300005295 Ga0065707_10086054 Ga0065707_100860546 259
32 3300005295 Ga0065707_10158965 Ga0065707_101589652 259
33 3300005295 Ga0065707_10185062 Ga0065707_101850622 259
34 3300005327 Ga0070658_10120410 Ga0070658_101204102 259
35 3300005327 Ga0070658_10268503 Ga0070658_102685031 259
36 3300005329 Ga0070683_100022136 Ga0070683_1000221364 259
37 3300005331 Ga0070670_100014713 Ga0070670_1000147132 259
38 3300005334 Ga0068869_100074097 Ga0068869_1000740972 259
39 3300005336 Ga0070680_100019666 Ga0070680_1000196663 259
40 3300005338 Ga0068868_100036157 Ga0068868_1000361573 259
41 3300005339 Ga0070660_100040358 Ga0070660_1000403584 259
42 3300005339 Ga0070660_100267398 Ga0070660_1002673982 259
43 3300005345 Ga0070692_10193211 Ga0070692_101932112 259
44 3300005355 Ga0070671_100147357 Ga0070671_1001473571 259
45 3300005355 Ga0070671_100270598 Ga0070671_1002705982 259
46 3300005356 Ga0070674_100039014 Ga0070674_1000390143 259
47 3300005356 Ga0070674_100300576 Ga0070674_1003005762 259
48 3300005356 Ga0070674_100568040 Ga0070674_1005680401 259
49 3300005364 Ga0070673_100002123 Ga0070673_10000212312 259
50 3300005366 Ga0070659_100048249 Ga0070659_1000482494 259
51 3300005367 Ga0070667_100072017 Ga0070667_1000720172 259
52 3300005436 Ga0070713_100345872 Ga0070713_1003458722 259
53 3300005436 Ga0070713_100478856 Ga0070713_1004788561 259
54 3300005439 Ga0070711_100014615 Ga0070711_1000146153 259
55 3300005444 Ga0070694_100019670 Ga0070694_1000196703 259
56 3300005455 Ga0070663_100015657 Ga0070663_1000156573 259
57 3300005455 Ga0070663_100082478 Ga0070663_1000824782 259
58 3300005455 Ga0070663_100213770 Ga0070663_1002137701 259
59 3300005456 Ga0070678_100111924 Ga0070678_1001119242 259
60 3300005457 Ga0070662_100218347 Ga0070662_1002183472 259
61 3300005458 Ga0070681_10239689 Ga0070681_102396892 259
62 3300005458 Ga0070681_10807647 Ga0070681_108076471 259
63 3300005459 Ga0068867_100574737 Ga0068867_1005747371 259
64 3300005466 Ga0070685_10025616 Ga0070685_100256165 259
65 3300005467 Ga0070706_100093490 Ga0070706_1000934902 259
66 3300005518 Ga0070699_100185110 Ga0070699_1001851102 259
67 3300005530 Ga0070679_100064143 Ga0070679_1000641433 259
68 3300005530 Ga0070679_100178822 Ga0070679_1001788222 259
69 3300005535 Ga0070684_100055664 Ga0070684_1000556642 259
70 3300005535 Ga0070684_100665892 Ga0070684_1006658921 259
71 3300005539 Ga0068853_100036714 Ga0068853_1000367142 259
72 3300005539 Ga0068853_100076801 Ga0068853_1000768013 259
73 3300005543 Ga0070672_100313154 Ga0070672_1003131542 259
74 3300005545 Ga0070695_100059191 Ga0070695_1000591913 259
75 3300005548 Ga0070665_100097452 Ga0070665_1000974523 259
76 3300005549 Ga0070704_100010688 Ga0070704_1000106885 259
77 3300005563 Ga0068855_100108699 Ga0068855_1001086993 259
78 3300005563 Ga0068855_100209625 Ga0068855_1002096252 259
79 3300005563 Ga0068855_100248438 Ga0068855_1002484382 259
80 3300005577 Ga0068857_100147239 Ga0068857_1001472392 259
81 3300005614 Ga0068856_100016579 Ga0068856_1000165792 259
82 3300005616 Ga0068852_100234876 Ga0068852_1002348762 259
83 3300005617 Ga0068859_100005858 Ga0068859_1000058586 259
84 3300005617 Ga0068859_100068362 Ga0068859_1000683623 259
85 3300005843 Ga0068860_100057001 Ga0068860_1000570013 259
86 3300005843 Ga0068860_100161874 Ga0068860_1001618741 259
87 3300005843 Ga0068860_100561498 Ga0068860_1005614981 259
88 3300005844 Ga0068862_100038138 Ga0068862_1000381384 259
89 3300005985 Ga0081539_10008532 Ga0081539_100085323 259
90 3300005985 Ga0081539_10186275 Ga0081539_101862752 259
91 3300006028 Ga0070717_10091116 Ga0070717_100911162 259
92 3300006175 Ga0070712_100001501 Ga0070712_10000150112 259
93 3300006178 Ga0075367_10073565 Ga0075367_100735653 259
94 3300006178 Ga0075367_10074487 Ga0075367_100744872 259
95 3300006195 Ga0075366_10032499 Ga0075366_100324991 259
96 3300006353 Ga0075370_10185805 Ga0075370_101858051 259
97 3300006844 Ga0075428_100003218 Ga0075428_1000032183 259
98 3300006844 Ga0075428_100003847 Ga0075428_1000038474 259
99 3300006846 Ga0075430_100005753 Ga0075430_1000057533 259
100 3300006846 Ga0075430_100034731 Ga0075430_1000347314 259
101 3300006847 Ga0075431_100015919 Ga0075431_1000159193 259
102 3300006847 Ga0075431_100018339 Ga0075431_1000183394 259
103 3300006847 Ga0075431_100299546 Ga0075431_1002995461 259
104 3300006852 Ga0075433_10016728 Ga0075433_100167285 259
105 3300006871 Ga0075434_100033949 Ga0075434_1000339494 259
106 3300006880 Ga0075429_100001278 Ga0075429_1000012788 259
107 3300006880 Ga0075429_100008235 Ga0075429_1000082355 259
108 3300006881 Ga0068865_100271618 Ga0068865_1002716181 259
109 3300006931 Ga0097620_100005858 Ga0097620_1000058586 259
110 3300006931 Ga0097620_100068364 Ga0097620_1000683643 259
111 3300007076 Ga0075435_100006233 Ga0075435_1000062334 259
112 3300009093 Ga0105240_10076686 Ga0105240_100766864 259
113 3300009094 Ga0111539_10000530 Ga0111539_1000053036 259
114 3300009094 Ga0111539_10083397 Ga0111539_100833972 259
115 3300009094 Ga0111539_10754212 Ga0111539_107542121 259
116 3300009147 Ga0114129_10000204 Ga0114129_1000020457 259
117 3300009147 Ga0114129_10002702 Ga0114129_100027028 259
118 3300009147 Ga0114129_10020594 Ga0114129_100205946 259
119 3300009147 Ga0114129_10088400 Ga0114129_100884004 259
120 3300009147 Ga0114129_10195213 Ga0114129_101952133 259
121 3300009147 Ga0114129_10294419 Ga0114129_102944191 259
122 3300009147 Ga0114129_10746955 Ga0114129_107469551 259
123 3300009148 Ga0105243_10241693 Ga0105243_102416932 259
124 3300009148 Ga0105243_10261110 Ga0105243_102611102 259
125 3300009148 Ga0105243_10676068 Ga0105243_106760681 259
126 3300009177 Ga0105248_10104447 Ga0105248_101044472 259
127 3300009545 Ga0105237_10047075 Ga0105237_100470754 259
128 3300009551 Ga0105238_10019898 Ga0105238_100198983 259
129 3300009553 Ga0105249_10100280 Ga0105249_101002802 259
130 3300009553 Ga0105249_10156649 Ga0105249_101566492 259
131 3300013102 Ga0157371_10020009 Ga0157371_100200093 259
132 3300013102 Ga0157371_10045078 Ga0157371_100450782 259
133 3300013104 Ga0157370_10009751 Ga0157370_100097513 259
134 3300013104 Ga0157370_10025468 Ga0157370_100254684 259
135 3300013105 Ga0157369_10005300 Ga0157369_100053005 259
136 3300013105 Ga0157369_10012682 Ga0157369_100126826 259
137 3300013105 Ga0157369_10039420 Ga0157369_100394203 259
138 3300013105 Ga0157369_10082717 Ga0157369_100827172 259
139 3300013296 Ga0157374_10003283 Ga0157374_100032835 259
140 3300013296 Ga0157374_10041014 Ga0157374_100410142 259
141 3300013296 Ga0157374_10570717 Ga0157374_105707172 259
142 3300013307 Ga0157372_10017778 Ga0157372_100177784 259
143 3300013307 Ga0157372_10040191 Ga0157372_100401913 259
144 3300014325 Ga0163163_10150718 Ga0163163_101507182 259
145 3300014325 Ga0163163_11171104 Ga0163163_111711041 259
146 3300014326 Ga0157380_10059000 Ga0157380_100590003 259
147 3300014326 Ga0157380_10312909 Ga0157380_103129092 259
148 3300014326 Ga0157380_10632340 Ga0157380_106323401 259
149 3300014969 Ga0157376_10253377 Ga0157376_102533772 259
150 3300014969 Ga0157376_10580566 Ga0157376_105805661 259
151 3300025290 Ga0207673_1003917 Ga0207673_10039172 259
152 3300025315 Ga0207697_10000943 Ga0207697_100009433 259
153 3300025901 Ga0207688_10012361 Ga0207688_100123613 259
154 3300025904 Ga0207647_10017524 Ga0207647_100175244 259
155 3300025908 Ga0207643_10173201 Ga0207643_101732012 259
156 3300025909 Ga0207705_10000619 Ga0207705_1000061920 259
157 3300025910 Ga0207684_10085437 Ga0207684_100854373 259
158 3300025912 Ga0207707_10171444 Ga0207707_101714442 259
159 3300025912 Ga0207707_10233285 Ga0207707_102332852 259
160 3300025915 Ga0207693_10005520 Ga0207693_100055201 259
161 3300025916 Ga0207663_10004240 Ga0207663_100042405 259
162 3300025919 Ga0207657_10013459 Ga0207657_100134594 259
163 3300025919 Ga0207657_10097081 Ga0207657_100970813 259
164 3300025920 Ga0207649_10405196 Ga0207649_104051961 259
165 3300025921 Ga0207652_10012505 Ga0207652_100125054 259
166 3300025922 Ga0207646_10212664 Ga0207646_102126642 259
167 3300025924 Ga0207694_10028666 Ga0207694_100286662 259
168 3300025925 Ga0207650_10084882 Ga0207650_100848822 259
169 3300025926 Ga0207659_10091400 Ga0207659_100914002 259
170 3300025928 Ga0207700_10312173 Ga0207700_103121731 259
171 3300025932 Ga0207690_10115423 Ga0207690_101154232 259
172 3300025933 Ga0207706_10152799 Ga0207706_101527993 259
173 3300025935 Ga0207709_10325583 Ga0207709_103255831 259
174 3300025935 Ga0207709_10334041 Ga0207709_103340411 259
175 3300025937 Ga0207669_10076823 Ga0207669_100768232 259
176 3300025937 Ga0207669_10134186 Ga0207669_101341862 259
177 3300025937 Ga0207669_10379647 Ga0207669_103796471 259
178 3300025937 Ga0207669_10550811 Ga0207669_105508111 259
179 3300025938 Ga0207704_10132799 Ga0207704_101327992 259
180 3300025940 Ga0207691_10110002 Ga0207691_101100022 259
181 3300025942 Ga0207689_10107728 Ga0207689_101077283 259
182 3300025944 Ga0207661_10052593 Ga0207661_100525932 259
183 3300025944 Ga0207661_10058346 Ga0207661_100583463 259
184 3300025949 Ga0207667_10044145 Ga0207667_100441454 259
185 3300025949 Ga0207667_10054426 Ga0207667_100544261 259
186 3300025949 Ga0207667_10087971 Ga0207667_100879713 259
187 3300025960 Ga0207651_10007669 Ga0207651_100076695 259
188 3300025961 Ga0207712_10052192 Ga0207712_100521922 259
189 3300025986 Ga0207658_10031534 Ga0207658_100315343 259
190 3300026023 Ga0207677_10075443 Ga0207677_100754433 259
191 3300026041 Ga0207639_10067416 Ga0207639_100674162 259
192 3300026067 Ga0207678_10001594 Ga0207678_100015948 259
193 3300026067 Ga0207678_10007772 Ga0207678_100077725 259
194 3300026078 Ga0207702_10012139 Ga0207702_100121395 259
195 3300026095 Ga0207676_10176709 Ga0207676_101767092 259
196 3300026116 Ga0207674_10017530 Ga0207674_100175304 259
197 3300026118 Ga0207675_100070663 Ga0207675_1000706632 259
198 3300026121 Ga0207683_10101559 Ga0207683_101015592 259
199 3300027907 Ga0207428_10004136 Ga0207428_100041364 259
200 3300028379 Ga0268266_10322525 Ga0268266_103225252 259
201 3300028379 Ga0268266_10804096 Ga0268266_108040961 259
202 3300028380 Ga0268265_10055072 Ga0268265_100550722 259
203 3300028381 Ga0268264_10161887 Ga0268264_101618872 259
204 3300028563 Ga0265319_1039044 Ga0265319_10390442 259
205 3300028800 Ga0265338_10022724 Ga0265338_100227242 259
206 3300031241 Ga0265325_10007982 Ga0265325_100079824 259
207 3300031241 Ga0265325_10206967 Ga0265325_102069671 259
208 3300031242 Ga0265329_10053483 Ga0265329_100534832 259
209 3300031344 Ga0265316_10010144 Ga0265316_100101444 259
210 3300031548 Ga0307408_100006290 Ga0307408_1000062906 259
211 3300031731 Ga0307405_10052556 Ga0307405_100525563 259
212 3300032002 Ga0307416_100733702 Ga0307416_1007337022 259
213 3300041512 Ga0451853_2250096 Ga0451853_2250096_163_942 259
214 3300042008 Ga0439450_031858 Ga0439450_031858_128_955 259
215 3300042436 Ga0439435_0017157 Ga0439435_0017157_573_1352 259
216 3300042439 Ga0439464_0002665 Ga0439464_0002665_2994_3821 259
217 3300046455 Ga0495603_0271742 Ga0495603_0271742_56_883 259
218 3300047318 Ga0495636_0032604 Ga0495636_0032604_425_1207 259
219 3300048904 Ga0496101_0345455 Ga0496101_0345455_120_902 259
220 3300048911 Ga0496108_0321909 Ga0496108_0321909_330_1109 259
221 3300048912 Ga0496109_0094128 Ga0496109_0094128_864_1643 259
222 3300048915 Ga0496112_0014903 Ga0496112_0014903_3344_4123 259
223 3300048918 Ga0496115_0214591 Ga0496115_0214591_226_1005 259
224 3300049514 Ga0501291_031361 Ga0501291_031361_26_805 259
225 3300049570 Ga0501033_0014567 Ga0501033_0014567_2765_3544 259
226 3300049572 Ga0501036_0173168 Ga0501036_0173168_885_1664 259
227 3300049574 Ga0501038_0014005 Ga0501038_0014005_2148_2927 259
228 3300049576 Ga0501040_0427301 Ga0501040_0427301_54_833 259
229 3300049579 Ga0501043_0128285 Ga0501043_0128285_491_1270 259
230 3300049580 Ga0501046_0435846 Ga0501046_0435846_57_836 259
231 3300049582 Ga0501048_0318857 Ga0501048_0318857_32_811 259
232 3300049586 Ga0501070_0249782 Ga0501070_0249782_488_1267 259
233 3300049587 Ga0501071_0330445 Ga0501071_0330445_203_982 259
234 3300049587 Ga0501071_0435050 Ga0501071_0435050_125_904 259
235 3300049588 Ga0501072_0371154 Ga0501072_0371154_24_803 259
236 3300049588 Ga0501072_0404273 Ga0501072_0404273_244_1023 259
237 3300049588 Ga0501072_0502963 Ga0501072_0502963_150_929 259
238 3300049589 Ga0501073_0148846 Ga0501073_0148846_256_1035 259
239 3300049590 Ga0501074_0271665 Ga0501074_0271665_360_1139 259
240 3300049591 Ga0501075_0021693 Ga0501075_0021693_1099_1878 259
241 3300049592 Ga0501076_0046834 Ga0501076_0046834_2262_3041 259
242 3300049742 Ga0501080_0085413 Ga0501080_0085413_1951_2730 259
243 3300049823 Ga0501044_0284380 Ga0501044_0284380_610_1389 259
244 3300049824 Ga0501045_0033904 Ga0501045_0033904_69_848 259
245 3300050493 nmdc:mga0k408_100586_c1 nmdc:mga0k408_100586_c1_15_794 259
246 3300050493 nmdc:mga0k408_38282_c1 nmdc:mga0k408_38282_c1_90_869 259
247 3300050494 nmdc:mga06z11_9159_c1 nmdc:mga06z11_9159_c1_2792_3571 259
248 3300050507 nmdc:mga05p37_350006_c1 nmdc:mga05p37_350006_c1_930_1709 259
249 3300050507 nmdc:mga05p37_382_c1 nmdc:mga05p37_382_c1_33156_33935 259
250 3300050507 nmdc:mga05p37_42707_c1 nmdc:mga05p37_42707_c1_4595_5374 259
251 3300050507 nmdc:mga05p37_64332_c1 nmdc:mga05p37_64332_c1_1963_2742 259
252 3300050507 nmdc:mga05p37_85720_c1 nmdc:mga05p37_85720_c1_1227_2006 259
253 3300050508 nmdc:mga09592_12628_c1 nmdc:mga09592_12628_c1_1891_2670 259
254 3300050508 nmdc:mga09592_6583_c1 nmdc:mga09592_6583_c1_5807_6586 259
255 3300050508 nmdc:mga09592_95755_c1 nmdc:mga09592_95755_c1_536_1315 259
256 3300050509 nmdc:mga0qj67_4210_c1 nmdc:mga0qj67_4210_c1_8310_9089 259
257 3300050509 nmdc:mga0qj67_44262_c1 nmdc:mga0qj67_44262_c1_1366_2145 259
258 3300050510 nmdc:mga06r32_1110_c1 nmdc:mga06r32_1110_c1_20481_21260 259
259 3300050510 nmdc:mga06r32_123776_c1 nmdc:mga06r32_123776_c1_1181_1960 259
260 3300050510 nmdc:mga06r32_21203_c1 nmdc:mga06r32_21203_c1_4087_4866 259
261 3300050510 nmdc:mga06r32_273500_c1 nmdc:mga06r32_273500_c1_743_1522 259
262 3300050510 nmdc:mga06r32_58728_c1 nmdc:mga06r32_58728_c1_2527_3306 259
263 3300050511 nmdc:mga08y16_108873_c1 nmdc:mga08y16_108873_c1_473_1252 259
264 3300050511 nmdc:mga08y16_139175_c1 nmdc:mga08y16_139175_c1_461_1240 259
265 3300050511 nmdc:mga08y16_186018_c1 nmdc:mga08y16_186018_c1_339_1118 259
266 3300050511 nmdc:mga08y16_409715_c1 nmdc:mga08y16_409715_c1_194_973 259
267 3300050511 nmdc:mga08y16_5292_c1 nmdc:mga08y16_5292_c1_9359_10138 259
268 3300050512 nmdc:mga0n895_288589_c1 nmdc:mga0n895_288589_c1_788_1567 259
269 3300050513 nmdc:mga0rr50_170840_c1 nmdc:mga0rr50_170840_c1_473_1252 259
270 3300050513 nmdc:mga0rr50_4764_c1 nmdc:mga0rr50_4764_c1_4277_5056 259
271 3300050515 nmdc:mga0a205_18236_c1 nmdc:mga0a205_18236_c1_5747_6526 259
272 3300050515 nmdc:mga0a205_6356_c1 nmdc:mga0a205_6356_c1_788_1567 259
273 3300054114 Ga0501084_0050481 Ga0501084_0050481_1230_2009 259
274 3300060353 Ga0501082_0154058 Ga0501082_0154058_1019_1801 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

225

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

287

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

47

248

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8u9a-assembly1.cif.gz_B crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (dbh bound) 0.9164 6 253
2ztu-assembly1.cif.gz_B t190a mutant of d-3-hydroxybutyrate dehydrogenase complexed with nad+ 0.9164 12 253
8g9v-assembly4.cif.gz_H crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.9126 5 181
8sbv-assembly2.cif.gz_B crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (adp bound) 0.9121 6 253
8g9v-assembly4.cif.gz_G crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.9089 5 181
ID Description Score Start End Superfamily
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9417 3 181 3.40.50.720
af_Q19843_28_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9167 5 180 3.40.50.720
2ztuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9164 12 253 3.40.50.720
af_A0A1D6LBF9_1_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9121 79 181 3.40.50.720
af_O53398_1_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9095 6 181 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q3QW30-F1-model_v4 Short-chain dehydrogenase 0.9478 1 259 GO:0016491
AF-A0A509CGU0-F1-model_v4 NAD(P)-dependent oxidoreductase EC-YbbO (EC 1.1.1.56) 0.9415 7 182 GO:0008202
GO:0050255
AF-A0A1C4A6H9-F1-model_v4 Short-chain dehydrogenase 0.9411 8 182 GO:0016491
AF-A0A485DC56-F1-model_v4 Fatty acyl-CoA reductase (EC 1.2.1.-) 0.939 7 168 GO:0016491
AF-A0A7V2T7U7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9369 8 182 GO:0016491

Feature Viewer

pLDDT pTM Quality
87.58 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map