F379382

General Info

Members Datasets Scaffolds Average Seq Length
273 100 494 605

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221684|2644472603
Length 645
Sequence LRDAFSVTRFSFWTGVMLSTLVGSVLYVVTTRSIESDVQERFSRQAKYAQAVINMRIKSYTDLLRGAASLLQSGDTISHRQFHDYVQGLHLARNYPAVDTLNFATWVREDERSHFEAEFARELQAFLGPGARPVVTPSGRRPAYLVVTYIEPDATNTRLYGLDLMSNPYFRTQLAQSRDDGRLRASGRPIAALSVPNDNHLGMRLPVYRHGPLLTGAEQRRAAYLGSLGIAFSLPKLLHGVMDEMPIPGVRMTLFDVGPREVIGHDTTTWPKVLFDSHGTAANPTPPLDGGDEVFTATLPLDFNGRPWQTTYSVPKARLRTQFDVYYPKLMMAFGFIGSVLLYALLHILTSSRRAALELAQEMTSELRESQTRLQLSHQKLRRLADHAYQIKELERKRIAREIHDDLGQSLLALRIEAELLAGRTQGTHNHLNTRARXDLGQSLLALRIEAELLAGRTQGTHNHLNTRARSTLQQIDTTIRSVRQIINDLRPTVLDLGLSAAVEWQVDQFQKRTGIQCEIRDDHGEIALPDHCATAFFRILQESLTNIVRHANATHVKVELRLNGGWLSLTIRDNGCGLPPGGRNKYESFGLVGIEERIAILGGTCAVFSEPGGGTTVIVSAPVIGGPEPAVPLQQEHGPGSAVV

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
5 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
6 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
7 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
8 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
10 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
11 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
12 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
13 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
14 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
15 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
16 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
17 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
18 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
19 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
20 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
21 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
22 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
23 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
24 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
25 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
26 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
27 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
28 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
29 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
30 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
31 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
32 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
33 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
34 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
35 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
36 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
37 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
38 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
39 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
40 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
41 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
42 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
43 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
44 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
45 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
46 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
47 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
48 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
49 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
50 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
51 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
52 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
53 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
54 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
55 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
56 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
57 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
58 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
59 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
60 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
61 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
62 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
63 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
64 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
65 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
66 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
67 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
68 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
69 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
70 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
71 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
72 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
73 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
74 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
75 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
76 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
77 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
78 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
79 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
80 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
81 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
90 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
91 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
92 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
93 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
94 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
97 2643221684 Massilia sp. Root133 Isolate Unclassified
98 2643221556 Massilia sp. Root1485 Isolate Unclassified
99 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
100 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 0
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 3.66
Rhizosphere 89.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10019476 3300003322 Bacteria 5805
2 Ga0055542_1006591 3300003762 Bacteria 2465
3 Ga0070659_100083030 3300005366 Bacteria 2560
4 Ga0105244_10032654 3300009036 Bacteria 2753
5 Ga0209563_100003 3300025230 Bacteria 1932942
6 Ga0209148_1006110 3300025254 Bacteria 2649
7 Ga0207706_10019609 3300025933 Bacteria 6083
8 Ga0207706_10134512 3300025933 Bacteria 2174
9 Ga0207686_10005365 3300025934 Bacteria 6874
10 Ga0395899_0005785 3300037312 Bacteria 9593
11 Ga0395899_0008959 3300037312 Bacteria 7699
12 Ga0395899_0026806 3300037312 Bacteria 4347
13 Ga0395899_0035201 3300037312 Bacteria 3759
14 Ga0395899_0062933 3300037312 Bacteria 2731
15 Ga0395900_0000202 3300037418 Bacteria 93773
16 Ga0395900_0042252 3300037418 Bacteria 4696
17 Ga0395900_0048070 3300037418 Bacteria 4394
18 Ga0395900_0061749 3300037418 Bacteria 3853
19 Ga0395900_0099021 3300037418 Bacteria 2995
20 Ga0395898_0020073 3300037466 Bacteria 6790
21 Ga0395898_0079556 3300037466 Bacteria 3162
22 Ga0395898_0080673 3300037466 Bacteria 3138
23 Ga0395898_0118751 3300037466 Bacteria 2533
24 Ga0395905_0028695 3300037471 Bacteria 5244
25 Ga0395905_0034972 3300037471 Bacteria 4716
26 Ga0395905_0036627 3300037471 Bacteria 4608
27 Ga0395905_0052708 3300037471 Bacteria 3808
28 Ga0395905_0063245 3300037471 Bacteria 3462
29 Ga0395905_0096951 3300037471 Bacteria 2768
30 Ga0395901_0000019 3300038443 Bacteria 317063
31 Ga0395901_0053040 3300038443 Bacteria 4214
32 Ga0395901_0058801 3300038443 Bacteria 3998
33 Ga0395901_0099897 3300038443 Bacteria 3043
34 Ga0395901_0180106 3300038443 Bacteria 2216
35 Ga0439448_0003798 3300042005 Bacteria 4216
36 Ga0439448_0006793 3300042005 Bacteria 3298
37 Ga0439449_0009738 3300042007 Bacteria 3636
38 Ga0439450_003666 3300042008 Bacteria 2561
39 Ga0439455_0006278 3300042012 Bacteria 2459
40 Ga0466969_0017465 3300044656 Bacteria 3745
41 Ga0466972_0016400 3300044658 Bacteria 3704
42 Ga0466965_0013777 3300044683 Bacteria 3820
43 Ga0466966_0008163 3300044684 Bacteria 6940
44 Ga0466966_0026048 3300044684 Bacteria 3819
45 Ga0466966_0043701 3300044684 Bacteria 2871
46 Ga0466961_0032077 3300044693 Bacteria 3376
47 Ga0466968_0012498 3300044735 Bacteria 3325
48 Ga0466970_0044848 3300044765 Bacteria 2354
49 Ga0466957_0002396 3300044842 Bacteria 10062
50 Ga0466959_0068606 3300045049 Bacteria 2569
51 Ga0466959_0095874 3300045049 Bacteria 2127
52 Ga0466958_0031069 3300045836 Bacteria 3174
53 Ga0466958_0032919 3300045836 Bacteria 3086
54 Ga0466967_0049680 3300045976 Bacteria 3669
55 Ga0495617_000015 3300046452 Bacteria 260968
56 Ga0495627_000106 3300046453 Bacteria 102596
57 Ga0495590_0004928 3300046457 Bacteria 5334
58 Ga0495591_010951 3300046458 Bacteria 3466
59 Ga0495653_0003331 3300046463 Bacteria 12905
60 Ga0495653_0009999 3300046463 Bacteria 7761
61 Ga0495650_0001033 3300046471 Bacteria 31238
62 Ga0495650_0015848 3300046471 Bacteria 3849
63 Ga0495605_0000021 3300046474 Bacteria 248512
64 Ga0495605_0000065 3300046474 Bacteria 139441
65 Ga0495605_0007453 3300046474 Bacteria 6209
66 Ga0495605_0009445 3300046474 Bacteria 5479
67 Ga0495605_0021871 3300046474 Bacteria 3382
68 Ga0495605_0030609 3300046474 Bacteria 2757
69 Ga0495605_0032684 3300046474 Bacteria 2647
70 Ga0495584_0001455 3300046491 Bacteria 14228
71 Ga0495584_0002488 3300046491 Bacteria 10435
72 Ga0495584_0003481 3300046491 Bacteria 8654
73 Ga0495584_0006068 3300046491 Bacteria 6361
74 Ga0495585_0014668 3300046492 Bacteria 4558
75 Ga0495585_0015749 3300046492 Bacteria 4391
76 Ga0495585_0022358 3300046492 Bacteria 3629
77 Ga0495585_0022822 3300046492 Bacteria 3592
78 Ga0495585_0046813 3300046492 Bacteria 2410
79 Ga0495594_0005382 3300046499 Bacteria 6577
80 Ga0495594_0041488 3300046499 Bacteria 2520
81 Ga0495594_0045923 3300046499 Bacteria 2398
82 Ga0495596_0001125 3300046500 Bacteria 15781
83 Ga0495596_0003057 3300046500 Bacteria 8646
84 Ga0495596_0005541 3300046500 Bacteria 5942
85 Ga0495596_0018962 3300046500 Bacteria 2831
86 Ga0495607_0001621 3300046501 Bacteria 19542
87 Ga0495607_0002692 3300046501 Bacteria 14180
88 Ga0495607_0002828 3300046501 Bacteria 13777
89 Ga0495607_0009818 3300046501 Bacteria 6460
90 Ga0495607_0015788 3300046501 Bacteria 4885
91 Ga0495607_0023401 3300046501 Bacteria 3868
92 Ga0495583_0000665 3300046506 Bacteria 45049
93 Ga0495583_0012638 3300046506 Bacteria 4761
94 Ga0495606_0019686 3300046507 Bacteria 5008
95 Ga0495606_0028605 3300046507 Bacteria 3928
96 Ga0495616_0000803 3300046513 Bacteria 23000
97 Ga0495616_0019327 3300046513 Bacteria 3718
98 Ga0495616_0026131 3300046513 Bacteria 3112
99 Ga0495631_0008015 3300046518 Bacteria 5338
100 Ga0495631_0016714 3300046518 Bacteria 3489
101 Ga0495632_0000237 3300046519 Bacteria 55087
102 Ga0495632_0001900 3300046519 Bacteria 16723
103 Ga0495632_0007048 3300046519 Bacteria 7123
104 Ga0495632_0022680 3300046519 Bacteria 3361
105 Ga0495637_0008830 3300046520 Bacteria 4934
106 Ga0495637_0030387 3300046520 Bacteria 2397
107 Ga0495643_0007462 3300046522 Bacteria 7044
108 Ga0495643_0008353 3300046522 Bacteria 6562
109 Ga0495643_0018232 3300046522 Bacteria 4084
110 Ga0495643_0020948 3300046522 Bacteria 3760
111 Ga0495644_0000633 3300046523 Bacteria 14683
112 Ga0495644_0003050 3300046523 Bacteria 6630
113 Ga0495644_0008687 3300046523 Bacteria 3909
114 Ga0495648_0000200 3300046524 Bacteria 69169
115 Ga0495648_0003174 3300046524 Bacteria 14636
116 Ga0495648_0014607 3300046524 Bacteria 5739
117 Ga0495648_0018918 3300046524 Bacteria 4860
118 Ga0495642_0000518 3300046528 Bacteria 19820
119 Ga0495642_0003880 3300046528 Bacteria 5865
120 Ga0495642_0004336 3300046528 Bacteria 5510
121 Ga0495642_0004900 3300046528 Bacteria 5166
122 Ga0495642_0011796 3300046528 Bacteria 3367
123 Ga0495642_0012802 3300046528 Bacteria 3237
124 Ga0495642_0015438 3300046528 Bacteria 2969
125 Ga0495642_0050917 3300046528 Bacteria 1703
126 Ga0495652_0055003 3300046529 Bacteria 3386
127 Ga0495654_0014252 3300046530 Bacteria 4236
128 Ga0495665_0013441 3300046531 Bacteria 4426
129 Ga0495587_0018922 3300046536 Bacteria 4268
130 Ga0495609_0000026 3300046538 Bacteria 251973
131 Ga0495609_0000901 3300046538 Bacteria 21675
132 Ga0495609_0007250 3300046538 Bacteria 5559
133 Ga0495609_0010560 3300046538 Bacteria 4425
134 Ga0495597_0000775 3300046542 Bacteria 25284
135 Ga0495645_0081035 3300046543 Bacteria 2329
136 Ga0495668_0001245 3300046616 Bacteria 25534
137 Ga0495668_0014613 3300046616 Bacteria 4598
138 Ga0495668_0031443 3300046616 Bacteria 2991
139 Ga0495634_0004458 3300046642 Bacteria 10988
140 Ga0495634_0027310 3300046642 Bacteria 3972
141 Ga0495611_0000834 3300046648 Bacteria 16992
142 Ga0495611_0003020 3300046648 Bacteria 7501
143 Ga0495611_0013367 3300046648 Bacteria 3494
144 Ga0495661_0000408 3300046665 Bacteria 45688
145 Ga0495661_0000677 3300046665 Bacteria 34020
146 Ga0495661_0001698 3300046665 Bacteria 17847
147 Ga0495661_0001740 3300046665 Bacteria 17542
148 Ga0495661_0004666 3300046665 Bacteria 9846
149 Ga0495661_0012132 3300046665 Bacteria 5823
150 Ga0495661_0015088 3300046665 Bacteria 5163
151 Ga0495661_0015162 3300046665 Bacteria 5147
152 Ga0495661_0019805 3300046665 Bacteria 4402
153 Ga0495661_0032044 3300046665 Bacteria 3326
154 Ga0495661_0039162 3300046665 Bacteria 2948
155 Ga0495661_0044645 3300046665 Bacteria 2715
156 Ga0495588_0000140 3300046674 Bacteria 107766
157 Ga0495623_0009848 3300046679 Bacteria 6193
158 Ga0495623_0047175 3300046679 Bacteria 2734
159 Ga0495669_0000244 3300046684 Bacteria 31848
160 Ga0495669_0002933 3300046684 Bacteria 7011
161 Ga0495669_0008957 3300046684 Bacteria 4216
162 Ga0495670_0011965 3300046691 Bacteria 4270
163 Ga0495671_0000151 3300046692 Bacteria 60359
164 Ga0495649_0003366 3300046694 Bacteria 10832
165 Ga0495649_0013699 3300046694 Bacteria 4672
166 Ga0495649_0026377 3300046694 Bacteria 3231
167 Ga0495649_0039423 3300046694 Bacteria 2590
168 Ga0495589_0000073 3300046794 Bacteria 94125
169 Ga0495589_0000142 3300046794 Bacteria 66439
170 Ga0495589_0000697 3300046794 Bacteria 21866
171 Ga0495589_0004693 3300046794 Bacteria 7256
172 Ga0495589_0013087 3300046794 Bacteria 4284
173 Ga0495589_0017203 3300046794 Bacteria 3712
174 Ga0495660_0000085 3300046810 Bacteria 100369
175 Ga0495660_0002484 3300046810 Bacteria 11756
176 Ga0495660_0015353 3300046810 Bacteria 4425
177 Ga0495660_0034928 3300046810 Bacteria 2811
178 Ga0495604_0046748 3300047317 Bacteria 3374
179 Ga0495672_0000850 3300047320 Bacteria 32446
180 Ga0495672_0021495 3300047320 Bacteria 4208
181 Ga0495672_0025739 3300047320 Bacteria 3761
182 Ga0495683_0003004 3300047323 Bacteria 9946
183 Ga0495683_0007499 3300047323 Bacteria 5891
184 Ga0495683_0018364 3300047323 Bacteria 3617
185 Ga0495687_000037 3300047443 Bacteria 252363
186 Ga0495687_000624 3300047443 Bacteria 40748
187 Ga0495687_000926 3300047443 Bacteria 30436
188 Ga0495687_001105 3300047443 Bacteria 26257
189 Ga0495687_001764 3300047443 Bacteria 19119
190 Ga0495687_015584 3300047443 Bacteria 3859
191 Ga0495675_0016295 3300047444 Bacteria 4701
192 Ga0495677_0000329 3300047445 Bacteria 20455
193 Ga0495677_0000384 3300047445 Bacteria 18956
194 Ga0495677_0002846 3300047445 Bacteria 6741
195 Ga0495677_0003204 3300047445 Bacteria 6378
196 Ga0495677_0004437 3300047445 Bacteria 5387
197 Ga0495677_0008829 3300047445 Bacteria 3733
198 Ga0495677_0012758 3300047445 Bacteria 3062
199 Ga0495679_004476 3300047446 Bacteria 6428
200 Ga0495685_000708 3300047447 Bacteria 10224
201 Ga0495681_0000101 3300047470 Bacteria 75746
202 Ga0495681_0016732 3300047470 Bacteria 4097
203 Ga0495681_0036417 3300047470 Bacteria 2433
204 Ga0495686_0000047 3300047472 Bacteria 280086
205 Ga0495602_0049568 3300048088 Bacteria 3760
206 Ga0495602_0051930 3300048088 Bacteria 3646
207 Ga0495626_0000009 3300048091 Bacteria 270596
208 Ga0495626_0000078 3300048091 Bacteria 130020
209 Ga0495626_0003211 3300048091 Bacteria 10607
210 Ga0495626_0008685 3300048091 Bacteria 5547
211 Ga0495626_0013503 3300048091 Bacteria 4243
212 Ga0495626_0017333 3300048091 Bacteria 3639
213 Ga0495626_0022074 3300048091 Bacteria 3147
214 Ga0496100_0009276 3300048903 Bacteria 5525
215 Ga0496101_0025642 3300048904 Bacteria 4091
216 Ga0496102_0000538 3300048905 Bacteria 40982
217 Ga0496102_0034952 3300048905 Bacteria 4523
218 Ga0496103_0015189 3300048906 Bacteria 4578
219 Ga0496110_0000697 3300048913 Bacteria 23164
220 Ga0496110_0062364 3300048913 Bacteria 3292
221 Ga0496113_0032307 3300048916 Bacteria 3804
222 Ga0496113_0034783 3300048916 Bacteria 3679
223 Ga0496115_0121684 3300048918 Bacteria 2148
224 Ga0496122_0000281 3300048925 Bacteria 113531
225 Ga0496122_0008664 3300048925 Bacteria 10913
226 Ga0496122_0017593 3300048925 Bacteria 6670
227 Ga0496123_0000242 3300048926 Bacteria 110049
228 Ga0496123_0042063 3300048926 Bacteria 3159
229 Ga0496123_0068119 3300048926 Bacteria 2243
230 Ga0496124_0019535 3300048927 Bacteria 6300
231 Ga0496124_0043296 3300048927 Bacteria 3870
232 Ga0496125_0000503 3300048928 Bacteria 68126
233 Ga0496125_0118537 3300048928 Bacteria 1895
234 Ga0495678_000045 3300049459 Bacteria 171880
235 Ga0495678_008145 3300049459 Bacteria 5334
236 Ga0495682_0011167 3300049460 Bacteria 3461
237 Ga0501035_0000719 3300049822 Bacteria 35784
238 Ga0466962_0010589 3300061719 Bacteria 4435
239 Ga0466962_0026891 3300061719 Bacteria 2762
240 2644472603 2643221684 Bacteria 7145183
241 2643801438 2643221556 Bacteria 7251154
242 2643801442 2643221556 Bacteria 7251154
243 2644472601 2643221684 Bacteria 7145183
244 2809142183 2808606418 Bacteria 6724496
245 8047675067 8047673197 Bacteria 7395230
246 8047676529 8047673197 Bacteria 7395230
247 8047676531 8047673197 Bacteria 7395230
248 rootL2_10019476
249 Ga0055542_1006591
250 Ga0070659_100083030
251 Ga0105244_10032654
252 Ga0209563_100003
253 Ga0209148_1006110
254 Ga0207706_10019609
255 Ga0207706_10134512
256 Ga0207686_10005365
257 Ga0395899_0005785
258 Ga0395899_0008959
259 Ga0395899_0026806
260 Ga0395899_0035201
261 Ga0395899_0062933
262 Ga0395900_0000202
263 Ga0395900_0042252
264 Ga0395900_0048070
265 Ga0395900_0061749
266 Ga0395900_0099021
267 Ga0395898_0020073
268 Ga0395898_0079556
269 Ga0395898_0080673
270 Ga0395898_0118751
271 Ga0395905_0028695
272 Ga0395905_0034972
273 Ga0395905_0036627
274 Ga0395905_0052708
275 Ga0395905_0063245
276 Ga0395905_0096951
277 Ga0395901_0000019
278 Ga0395901_0053040
279 Ga0395901_0058801
280 Ga0395901_0099897
281 Ga0395901_0180106
282 Ga0439448_0003798
283 Ga0439448_0006793
284 Ga0439449_0009738
285 Ga0439450_003666
286 Ga0439455_0006278
287 Ga0466969_0017465
288 Ga0466972_0016400
289 Ga0466965_0013777
290 Ga0466966_0008163
291 Ga0466966_0026048
292 Ga0466966_0043701
293 Ga0466961_0032077
294 Ga0466968_0012498
295 Ga0466970_0044848
296 Ga0466957_0002396
297 Ga0466959_0068606
298 Ga0466959_0095874
299 Ga0466958_0031069
300 Ga0466958_0032919
301 Ga0466967_0049680
302 Ga0495617_000015
303 Ga0495627_000106
304 Ga0495590_0004928
305 Ga0495591_010951
306 Ga0495653_0003331
307 Ga0495653_0009999
308 Ga0495650_0001033
309 Ga0495650_0015848
310 Ga0495605_0000021
311 Ga0495605_0000065
312 Ga0495605_0007453
313 Ga0495605_0009445
314 Ga0495605_0021871
315 Ga0495605_0030609
316 Ga0495605_0032684
317 Ga0495584_0001455
318 Ga0495584_0002488
319 Ga0495584_0003481
320 Ga0495584_0006068
321 Ga0495585_0014668
322 Ga0495585_0015749
323 Ga0495585_0022358
324 Ga0495585_0022822
325 Ga0495585_0046813
326 Ga0495594_0005382
327 Ga0495594_0041488
328 Ga0495594_0045923
329 Ga0495596_0001125
330 Ga0495596_0003057
331 Ga0495596_0005541
332 Ga0495596_0018962
333 Ga0495607_0001621
334 Ga0495607_0002692
335 Ga0495607_0002828
336 Ga0495607_0009818
337 Ga0495607_0015788
338 Ga0495607_0023401
339 Ga0495583_0000665
340 Ga0495583_0012638
341 Ga0495606_0019686
342 Ga0495606_0028605
343 Ga0495616_0000803
344 Ga0495616_0019327
345 Ga0495616_0026131
346 Ga0495631_0008015
347 Ga0495631_0016714
348 Ga0495632_0000237
349 Ga0495632_0001900
350 Ga0495632_0007048
351 Ga0495632_0022680
352 Ga0495637_0008830
353 Ga0495637_0030387
354 Ga0495643_0007462
355 Ga0495643_0008353
356 Ga0495643_0018232
357 Ga0495643_0020948
358 Ga0495644_0000633
359 Ga0495644_0003050
360 Ga0495644_0008687
361 Ga0495648_0000200
362 Ga0495648_0003174
363 Ga0495648_0014607
364 Ga0495648_0018918
365 Ga0495642_0000518
366 Ga0495642_0003880
367 Ga0495642_0004336
368 Ga0495642_0004900
369 Ga0495642_0011796
370 Ga0495642_0012802
371 Ga0495642_0015438
372 Ga0495642_0050917
373 Ga0495652_0055003
374 Ga0495654_0014252
375 Ga0495665_0013441
376 Ga0495587_0018922
377 Ga0495609_0000026
378 Ga0495609_0000901
379 Ga0495609_0007250
380 Ga0495609_0010560
381 Ga0495597_0000775
382 Ga0495645_0081035
383 Ga0495668_0001245
384 Ga0495668_0014613
385 Ga0495668_0031443
386 Ga0495634_0004458
387 Ga0495634_0027310
388 Ga0495611_0000834
389 Ga0495611_0003020
390 Ga0495611_0013367
391 Ga0495661_0000408
392 Ga0495661_0000677
393 Ga0495661_0001698
394 Ga0495661_0001740
395 Ga0495661_0004666
396 Ga0495661_0012132
397 Ga0495661_0015088
398 Ga0495661_0015162
399 Ga0495661_0019805
400 Ga0495661_0032044
401 Ga0495661_0039162
402 Ga0495661_0044645
403 Ga0495588_0000140
404 Ga0495623_0009848
405 Ga0495623_0047175
406 Ga0495669_0000244
407 Ga0495669_0002933
408 Ga0495669_0008957
409 Ga0495670_0011965
410 Ga0495671_0000151
411 Ga0495649_0003366
412 Ga0495649_0013699
413 Ga0495649_0026377
414 Ga0495649_0039423
415 Ga0495589_0000073
416 Ga0495589_0000142
417 Ga0495589_0000697
418 Ga0495589_0004693
419 Ga0495589_0013087
420 Ga0495589_0017203
421 Ga0495660_0000085
422 Ga0495660_0002484
423 Ga0495660_0015353
424 Ga0495660_0034928
425 Ga0495604_0046748
426 Ga0495672_0000850
427 Ga0495672_0021495
428 Ga0495672_0025739
429 Ga0495683_0003004
430 Ga0495683_0007499
431 Ga0495683_0018364
432 Ga0495687_000037
433 Ga0495687_000624
434 Ga0495687_000926
435 Ga0495687_001105
436 Ga0495687_001764
437 Ga0495687_015584
438 Ga0495675_0016295
439 Ga0495677_0000329
440 Ga0495677_0000384
441 Ga0495677_0002846
442 Ga0495677_0003204
443 Ga0495677_0004437
444 Ga0495677_0008829
445 Ga0495677_0012758
446 Ga0495679_004476
447 Ga0495685_000708
448 Ga0495681_0000101
449 Ga0495681_0016732
450 Ga0495681_0036417
451 Ga0495686_0000047
452 Ga0495602_0049568
453 Ga0495602_0051930
454 Ga0495626_0000009
455 Ga0495626_0000078
456 Ga0495626_0003211
457 Ga0495626_0008685
458 Ga0495626_0013503
459 Ga0495626_0017333
460 Ga0495626_0022074
461 Ga0496100_0009276
462 Ga0496101_0025642
463 Ga0496102_0000538
464 Ga0496102_0034952
465 Ga0496103_0015189
466 Ga0496110_0000697
467 Ga0496110_0062364
468 Ga0496113_0032307
469 Ga0496113_0034783
470 Ga0496115_0121684
471 Ga0496122_0000281
472 Ga0496122_0008664
473 Ga0496122_0017593
474 Ga0496123_0000242
475 Ga0496123_0042063
476 Ga0496123_0068119
477 Ga0496124_0019535
478 Ga0496124_0043296
479 Ga0496125_0000503
480 Ga0496125_0118537
481 Ga0495678_000045
482 Ga0495678_008145
483 Ga0495682_0011167
484 Ga0501035_0000719
485 Ga0466962_0010589
486 Ga0466962_0026891
487 2644472603
488 2643801438
489 2643801442
490 2644472601
491 2809142183
492 8047675067
493 8047676529
494 8047676531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07730

HisKA_3

Histidine kinase

439

495

0.97

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

533

625

0.91

PF07730

HisKA_3

Histidine kinase

395

438

0.87

PF03924

CHASE

CHASE domain

75

268

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ehg-assembly1.cif.gz_A crystal structure of the atp-binding domain of desk in complex with atp 0.8755 468 593
4gt8-assembly1.cif.gz_A crystal structure of the catalytic and atp-binding domain from vras in complex with adp 0.8749 468 596
3ehg-assembly1.cif.gz_A crystal structure of the atp-binding domain of desk in complex with atp 0.8499 468 593
4gt8-assembly1.cif.gz_A crystal structure of the catalytic and atp-binding domain from vras in complex with adp 0.8266 468 596
6k62-assembly1.cif.gz_A crystal structure of xanthomonas pcrk 0.8031 45 318
ID Description Score Start End Superfamily
af_Q2FVM6_212_344_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.891 464 594 3.30.565.10
4gt8A00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8748 468 596 3.30.565.10
af_P27896_425_560_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8737 468 595 3.30.565.10
af_Q2FVM6_212_344_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8722 464 594 3.30.565.10
af_P09835_373_498_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8722 469 594 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A6G1SXT5-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9131 487 593 GO:0000160
GO:0016301
AF-A0A2A6RKK5-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.9084 468 595 GO:0000160
GO:0016020
GO:0016301
AF-A0A4V2NHS0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8876 466 594 GO:0000160
GO:0016301
AF-A0A3A9V7F0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8815 462 597 GO:0000160
GO:0016301
AF-A0A3N6AEF3-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8735 483 594 GO:0000160
GO:0005886
GO:0016301

Map