F379331

General Info

Members Datasets Scaffolds Average Seq Length
273 186 546 163

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0420645|Ga0501076_0420645_477_1016
Length 179
Sequence MTDRLKTGATVPASQKRVRLERVYRADIQDVWXXWTTKDGIESWWGPGGFAVTVRKLDLRPGGELLYAMTAVNPPQVEFLKKAGMPLTQECRITFTEVDAPRRLAYIHLADFIPGVDPYDVATVVELQPAADGIRMILTFDAMHSDEWTKRATMGWESELDKLTAVLAEGHDRRTGGRS

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
182 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
183 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
184 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
185 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 2.93
Rhizosphere 90.11
Stem 0
Stem Tuber 0
Unclassified 21.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0420645 3300049592 Unclassified 1099
2 JGI25164J39214_1003502 3300002772 Bacteria 1976
3 rootH2_10017225 3300003320 Bacteria 3764
4 rootH2_10178114 3300003320 Unclassified 3119
5 rootH1_10039253 3300003323 Bacteria 2278
6 rootH1_10051213 3300003323 Bacteria 12028
7 rootH1_10054377 3300003323 Bacteria 23325
8 rootH1_10155739 3300003323 Unclassified 1056
9 Ga0070658_10301366 3300005327 Unclassified 1366
10 Ga0070676_10016907 3300005328 Bacteria 4032
11 Ga0070690_100048789 3300005330 Bacteria 2697
12 Ga0070690_100418280 3300005330 Unclassified 988
13 Ga0070670_100307253 3300005331 Bacteria 1388
14 Ga0070677_10014161 3300005333 Bacteria 2802
15 Ga0068869_100059635 3300005334 Bacteria 2794
16 Ga0068869_100360861 3300005334 Bacteria 1186
17 Ga0068869_100810464 3300005334 Bacteria 805
18 Ga0070666_10034325 3300005335 Bacteria 3362
19 Ga0070666_10224895 3300005335 Unclassified 1324
20 Ga0070680_100271392 3300005336 Bacteria 1436
21 Ga0070682_100022104 3300005337 Bacteria 3763
22 Ga0068868_100033557 3300005338 Bacteria 3956
23 Ga0068868_100154972 3300005338 Unclassified 1889
24 Ga0070689_100531208 3300005340 Bacteria 1011
25 Ga0070689_101546626 3300005340 Bacteria 601
26 Ga0070692_10199738 3300005345 Bacteria 1170
27 Ga0070668_100145681 3300005347 Bacteria 1912
28 Ga0070669_100001659 3300005353 Bacteria 16100
29 Ga0070669_100057398 3300005353 Bacteria 2856
30 Ga0070675_100032729 3300005354 Bacteria 4208
31 Ga0070675_101539049 3300005354 Bacteria 613
32 Ga0070674_100929633 3300005356 Bacteria 759
33 Ga0070674_101223238 3300005356 Bacteria 667
34 Ga0070673_100021984 3300005364 Bacteria 4635
35 Ga0070673_100524996 3300005364 Unclassified 1073
36 Ga0070701_10014543 3300005438 Bacteria 3612
37 Ga0070705_100089035 3300005440 Bacteria 1918
38 Ga0070700_100085927 3300005441 Bacteria 2042
39 Ga0070700_100888181 3300005441 Unclassified 725
40 Ga0070708_100248309 3300005445 Bacteria 1671
41 Ga0070708_100769329 3300005445 Unclassified 905
42 Ga0070663_100564528 3300005455 Unclassified 953
43 Ga0070663_101477247 3300005455 Bacteria 604
44 Ga0070678_101094643 3300005456 Unclassified 735
45 Ga0068867_100026207 3300005459 Bacteria 4185
46 Ga0068867_100728617 3300005459 Unclassified 878
47 Ga0070707_100004339 3300005468 Bacteria 13286
48 Ga0070707_100112398 3300005468 Bacteria 2642
49 Ga0070707_100268533 3300005468 Bacteria 1659
50 Ga0070707_100455844 3300005468 Bacteria 1239
51 Ga0070698_100001640 3300005471 Bacteria 24951
52 Ga0070698_100016033 3300005471 Bacteria 7913
53 Ga0070699_100030074 3300005518 Bacteria 4687
54 Ga0070697_100001111 3300005536 Bacteria 20332
55 Ga0070697_100002055 3300005536 Bacteria 15431
56 Ga0070697_100139491 3300005536 Unclassified 2038
57 Ga0070697_100180399 3300005536 Bacteria 1790
58 Ga0070672_100005457 3300005543 Bacteria 8430
59 Ga0070672_100181042 3300005543 Bacteria 1756
60 Ga0070672_100525585 3300005543 Bacteria 1025
61 Ga0070686_100003119 3300005544 Bacteria 9086
62 Ga0070696_100142847 3300005546 Bacteria 1751
63 Ga0070664_100001768 3300005564 Bacteria 17327
64 Ga0068854_100197285 3300005578 Bacteria 1580
65 Ga0068854_100204185 3300005578 Bacteria 1555
66 Ga0068854_100561539 3300005578 Bacteria 970
67 Ga0068856_100008680 3300005614 Bacteria 9887
68 Ga0070702_100206258 3300005615 Bacteria 1305
69 Ga0068864_100677938 3300005618 Bacteria 1005
70 Ga0068866_10526125 3300005718 Bacteria 787
71 Ga0068861_100133658 3300005719 Unclassified 2016
72 Ga0068870_10004140 3300005840 Bacteria 6213
73 Ga0068870_10013123 3300005840 Bacteria 3885
74 Ga0068870_10501304 3300005840 Unclassified 809
75 Ga0068863_100014762 3300005841 Bacteria 7513
76 Ga0068863_100367445 3300005841 Bacteria 1403
77 Ga0068863_100495315 3300005841 Bacteria 1203
78 Ga0068858_100118784 3300005842 Bacteria 2472
79 Ga0068860_100004343 3300005843 Bacteria 14481
80 Ga0068860_101286049 3300005843 Unclassified 752
81 Ga0068862_100004788 3300005844 Bacteria 11391
82 Ga0068862_100289724 3300005844 Bacteria 1503
83 Ga0068862_100685235 3300005844 Bacteria 992
84 Ga0081455_10631706 3300005937 Bacteria 693
85 Ga0097621_100072493 3300006237 Bacteria 2849
86 Ga0097621_101428132 3300006237 Bacteria 655
87 Ga0068871_100112901 3300006358 Bacteria 2288
88 Ga0075428_100012132 3300006844 Bacteria 9587
89 Ga0075428_100811479 3300006844 Unclassified 994
90 Ga0075428_101398813 3300006844 Unclassified 734
91 Ga0075428_101752277 3300006844 Bacteria 647
92 Ga0075430_100001722 3300006846 Bacteria 17845
93 Ga0075431_100064556 3300006847 Bacteria 3780
94 Ga0075431_100076462 3300006847 Bacteria 3455
95 Ga0075433_10045655 3300006852 Bacteria 3809
96 Ga0075433_10065150 3300006852 Bacteria 3195
97 Ga0075434_100281018 3300006871 Bacteria 1684
98 Ga0075434_100303184 3300006871 Bacteria 1618
99 Ga0075429_100003476 3300006880 Bacteria 13440
100 Ga0068865_100046340 3300006881 Bacteria 2983
101 Ga0068865_100140138 3300006881 Bacteria 1822
102 Ga0075436_100020478 3300006914 Bacteria 4540
103 Ga0075435_100010430 3300007076 Bacteria 6796
104 Ga0075435_100435898 3300007076 Bacteria 1129
105 Ga0099794_10017696 3300007265 Unclassified 3181
106 Ga0099794_10088355 3300007265 Bacteria 1536
107 Ga0105240_10270898 3300009093 Bacteria 1955
108 Ga0111539_10011615 3300009094 Bacteria 11052
109 Ga0114129_10132021 3300009147 Bacteria 3428
110 Ga0114129_10450312 3300009147 Bacteria 1688
111 Ga0105243_10211088 3300009148 Bacteria 1710
112 Ga0105242_10068428 3300009176 Bacteria 2937
113 Ga0105242_10509661 3300009176 Unclassified 1146
114 Ga0105248_10070932 3300009177 Bacteria 3912
115 Ga0105248_10200864 3300009177 Bacteria 2246
116 Ga0105238_10423430 3300009551 Bacteria 1326
117 Ga0105249_10004714 3300009553 Bacteria 11772
118 Ga0105249_10848799 3300009553 Bacteria 979
119 Ga0105246_10275605 3300011119 Bacteria 1347
120 Ga0157374_10068708 3300013296 Bacteria 3334
121 Ga0163162_10156755 3300013306 Unclassified 2397
122 Ga0163162_10217779 3300013306 Unclassified 2039
123 Ga0157375_10205919 3300013308 Unclassified 2123
124 Ga0157375_10562682 3300013308 Unclassified 1301
125 Ga0163163_10299819 3300014325 Unclassified 1660
126 Ga0157380_10001061 3300014326 Bacteria 17614
127 Ga0157380_10122885 3300014326 Bacteria 2202
128 Ga0157380_10148686 3300014326 Bacteria 2022
129 Ga0157379_10287815 3300014968 Unclassified 1496
130 Ga0157376_10217646 3300014969 Bacteria 1767
131 Ga0157376_10530349 3300014969 Bacteria 1162
132 Ga0157376_11930404 3300014969 Bacteria 628
133 Ga0163161_10002269 3300017792 Bacteria 13791
134 Ga0207427_100371 3300025231 Bacteria 27335
135 Ga0209759_1009778 3300025256 Bacteria 2870
136 Ga0209759_1010560 3300025256 Bacteria 2697
137 Ga0209233_1066076 3300025261 Bacteria 683
138 Ga0207697_10173806 3300025315 Bacteria 943
139 Ga0207682_10000982 3300025893 Bacteria 13150
140 Ga0207682_10009603 3300025893 Bacteria 3814
141 Ga0207688_10001460 3300025901 Bacteria 12387
142 Ga0207680_10866447 3300025903 Unclassified 647
143 Ga0207645_10000714 3300025907 Bacteria 27661
144 Ga0207645_10153068 3300025907 Bacteria 1506
145 Ga0207643_10001288 3300025908 Bacteria 14613
146 Ga0207643_10016024 3300025908 Bacteria 4082
147 Ga0207695_10067089 3300025913 Bacteria 3681
148 Ga0207662_10324501 3300025918 Bacteria 1028
149 Ga0207646_10003799 3300025922 Bacteria 16802
150 Ga0207646_10022780 3300025922 Bacteria 5760
151 Ga0207646_10033039 3300025922 Bacteria 4681
152 Ga0207646_10092384 3300025922 Bacteria 2709
153 Ga0207646_10094180 3300025922 Bacteria 2682
154 Ga0207646_10125569 3300025922 Bacteria 2307
155 Ga0207681_10165549 3300025923 Bacteria 1671
156 Ga0207694_10284760 3300025924 Bacteria 1358
157 Ga0207650_10227172 3300025925 Bacteria 1504
158 Ga0207690_10481357 3300025932 Bacteria 1002
159 Ga0207686_10038432 3300025934 Unclassified 2896
160 Ga0207686_10568806 3300025934 Bacteria 888
161 Ga0207670_11474011 3300025936 Bacteria 578
162 Ga0207669_10849547 3300025937 Bacteria 760
163 Ga0207704_11106636 3300025938 Unclassified 673
164 Ga0207691_10022774 3300025940 Bacteria 5906
165 Ga0207691_10499261 3300025940 Bacteria 1033
166 Ga0207689_10005911 3300025942 Bacteria 10837
167 Ga0207689_10039301 3300025942 Bacteria 3917
168 Ga0207689_10723800 3300025942 Bacteria 840
169 Ga0207651_10475339 3300025960 Unclassified 1076
170 Ga0207712_10135676 3300025961 Bacteria 1881
171 Ga0207640_10954007 3300025981 Unclassified 752
172 Ga0207703_10059580 3300026035 Bacteria 3118
173 Ga0207678_10439154 3300026067 Bacteria 1133
174 Ga0207708_10027732 3300026075 Bacteria 4288
175 Ga0207708_10424605 3300026075 Bacteria 1103
176 Ga0207702_10041857 3300026078 Bacteria 3841
177 Ga0207641_10363123 3300026088 Unclassified 1383
178 Ga0207641_10426715 3300026088 Unclassified 1277
179 Ga0207648_10010897 3300026089 Bacteria 8591
180 Ga0207648_11268058 3300026089 Unclassified 692
181 Ga0207676_10253677 3300026095 Bacteria 1585
182 Ga0207675_100539401 3300026118 Bacteria 1165
183 Ga0207683_10054180 3300026121 Bacteria 3517
184 Ga0207683_10059313 3300026121 Bacteria 3362
185 Ga0268266_10207294 3300028379 Bacteria 1797
186 Ga0268265_10343089 3300028380 Bacteria 1361
187 Ga0268264_10201301 3300028381 Bacteria 1822
188 Ga0268264_10264019 3300028381 Bacteria 1605
189 Ga0268264_10975044 3300028381 Unclassified 853
190 Ga0265334_10036106 3300028573 Bacteria 1953
191 Ga0265338_10191389 3300028800 Unclassified 1550
192 Ga0265324_10001021 3300029957 Bacteria 17213
193 Ga0265325_10007602 3300031241 Bacteria 6481
194 Ga0265339_10000693 3300031249 Bacteria 26066
195 Ga0265316_10140696 3300031344 Unclassified 1813
196 Ga0307513_10020127 3300031456 Bacteria 7917
197 Ga0307513_10025919 3300031456 Bacteria 6773
198 Ga0307513_10494612 3300031456 Bacteria 941
199 Ga0307509_10224032 3300031507 Bacteria 1690
200 Ga0265313_10004816 3300031595 Bacteria 10154
201 Ga0265342_10070908 3300031712 Unclassified 2031
202 Ga0373950_0000005 3300034818 Bacteria 404272
203 Ga0373928_0093506 3300035084 Bacteria 775
204 Ga0373932_0017879 3300035112 Bacteria 1827
205 Ga0373955_0114538 3300035172 Unclassified 1562
206 Ga0373931_0558926 3300035691 Unclassified 744
207 Ga0373933_0424717 3300035724 Unclassified 868
208 Ga0373937_0103457 3300036401 Bacteria 2645
209 Ga0373925_0106989 3300037068 Bacteria 2157
210 Ga0451576_0089082 3300045051 Bacteria 3209
211 Ga0495590_0155873 3300046457 Unclassified 829
212 Ga0495662_0412007 3300046476 Unclassified 664
213 Ga0495583_0000123 3300046506 Bacteria 131122
214 Ga0495606_0008203 3300046507 Bacteria 9136
215 Ga0495616_0035326 3300046513 Bacteria 2588
216 Ga0495620_0341633 3300046515 Bacteria 568
217 Ga0495632_0097258 3300046519 Bacteria 1390
218 Ga0495621_0068051 3300046539 Bacteria 1306
219 Ga0495656_0245987 3300046615 Unclassified 902
220 Ga0495668_0058650 3300046616 Unclassified 2124
221 Ga0495625_0035235 3300046660 Bacteria 3690
222 Ga0495625_0035548 3300046660 Bacteria 3671
223 Ga0495647_0075682 3300046681 Bacteria 1356
224 Ga0495658_0067116 3300046683 Unclassified 2074
225 Ga0495649_0000618 3300046694 Bacteria 29404
226 Ga0495649_0019247 3300046694 Bacteria 3836
227 Ga0495589_0002156 3300046794 Bacteria 11089
228 Ga0495683_0176679 3300047323 Bacteria 978
229 Ga0495686_0445518 3300047472 Bacteria 689
230 Ga0495626_0048153 3300048091 Bacteria 1979
231 Ga0496100_0010753 3300048903 Bacteria 5190
232 Ga0496101_0003244 3300048904 Bacteria 10102
233 Ga0496102_0303275 3300048905 Bacteria 1505
234 Ga0496104_0019526 3300048907 Bacteria 6203
235 Ga0496106_0032590 3300048909 Bacteria 3886
236 Ga0496114_0001230 3300048917 Bacteria 19357
237 Ga0496114_0078153 3300048917 Unclassified 2792
238 Ga0496115_0170365 3300048918 Bacteria 1801
239 Ga0495678_092067 3300049459 Bacteria 1066
240 Ga0501031_0274195 3300049568 Bacteria 1095
241 Ga0501037_0245249 3300049573 Unclassified 1255
242 Ga0501040_0046967 3300049576 Unclassified 2948
243 Ga0501041_0013241 3300049577 Unclassified 4887
244 Ga0501043_0971279 3300049579 Bacteria 606
245 Ga0501048_0010497 3300049582 Bacteria 6913
246 Ga0501067_0000013 3300049583 Bacteria 111318
247 Ga0501070_1208639 3300049586 Unclassified 580
248 Ga0501072_0129566 3300049588 Unclassified 2010
249 Ga0501073_0001497 3300049589 Bacteria 17288
250 Ga0501073_0044277 3300049589 Bacteria 3137
251 Ga0501077_0036887 3300049593 Bacteria 3114
252 Ga0501081_0038045 3300049743 Unclassified 3285
253 Ga0501045_0047728 3300049824 Unclassified 3120
254 nmdc:mga05p37_405161_c1 3300050507 Unclassified 1591
255 nmdc:mga05p37_605214_c1 3300050507 Bacteria 1236
256 nmdc:mga09592_256187_c1 3300050508 Bacteria 1517
257 nmdc:mga09592_5173_c1 3300050508 Bacteria 10600
258 nmdc:mga0qj67_400298_c1 3300050509 Bacteria 1108
259 nmdc:mga06r32_1390670_c1 3300050510 Bacteria 644
260 nmdc:mga06r32_33499_c1 3300050510 Bacteria 4838
261 nmdc:mga06r32_3694_c1 3300050510 Bacteria 13674
262 nmdc:mga0n895_233015_c1 3300050512 Bacteria 1869
263 nmdc:mga0n895_382854_c1 3300050512 Bacteria 1423
264 nmdc:mga0rr50_38658_c1 3300050513 Bacteria 3455
265 nmdc:mga08x19_90527_c1 3300050514 Bacteria 2019
266 nmdc:mga0a205_136914_c1 3300050515 Bacteria 2349
267 nmdc:mga0a205_9906_c1 3300050515 Bacteria 8740
268 Ga0500635_0091668 3300053080 Bacteria 1106
269 Ga0495655_0022895 3300053083 Unclassified 1434
270 Ga0500564_097679 3300053138 Bacteria 1301
271 Ga0500588_0038047 3300053146 Bacteria 1432
272 Ga0500636_0028630 3300053177 Bacteria 3289
273 Ga0530510_0030500 3300061734 Unclassified 3873
274 Ga0501076_0420645
275 JGI25164J39214_1003502
276 rootH2_10017225
277 rootH2_10178114
278 rootH1_10039253
279 rootH1_10051213
280 rootH1_10054377
281 rootH1_10155739
282 Ga0070658_10301366
283 Ga0070676_10016907
284 Ga0070690_100048789
285 Ga0070690_100418280
286 Ga0070670_100307253
287 Ga0070677_10014161
288 Ga0068869_100059635
289 Ga0068869_100360861
290 Ga0068869_100810464
291 Ga0070666_10034325
292 Ga0070666_10224895
293 Ga0070680_100271392
294 Ga0070682_100022104
295 Ga0068868_100033557
296 Ga0068868_100154972
297 Ga0070689_100531208
298 Ga0070689_101546626
299 Ga0070692_10199738
300 Ga0070668_100145681
301 Ga0070669_100001659
302 Ga0070669_100057398
303 Ga0070675_100032729
304 Ga0070675_101539049
305 Ga0070674_100929633
306 Ga0070674_101223238
307 Ga0070673_100021984
308 Ga0070673_100524996
309 Ga0070701_10014543
310 Ga0070705_100089035
311 Ga0070700_100085927
312 Ga0070700_100888181
313 Ga0070708_100248309
314 Ga0070708_100769329
315 Ga0070663_100564528
316 Ga0070663_101477247
317 Ga0070678_101094643
318 Ga0068867_100026207
319 Ga0068867_100728617
320 Ga0070707_100004339
321 Ga0070707_100112398
322 Ga0070707_100268533
323 Ga0070707_100455844
324 Ga0070698_100001640
325 Ga0070698_100016033
326 Ga0070699_100030074
327 Ga0070697_100001111
328 Ga0070697_100002055
329 Ga0070697_100139491
330 Ga0070697_100180399
331 Ga0070672_100005457
332 Ga0070672_100181042
333 Ga0070672_100525585
334 Ga0070686_100003119
335 Ga0070696_100142847
336 Ga0070664_100001768
337 Ga0068854_100197285
338 Ga0068854_100204185
339 Ga0068854_100561539
340 Ga0068856_100008680
341 Ga0070702_100206258
342 Ga0068864_100677938
343 Ga0068866_10526125
344 Ga0068861_100133658
345 Ga0068870_10004140
346 Ga0068870_10013123
347 Ga0068870_10501304
348 Ga0068863_100014762
349 Ga0068863_100367445
350 Ga0068863_100495315
351 Ga0068858_100118784
352 Ga0068860_100004343
353 Ga0068860_101286049
354 Ga0068862_100004788
355 Ga0068862_100289724
356 Ga0068862_100685235
357 Ga0081455_10631706
358 Ga0097621_100072493
359 Ga0097621_101428132
360 Ga0068871_100112901
361 Ga0075428_100012132
362 Ga0075428_100811479
363 Ga0075428_101398813
364 Ga0075428_101752277
365 Ga0075430_100001722
366 Ga0075431_100064556
367 Ga0075431_100076462
368 Ga0075433_10045655
369 Ga0075433_10065150
370 Ga0075434_100281018
371 Ga0075434_100303184
372 Ga0075429_100003476
373 Ga0068865_100046340
374 Ga0068865_100140138
375 Ga0075436_100020478
376 Ga0075435_100010430
377 Ga0075435_100435898
378 Ga0099794_10017696
379 Ga0099794_10088355
380 Ga0105240_10270898
381 Ga0111539_10011615
382 Ga0114129_10132021
383 Ga0114129_10450312
384 Ga0105243_10211088
385 Ga0105242_10068428
386 Ga0105242_10509661
387 Ga0105248_10070932
388 Ga0105248_10200864
389 Ga0105238_10423430
390 Ga0105249_10004714
391 Ga0105249_10848799
392 Ga0105246_10275605
393 Ga0157374_10068708
394 Ga0163162_10156755
395 Ga0163162_10217779
396 Ga0157375_10205919
397 Ga0157375_10562682
398 Ga0163163_10299819
399 Ga0157380_10001061
400 Ga0157380_10122885
401 Ga0157380_10148686
402 Ga0157379_10287815
403 Ga0157376_10217646
404 Ga0157376_10530349
405 Ga0157376_11930404
406 Ga0163161_10002269
407 Ga0207427_100371
408 Ga0209759_1009778
409 Ga0209759_1010560
410 Ga0209233_1066076
411 Ga0207697_10173806
412 Ga0207682_10000982
413 Ga0207682_10009603
414 Ga0207688_10001460
415 Ga0207680_10866447
416 Ga0207645_10000714
417 Ga0207645_10153068
418 Ga0207643_10001288
419 Ga0207643_10016024
420 Ga0207695_10067089
421 Ga0207662_10324501
422 Ga0207646_10003799
423 Ga0207646_10022780
424 Ga0207646_10033039
425 Ga0207646_10092384
426 Ga0207646_10094180
427 Ga0207646_10125569
428 Ga0207681_10165549
429 Ga0207694_10284760
430 Ga0207650_10227172
431 Ga0207690_10481357
432 Ga0207686_10038432
433 Ga0207686_10568806
434 Ga0207670_11474011
435 Ga0207669_10849547
436 Ga0207704_11106636
437 Ga0207691_10022774
438 Ga0207691_10499261
439 Ga0207689_10005911
440 Ga0207689_10039301
441 Ga0207689_10723800
442 Ga0207651_10475339
443 Ga0207712_10135676
444 Ga0207640_10954007
445 Ga0207703_10059580
446 Ga0207678_10439154
447 Ga0207708_10027732
448 Ga0207708_10424605
449 Ga0207702_10041857
450 Ga0207641_10363123
451 Ga0207641_10426715
452 Ga0207648_10010897
453 Ga0207648_11268058
454 Ga0207676_10253677
455 Ga0207675_100539401
456 Ga0207683_10054180
457 Ga0207683_10059313
458 Ga0268266_10207294
459 Ga0268265_10343089
460 Ga0268264_10201301
461 Ga0268264_10264019
462 Ga0268264_10975044
463 Ga0265334_10036106
464 Ga0265338_10191389
465 Ga0265324_10001021
466 Ga0265325_10007602
467 Ga0265339_10000693
468 Ga0265316_10140696
469 Ga0307513_10020127
470 Ga0307513_10025919
471 Ga0307513_10494612
472 Ga0307509_10224032
473 Ga0265313_10004816
474 Ga0265342_10070908
475 Ga0373950_0000005
476 Ga0373928_0093506
477 Ga0373932_0017879
478 Ga0373955_0114538
479 Ga0373931_0558926
480 Ga0373933_0424717
481 Ga0373937_0103457
482 Ga0373925_0106989
483 Ga0451576_0089082
484 Ga0495590_0155873
485 Ga0495662_0412007
486 Ga0495583_0000123
487 Ga0495606_0008203
488 Ga0495616_0035326
489 Ga0495620_0341633
490 Ga0495632_0097258
491 Ga0495621_0068051
492 Ga0495656_0245987
493 Ga0495668_0058650
494 Ga0495625_0035235
495 Ga0495625_0035548
496 Ga0495647_0075682
497 Ga0495658_0067116
498 Ga0495649_0000618
499 Ga0495649_0019247
500 Ga0495589_0002156
501 Ga0495683_0176679
502 Ga0495686_0445518
503 Ga0495626_0048153
504 Ga0496100_0010753
505 Ga0496101_0003244
506 Ga0496102_0303275
507 Ga0496104_0019526
508 Ga0496106_0032590
509 Ga0496114_0001230
510 Ga0496114_0078153
511 Ga0496115_0170365
512 Ga0495678_092067
513 Ga0501031_0274195
514 Ga0501037_0245249
515 Ga0501040_0046967
516 Ga0501041_0013241
517 Ga0501043_0971279
518 Ga0501048_0010497
519 Ga0501067_0000013
520 Ga0501070_1208639
521 Ga0501072_0129566
522 Ga0501073_0001497
523 Ga0501073_0044277
524 Ga0501077_0036887
525 Ga0501081_0038045
526 Ga0501045_0047728
527 nmdc:mga05p37_405161_c1
528 nmdc:mga05p37_605214_c1
529 nmdc:mga09592_256187_c1
530 nmdc:mga09592_5173_c1
531 nmdc:mga0qj67_400298_c1
532 nmdc:mga06r32_1390670_c1
533 nmdc:mga06r32_33499_c1
534 nmdc:mga06r32_3694_c1
535 nmdc:mga0n895_233015_c1
536 nmdc:mga0n895_382854_c1
537 nmdc:mga0rr50_38658_c1
538 nmdc:mga08x19_90527_c1
539 nmdc:mga0a205_136914_c1
540 nmdc:mga0a205_9906_c1
541 Ga0500635_0091668
542 Ga0495655_0022895
543 Ga0500564_097679
544 Ga0500588_0038047
545 Ga0500636_0028630
546 Ga0530510_0030500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

25

168

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8981 10 160
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8902 10 160
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8658 11 157
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8559 10 160
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.8552 11 160
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8963 10 160 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8536 10 160 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8532 11 160 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8363 11 156 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8355 10 160 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A536GR40-F1-model_v4 SRPBCC domain-containing protein 0.9817 46 160
AF-A0A536MDA9-F1-model_v4 SRPBCC domain-containing protein 0.9789 10 160
AF-A0A535WUF5-F1-model_v4 SRPBCC domain-containing protein 0.9733 34 159
AF-A0A536FT71-F1-model_v4 SRPBCC domain-containing protein 0.9706 10 161
AF-A0A6H1W4B3-F1-model_v4 SRPBCC domain-containing protein 0.9702 11 161

Map