F379279

General Info

Members Datasets Scaffolds Average Seq Length
273 157 546 339

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0043185|Ga0496108_0043185_2388_3605
Length 390
Sequence VLVRDDGTLARGRVLVSPSFLTTVARMERLAVGGGGDECAHPRSGRRGSVACVPEPVIDWSTFPNAYERALEGRLDRHVIVSELLADNPLGDPAERPVEVYVPPGYDETGAEPMWHNRSPFRPTFPEAVDALFAGGGAPACVVVFVDAWTAYGGSQFVDSPGTGRYHSYLCDEVVAFVDARYRTLASAAHRGIAGKSSGGFGAMITPMLRPDLFGGLASHAGDALYELSYIQGFGKVVRALRAYDGSYEKFWEDFASRPPMSKETDGDLVITYGVAAAFSADEDGTVHLPFDLHTGRLVDDVWARWLAWDPVRMVPAHADALRGLRAIYLDGGTRDEWYLELGALAFRDALAQIGITDVACELFDAAHGGIDYRYPRGLAYLAERLTSDP

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
57 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
58 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
59 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 1.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 17.95
Rhizosphere 80.95
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0043185 3300048911 Bacteria 3765
2 Ga0070658_10070693 3300005327 Bacteria 2858
3 Ga0070658_10195079 3300005327 Bacteria 1707
4 Ga0070683_100110439 3300005329 Bacteria 2594
5 Ga0070683_100157825 3300005329 Bacteria 2152
6 Ga0070683_100288304 3300005329 Bacteria 1561
7 Ga0070680_100007198 3300005336 Bacteria 8479
8 Ga0070680_100012131 3300005336 Bacteria 6691
9 Ga0070680_100017743 3300005336 Bacteria 5614
10 Ga0070682_100039106 3300005337 Bacteria 2913
11 Ga0068868_100039898 3300005338 Bacteria 3651
12 Ga0068868_100148959 3300005338 Bacteria 1926
13 Ga0070659_100340058 3300005366 Bacteria 1257
14 Ga0070713_100186179 3300005436 Bacteria 1868
15 Ga0070713_100224864 3300005436 Bacteria 1704
16 Ga0070711_100015234 3300005439 Bacteria 4865
17 Ga0070681_10000165 3300005458 Bacteria 50320
18 Ga0070681_10002017 3300005458 Bacteria 18379
19 Ga0070681_10122545 3300005458 Bacteria 2533
20 Ga0070698_100264024 3300005471 Bacteria 1654
21 Ga0070679_100000350 3300005530 Bacteria 39216
22 Ga0070679_100020298 3300005530 Bacteria 6476
23 Ga0070679_100104445 3300005530 Bacteria 2819
24 Ga0070684_100051953 3300005535 Bacteria 3562
25 Ga0068857_100039264 3300005577 Bacteria 4193
26 Ga0068857_100139234 3300005577 Unclassified 2193
27 Ga0068856_100134024 3300005614 Bacteria 2482
28 Ga0068856_100331627 3300005614 Bacteria 1539
29 Ga0081455_10123198 3300005937 Unclassified 2040
30 Ga0081540_1002339 3300005983 Bacteria 15517
31 Ga0081540_1006518 3300005983 Bacteria 8479
32 Ga0081539_10002077 3300005985 Bacteria 29969
33 Ga0070712_100049966 3300006175 Bacteria 2907
34 Ga0075428_100007123 3300006844 Bacteria 12385
35 Ga0075428_100036994 3300006844 Bacteria 5375
36 Ga0105240_10068856 3300009093 Bacteria 4382
37 Ga0114129_10011816 3300009147 Bacteria 12421
38 Ga0114129_10321011 3300009147 Bacteria 2059
39 Ga0105249_10111527 3300009553 Bacteria 2586
40 Ga0105239_10461235 3300010375 Bacteria 1442
41 Ga0157370_10022195 3300013104 Bacteria 6317
42 Ga0157369_10010949 3300013105 Bacteria 10324
43 Ga0157369_10170414 3300013105 Bacteria 2294
44 Ga0157375_10088086 3300013308 Bacteria 3158
45 Ga0163161_10046913 3300017792 Bacteria 3119
46 Ga0206356_11311993 3300020070 Bacteria 1313
47 Ga0206354_10413687 3300020081 Bacteria 3641
48 Ga0206354_11708062 3300020081 Bacteria 1854
49 Ga0206353_10127771 3300020082 Bacteria 5538
50 Ga0206353_11281378 3300020082 Bacteria 3548
51 Ga0213876_10011225 3300021384 Bacteria 4787
52 Ga0207647_10043753 3300025904 Bacteria 2800
53 Ga0207643_10052244 3300025908 Bacteria 2321
54 Ga0207705_10136199 3300025909 Bacteria 1831
55 Ga0207705_10217996 3300025909 Bacteria 1448
56 Ga0207707_10000324 3300025912 Bacteria 50333
57 Ga0207707_10033821 3300025912 Bacteria 4474
58 Ga0207707_10109588 3300025912 Bacteria 2414
59 Ga0207695_10089682 3300025913 Bacteria 3091
60 Ga0207660_10001059 3300025917 Bacteria 18238
61 Ga0207660_10015478 3300025917 Bacteria 5035
62 Ga0207660_10057763 3300025917 Bacteria 2780
63 Ga0207660_10095780 3300025917 Bacteria 2209
64 Ga0207657_10000054 3300025919 Bacteria 106767
65 Ga0207652_10000308 3300025921 Bacteria 50308
66 Ga0207652_10027010 3300025921 Bacteria 4783
67 Ga0207652_10161803 3300025921 Bacteria 2007
68 Ga0207652_10162634 3300025921 Bacteria 2001
69 Ga0207646_10121983 3300025922 Bacteria 2342
70 Ga0207687_10250326 3300025927 Bacteria 1408
71 Ga0207664_10008480 3300025929 Bacteria 7172
72 Ga0207661_10162055 3300025944 Bacteria 1941
73 Ga0207661_10227922 3300025944 Bacteria 1649
74 Ga0207667_10377610 3300025949 Bacteria 1444
75 Ga0207676_10061552 3300026095 Bacteria 2973
76 Ga0207674_10061603 3300026116 Bacteria 3791
77 Ga0207674_10091638 3300026116 Bacteria 3029
78 Ga0207428_10025657 3300027907 Bacteria 4931
79 Ga0265338_10001177 3300028800 Bacteria 43159
80 Ga0265327_10007467 3300031251 Bacteria 8432
81 Ga0307408_100241883 3300031548 Bacteria 1484
82 Ga0307413_10010336 3300031824 Bacteria 4521
83 Ga0307410_10101176 3300031852 Bacteria 2066
84 Ga0307407_10082576 3300031903 Bacteria 1948
85 Ga0307409_100014816 3300031995 Bacteria 5088
86 Ga0307409_100124553 3300031995 Bacteria 2190
87 Ga0373944_0087826 3300035089 Bacteria 1035
88 Ga0373945_0012024 3300035116 Bacteria 2869
89 Ga0373943_0002827 3300035170 Bacteria 7882
90 Ga0373946_0069053 3300035171 Bacteria 1521
91 Ga0373935_0014681 3300035692 Bacteria 4727
92 Ga0373927_0051793 3300035695 Bacteria 2655
93 Ga0373947_0000237 3300035725 Bacteria 31058
94 Ga0373937_0018104 3300036401 Bacteria 6285
95 Ga0373925_0004494 3300037068 Bacteria 10537
96 Ga0395899_0004950 3300037312 Bacteria 10367
97 Ga0395899_0011463 3300037312 Bacteria 6786
98 Ga0395899_0052886 3300037312 Bacteria 3009
99 Ga0395900_0007074 3300037418 Bacteria 11621
100 Ga0395900_0013360 3300037418 Bacteria 8392
101 Ga0395900_0033377 3300037418 Bacteria 5297
102 Ga0395898_0008803 3300037466 Bacteria 10637
103 Ga0395898_0190098 3300037466 Bacteria 1962
104 Ga0395905_0006819 3300037471 Bacteria 11433
105 Ga0395905_0154018 3300037471 Bacteria 2162
106 Ga0395905_0260716 3300037471 Bacteria 1618
107 Ga0395901_0004291 3300038443 Bacteria 14382
108 Ga0395901_0006321 3300038443 Bacteria 11996
109 Ga0395901_0009124 3300038443 Bacteria 10043
110 Ga0466965_0107583 3300044683 Bacteria 1431
111 Ga0466961_0014621 3300044693 Bacteria 5042
112 Ga0466961_0108485 3300044693 Bacteria 1747
113 Ga0466959_0190412 3300045049 Bacteria 1432
114 Ga0466958_0031261 3300045836 Bacteria 3164
115 Ga0466967_0005281 3300045976 Bacteria 8912
116 Ga0466967_0080209 3300045976 Bacteria 2944
117 Ga0466967_0084413 3300045976 Bacteria 2874
118 Ga0466967_0181407 3300045976 Bacteria 1986
119 Ga0466967_0255711 3300045976 Bacteria 1674
120 Ga0466967_0495499 3300045976 Bacteria 1198
121 Ga0495603_0110312 3300046455 Bacteria 1605
122 Ga0495629_0000670 3300046459 Bacteria 27725
123 Ga0495629_0143335 3300046459 Bacteria 1662
124 Ga0495641_0000374 3300046461 Bacteria 37120
125 Ga0495651_0013674 3300046462 Bacteria 6272
126 Ga0495651_0121977 3300046462 Bacteria 1913
127 Ga0495582_0000124 3300046473 Bacteria 41197
128 Ga0495582_0160721 3300046473 Bacteria 1277
129 Ga0495639_0001181 3300046475 Bacteria 11798
130 Ga0495662_0010269 3300046476 Bacteria 4589
131 Ga0495608_0006930 3300046511 Bacteria 8025
132 Ga0495608_0036746 3300046511 Bacteria 3296
133 Ga0495618_0098856 3300046514 Bacteria 1867
134 Ga0495628_0136910 3300046516 Bacteria 1871
135 Ga0495630_0026538 3300046517 Bacteria 4288
136 Ga0495652_0228233 3300046529 Bacteria 1394
137 Ga0495665_0000249 3300046531 Bacteria 27073
138 Ga0495640_0120481 3300046533 Bacteria 1706
139 Ga0495586_0181638 3300046535 Bacteria 1190
140 Ga0495645_0310829 3300046543 Bacteria 1026
141 Ga0495667_0037513 3300046559 Unclassified 3229
142 Ga0495667_0041955 3300046559 Bacteria 3033
143 Ga0495634_0044557 3300046642 Bacteria 3002
144 Ga0495634_0192913 3300046642 Bacteria 1269
145 Ga0495588_0029903 3300046674 Bacteria 2735
146 Ga0495657_0017978 3300046675 Bacteria 5126
147 Ga0495599_0057067 3300046678 Bacteria 2443
148 Ga0495647_0012906 3300046681 Bacteria 2884
149 Ga0495658_0000794 3300046683 Bacteria 17003
150 Ga0495613_0015191 3300046689 Bacteria 5721
151 Ga0495624_0019006 3300046690 Bacteria 4590
152 Ga0495600_0037429 3300046809 Bacteria 3154
153 Ga0495581_0006876 3300047315 Bacteria 6597
154 Ga0495604_0084102 3300047317 Bacteria 2377
155 Ga0495674_0048882 3300047319 Unclassified 3740
156 Ga0495674_0078652 3300047319 Bacteria 2833
157 Ga0495676_0000583 3300047321 Bacteria 30065
158 Ga0495680_0001674 3300047322 Bacteria 23560
159 Ga0495680_0016507 3300047322 Bacteria 6339
160 Ga0495684_0005606 3300047471 Bacteria 9784
161 Ga0495684_0031426 3300047471 Bacteria 4076
162 Ga0495593_0006109 3300047673 Bacteria 7085
163 Ga0495602_0048074 3300048088 Bacteria 3839
164 Ga0495614_0008328 3300048089 Bacteria 4615
165 Ga0496100_0022652 3300048903 Bacteria 3803
166 Ga0496101_0003449 3300048904 Bacteria 9861
167 Ga0496101_0009317 3300048904 Bacteria 6450
168 Ga0496101_0019867 3300048904 Bacteria 4594
169 Ga0496101_0175230 3300048904 Bacteria 1649
170 Ga0496102_0067610 3300048905 Bacteria 3278
171 Ga0496102_0180884 3300048905 Bacteria 1987
172 Ga0496104_0048963 3300048907 Bacteria 3985
173 Ga0496104_0052116 3300048907 Bacteria 3864
174 Ga0496104_0100493 3300048907 Unclassified 2769
175 Ga0496104_0108024 3300048907 Bacteria 2666
176 Ga0496104_0121592 3300048907 Bacteria 2507
177 Ga0496104_0231110 3300048907 Unclassified 1761
178 Ga0496104_0283818 3300048907 Bacteria 1568
179 Ga0496105_0005400 3300048908 Bacteria 9698
180 Ga0496105_0005901 3300048908 Bacteria 9340
181 Ga0496105_0026079 3300048908 Bacteria 4763
182 Ga0496105_0042382 3300048908 Bacteria 3752
183 Ga0496105_0218390 3300048908 Bacteria 1552
184 Ga0496106_0051760 3300048909 Bacteria 3097
185 Ga0496107_0202567 3300048910 Bacteria 1475
186 Ga0496108_0008990 3300048911 Bacteria 8097
187 Ga0496108_0060273 3300048911 Bacteria 3193
188 Ga0496109_0119841 3300048912 Bacteria 2450
189 Ga0496109_0125051 3300048912 Bacteria 2397
190 Ga0496109_0138141 3300048912 Bacteria 2278
191 Ga0496109_0280272 3300048912 Unclassified 1571
192 Ga0496110_0023557 3300048913 Bacteria 5238
193 Ga0496110_0107636 3300048913 Bacteria 2503
194 Ga0496110_0150709 3300048913 Bacteria 2106
195 Ga0496110_0175064 3300048913 Bacteria 1947
196 Ga0496111_0084169 3300048914 Bacteria 2325
197 Ga0496111_0251460 3300048914 Bacteria 1312
198 Ga0496112_0034962 3300048915 Bacteria 4890
199 Ga0496112_0036811 3300048915 Bacteria 4775
200 Ga0496112_0087118 3300048915 Bacteria 3090
201 Ga0496112_0107845 3300048915 Bacteria 2755
202 Ga0496113_0025761 3300048916 Bacteria 4196
203 Ga0496113_0045388 3300048916 Bacteria 3259
204 Ga0496114_0010388 3300048917 Bacteria 7408
205 Ga0496114_0026056 3300048917 Bacteria 4784
206 Ga0496114_0053850 3300048917 Bacteria 3354
207 Ga0496114_0060638 3300048917 Bacteria 3162
208 Ga0496114_0079815 3300048917 Bacteria 2763
209 Ga0496115_0005823 3300048918 Bacteria 8982
210 Ga0496115_0045172 3300048918 Bacteria 3516
211 Ga0496115_0098341 3300048918 Bacteria 2396
212 Ga0496115_0180160 3300048918 Bacteria 1747
213 Ga0496125_0089384 3300048928 Bacteria 2317
214 Ga0496126_0000040 3300048929 Bacteria 345144
215 Ga0501031_0007888 3300049568 Bacteria 6930
216 Ga0501031_0049411 3300049568 Bacteria 2742
217 Ga0501036_0010621 3300049572 Bacteria 7607
218 Ga0501036_0031600 3300049572 Bacteria 4474
219 Ga0501037_0061598 3300049573 Bacteria 2736
220 Ga0501038_0087005 3300049574 Bacteria 2624
221 Ga0501039_0004208 3300049575 Bacteria 10839
222 Ga0501039_0200641 3300049575 Bacteria 1568
223 Ga0501040_0001456 3300049576 Bacteria 14997
224 Ga0501040_0036758 3300049576 Bacteria 3325
225 Ga0501041_0002500 3300049577 Bacteria 10461
226 Ga0501042_0000487 3300049578 Bacteria 20578
227 Ga0501042_0032338 3300049578 Bacteria 3704
228 Ga0501042_0092779 3300049578 Bacteria 2168
229 Ga0501043_0068327 3300049579 Bacteria 2790
230 Ga0501046_0264340 3300049580 Bacteria 1263
231 Ga0501048_0006898 3300049582 Bacteria 8631
232 Ga0501048_0007614 3300049582 Bacteria 8209
233 Ga0501067_0081815 3300049583 Bacteria 1790
234 Ga0501068_0026388 3300049584 Bacteria 3422
235 Ga0501068_0175109 3300049584 Bacteria 1355
236 Ga0501071_0003067 3300049587 Bacteria 10346
237 Ga0501071_0004068 3300049587 Bacteria 9241
238 Ga0501072_0002068 3300049588 Bacteria 14926
239 Ga0501072_0002241 3300049588 Bacteria 14435
240 Ga0501072_0050724 3300049588 Bacteria 3267
241 Ga0501075_0001737 3300049591 Bacteria 14319
242 Ga0501075_0002734 3300049591 Bacteria 11810
243 Ga0501076_0000599 3300049592 Bacteria 23076
244 Ga0501076_0001901 3300049592 Bacteria 14249
245 Ga0501076_0180999 3300049592 Bacteria 1718
246 Ga0501077_0011934 3300049593 Bacteria 5435
247 Ga0501077_0024970 3300049593 Bacteria 3794
248 Ga0501079_0004366 3300049741 Bacteria 10483
249 Ga0501079_0004390 3300049741 Bacteria 10441
250 Ga0501080_0011685 3300049742 Bacteria 8043
251 Ga0501081_0003536 3300049743 Bacteria 9982
252 Ga0501081_0004542 3300049743 Bacteria 8911
253 Ga0501081_0109032 3300049743 Bacteria 1964
254 Ga0501035_0193203 3300049822 Bacteria 1749
255 Ga0501045_0000647 3300049824 Bacteria 22062
256 Ga0501045_0007964 3300049824 Bacteria 7380
257 nmdc:mga05p37_274142_c1 3300050507 Bacteria 2015
258 nmdc:mga05p37_461437_c1 3300050507 Bacteria 1468
259 nmdc:mga05p37_48598_c1 3300050507 Bacteria 5217
260 nmdc:mga0qj67_285065_c1 3300050509 Bacteria 1338
261 nmdc:mga0qj67_57218_c1 3300050509 Bacteria 3090
262 nmdc:mga08y16_375586_c1 3300050511 Bacteria 1458
263 Ga0495595_0047227 3300053084 Bacteria 1985
264 Ga0495619_0033746 3300053085 Bacteria 3324
265 Ga0501084_0005594 3300054114 Bacteria 10317
266 Ga0501084_0006774 3300054114 Bacteria 9414
267 Ga0501082_0003000 3300060353 Bacteria 14745
268 Ga0501082_0032334 3300060353 Bacteria 4512
269 Ga0466962_0037279 3300061719 Bacteria 2328
270 Ga0530510_0000682 3300061734 Bacteria 21916
271 Ga0530510_0010305 3300061734 Bacteria 6550
272 Ga0530510_0160593 3300061734 Bacteria 1662
273 Ga0530510_0279942 3300061734 Bacteria 1246
274 Ga0496108_0043185
275 Ga0070658_10070693
276 Ga0070658_10195079
277 Ga0070683_100110439
278 Ga0070683_100157825
279 Ga0070683_100288304
280 Ga0070680_100007198
281 Ga0070680_100012131
282 Ga0070680_100017743
283 Ga0070682_100039106
284 Ga0068868_100039898
285 Ga0068868_100148959
286 Ga0070659_100340058
287 Ga0070713_100186179
288 Ga0070713_100224864
289 Ga0070711_100015234
290 Ga0070681_10000165
291 Ga0070681_10002017
292 Ga0070681_10122545
293 Ga0070698_100264024
294 Ga0070679_100000350
295 Ga0070679_100020298
296 Ga0070679_100104445
297 Ga0070684_100051953
298 Ga0068857_100039264
299 Ga0068857_100139234
300 Ga0068856_100134024
301 Ga0068856_100331627
302 Ga0081455_10123198
303 Ga0081540_1002339
304 Ga0081540_1006518
305 Ga0081539_10002077
306 Ga0070712_100049966
307 Ga0075428_100007123
308 Ga0075428_100036994
309 Ga0105240_10068856
310 Ga0114129_10011816
311 Ga0114129_10321011
312 Ga0105249_10111527
313 Ga0105239_10461235
314 Ga0157370_10022195
315 Ga0157369_10010949
316 Ga0157369_10170414
317 Ga0157375_10088086
318 Ga0163161_10046913
319 Ga0206356_11311993
320 Ga0206354_10413687
321 Ga0206354_11708062
322 Ga0206353_10127771
323 Ga0206353_11281378
324 Ga0213876_10011225
325 Ga0207647_10043753
326 Ga0207643_10052244
327 Ga0207705_10136199
328 Ga0207705_10217996
329 Ga0207707_10000324
330 Ga0207707_10033821
331 Ga0207707_10109588
332 Ga0207695_10089682
333 Ga0207660_10001059
334 Ga0207660_10015478
335 Ga0207660_10057763
336 Ga0207660_10095780
337 Ga0207657_10000054
338 Ga0207652_10000308
339 Ga0207652_10027010
340 Ga0207652_10161803
341 Ga0207652_10162634
342 Ga0207646_10121983
343 Ga0207687_10250326
344 Ga0207664_10008480
345 Ga0207661_10162055
346 Ga0207661_10227922
347 Ga0207667_10377610
348 Ga0207676_10061552
349 Ga0207674_10061603
350 Ga0207674_10091638
351 Ga0207428_10025657
352 Ga0265338_10001177
353 Ga0265327_10007467
354 Ga0307408_100241883
355 Ga0307413_10010336
356 Ga0307410_10101176
357 Ga0307407_10082576
358 Ga0307409_100014816
359 Ga0307409_100124553
360 Ga0373944_0087826
361 Ga0373945_0012024
362 Ga0373943_0002827
363 Ga0373946_0069053
364 Ga0373935_0014681
365 Ga0373927_0051793
366 Ga0373947_0000237
367 Ga0373937_0018104
368 Ga0373925_0004494
369 Ga0395899_0004950
370 Ga0395899_0011463
371 Ga0395899_0052886
372 Ga0395900_0007074
373 Ga0395900_0013360
374 Ga0395900_0033377
375 Ga0395898_0008803
376 Ga0395898_0190098
377 Ga0395905_0006819
378 Ga0395905_0154018
379 Ga0395905_0260716
380 Ga0395901_0004291
381 Ga0395901_0006321
382 Ga0395901_0009124
383 Ga0466965_0107583
384 Ga0466961_0014621
385 Ga0466961_0108485
386 Ga0466959_0190412
387 Ga0466958_0031261
388 Ga0466967_0005281
389 Ga0466967_0080209
390 Ga0466967_0084413
391 Ga0466967_0181407
392 Ga0466967_0255711
393 Ga0466967_0495499
394 Ga0495603_0110312
395 Ga0495629_0000670
396 Ga0495629_0143335
397 Ga0495641_0000374
398 Ga0495651_0013674
399 Ga0495651_0121977
400 Ga0495582_0000124
401 Ga0495582_0160721
402 Ga0495639_0001181
403 Ga0495662_0010269
404 Ga0495608_0006930
405 Ga0495608_0036746
406 Ga0495618_0098856
407 Ga0495628_0136910
408 Ga0495630_0026538
409 Ga0495652_0228233
410 Ga0495665_0000249
411 Ga0495640_0120481
412 Ga0495586_0181638
413 Ga0495645_0310829
414 Ga0495667_0037513
415 Ga0495667_0041955
416 Ga0495634_0044557
417 Ga0495634_0192913
418 Ga0495588_0029903
419 Ga0495657_0017978
420 Ga0495599_0057067
421 Ga0495647_0012906
422 Ga0495658_0000794
423 Ga0495613_0015191
424 Ga0495624_0019006
425 Ga0495600_0037429
426 Ga0495581_0006876
427 Ga0495604_0084102
428 Ga0495674_0048882
429 Ga0495674_0078652
430 Ga0495676_0000583
431 Ga0495680_0001674
432 Ga0495680_0016507
433 Ga0495684_0005606
434 Ga0495684_0031426
435 Ga0495593_0006109
436 Ga0495602_0048074
437 Ga0495614_0008328
438 Ga0496100_0022652
439 Ga0496101_0003449
440 Ga0496101_0009317
441 Ga0496101_0019867
442 Ga0496101_0175230
443 Ga0496102_0067610
444 Ga0496102_0180884
445 Ga0496104_0048963
446 Ga0496104_0052116
447 Ga0496104_0100493
448 Ga0496104_0108024
449 Ga0496104_0121592
450 Ga0496104_0231110
451 Ga0496104_0283818
452 Ga0496105_0005400
453 Ga0496105_0005901
454 Ga0496105_0026079
455 Ga0496105_0042382
456 Ga0496105_0218390
457 Ga0496106_0051760
458 Ga0496107_0202567
459 Ga0496108_0008990
460 Ga0496108_0060273
461 Ga0496109_0119841
462 Ga0496109_0125051
463 Ga0496109_0138141
464 Ga0496109_0280272
465 Ga0496110_0023557
466 Ga0496110_0107636
467 Ga0496110_0150709
468 Ga0496110_0175064
469 Ga0496111_0084169
470 Ga0496111_0251460
471 Ga0496112_0034962
472 Ga0496112_0036811
473 Ga0496112_0087118
474 Ga0496112_0107845
475 Ga0496113_0025761
476 Ga0496113_0045388
477 Ga0496114_0010388
478 Ga0496114_0026056
479 Ga0496114_0053850
480 Ga0496114_0060638
481 Ga0496114_0079815
482 Ga0496115_0005823
483 Ga0496115_0045172
484 Ga0496115_0098341
485 Ga0496115_0180160
486 Ga0496125_0089384
487 Ga0496126_0000040
488 Ga0501031_0007888
489 Ga0501031_0049411
490 Ga0501036_0010621
491 Ga0501036_0031600
492 Ga0501037_0061598
493 Ga0501038_0087005
494 Ga0501039_0004208
495 Ga0501039_0200641
496 Ga0501040_0001456
497 Ga0501040_0036758
498 Ga0501041_0002500
499 Ga0501042_0000487
500 Ga0501042_0032338
501 Ga0501042_0092779
502 Ga0501043_0068327
503 Ga0501046_0264340
504 Ga0501048_0006898
505 Ga0501048_0007614
506 Ga0501067_0081815
507 Ga0501068_0026388
508 Ga0501068_0175109
509 Ga0501071_0003067
510 Ga0501071_0004068
511 Ga0501072_0002068
512 Ga0501072_0002241
513 Ga0501072_0050724
514 Ga0501075_0001737
515 Ga0501075_0002734
516 Ga0501076_0000599
517 Ga0501076_0001901
518 Ga0501076_0180999
519 Ga0501077_0011934
520 Ga0501077_0024970
521 Ga0501079_0004366
522 Ga0501079_0004390
523 Ga0501080_0011685
524 Ga0501081_0003536
525 Ga0501081_0004542
526 Ga0501081_0109032
527 Ga0501035_0193203
528 Ga0501045_0000647
529 Ga0501045_0007964
530 nmdc:mga05p37_274142_c1
531 nmdc:mga05p37_461437_c1
532 nmdc:mga05p37_48598_c1
533 nmdc:mga0qj67_285065_c1
534 nmdc:mga0qj67_57218_c1
535 nmdc:mga08y16_375586_c1
536 Ga0495595_0047227
537 Ga0495619_0033746
538 Ga0501084_0005594
539 Ga0501084_0006774
540 Ga0501082_0003000
541 Ga0501082_0032334
542 Ga0466962_0037279
543 Ga0530510_0000682
544 Ga0530510_0010305
545 Ga0530510_0160593
546 Ga0530510_0279942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

93

354

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.8152 25 322
4rgy-assembly1.cif.gz_A-2 structural and functional analysis of a low-temperature-active alkaline esterase from south china sea marine sediment microbial metagenomic library 0.788 2 323
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.7879 25 322
4rgy-assembly1.cif.gz_B-2 structural and functional analysis of a low-temperature-active alkaline esterase from south china sea marine sediment microbial metagenomic library 0.7773 2 323
4rgy-assembly1.cif.gz_A-2 structural and functional analysis of a low-temperature-active alkaline esterase from south china sea marine sediment microbial metagenomic library 0.7758 2 323
ID Description Score Start End Superfamily
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8152 25 322 3.40.50.1820
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7879 25 322 3.40.50.1820
4rgyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7773 2 323 3.40.50.1820
4rgyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7652 2 323 3.40.50.1820
af_D4A328_4_184_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7308 261 326 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6J6PHI7-F1-model_v4 Unannotated protein 0.9745 2 326
AF-A0A0C2AVI8-F1-model_v4 deleted 0.9673 88 326
AF-A0A535W215-F1-model_v4 Enterochelin esterase 0.9608 2 293
AF-A0A7J9YMB2-F1-model_v4 Enterochelin esterase 0.9593 42 326
AF-A0A6J6PHI7-F1-model_v4 Unannotated protein 0.957 2 326

Map