F379262

General Info

Members Datasets Scaffolds Average Seq Length
273 147 547 201

Family's Representative Sequence

Representative Sequence 3300047470|Ga0495681_0286365|Ga0495681_0286365_46_564
Length 172
Sequence MKLTEDYYLGNDVVAISKNLLGKYLFTCIDGVTTGGYIVETEAYNGIVDKASHSFGNRMTPRTKTMFMQGGIAYVYLCDGIEAMQARRNMLVLKSTITSGPGSVAKALGISRNINAISLQSDTLWLEDRGLNFTDEQINIGPRIGVSYAAEDAFLPYRFYVKGNKYVSKPNK

Samples

Sample ID Description Type Environment
1 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
89 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
90 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
133 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
134 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
135 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
136 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
140 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
141 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
142 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
143 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
144 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
145 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
146 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
147 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 0
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.26
Nodule 0
Rhizoplane 0.37
Rhizosphere 80.22
Stem 0
Stem Tuber 0
Unclassified 9.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495681_0286365 3300047470 Bacteria 641
2 JGI24740J21852_10014047 3300001979 Bacteria 2967
3 JGI24740J21852_10061352 3300001979 Bacteria 1036
4 JGI24739J22299_10048441 3300001989 Bacteria 1382
5 JGI24735J21928_10000014 3300002067 Bacteria 186670
6 JGI25162J39368_1000020 3300002737 Bacteria 254723
7 JGI25162J39368_1002504 3300002737 Bacteria 7033
8 JGI25406J46586_10008238 3300003203 Bacteria 4730
9 JGI25165J46597_1002118 3300003214 Bacteria 7197
10 rootH1_10051256 3300003316 Bacteria 2259
11 rootH1_10055859 3300003316 Bacteria 4271
12 rootH1_10055859 3300003323 Bacteria 4451
13 rootH2_10045710 3300003320 Bacteria 24416
14 rootH2_10048269 3300003320 Bacteria 27648
15 rootH2_10162030 3300003320 Unclassified 1156
16 rootL2_10169808 3300003322 Bacteria 1395
17 rootL2_10332650 3300003322 Bacteria 1589
18 rootH1_10006920 3300003323 Bacteria 63684
19 rootH1_10048752 3300003323 Bacteria 4770
20 rootH1_10127552 3300003323 Bacteria 5677
21 rootH1_10136779 3300003323 Bacteria 1914
22 rootH1_10194945 3300003323 Bacteria 2159
23 rootH1_10296372 3300003323 Bacteria 1212
24 Ga0065714_10071632 3300005288 Bacteria 3526
25 Ga0065714_10111482 3300005288 Bacteria 1470
26 Ga0070658_10136213 3300005327 Bacteria 2049
27 Ga0070658_10401583 3300005327 Unclassified 1177
28 Ga0068868_100269499 3300005338 Bacteria 1438
29 Ga0070660_100207715 3300005339 Bacteria 1589
30 Ga0070671_100025645 3300005355 Bacteria 4839
31 Ga0070673_100006179 3300005364 Bacteria 7766
32 Ga0070673_100310818 3300005364 Bacteria 1390
33 Ga0070659_100000231 3300005366 Bacteria 43452
34 Ga0070659_100014529 3300005366 Bacteria 5884
35 Ga0070659_100767562 3300005366 Bacteria 837
36 Ga0070663_100002347 3300005455 Bacteria 10638
37 Ga0070678_100005787 3300005456 Bacteria 7194
38 Ga0070662_100000068 3300005457 Bacteria 56624
39 Ga0068867_100000938 3300005459 Bacteria 19833
40 Ga0070685_10391814 3300005466 Unclassified 960
41 Ga0070684_100134125 3300005535 Unclassified 2235
42 Ga0068853_100089869 3300005539 Bacteria 2698
43 Ga0070665_100000003 3300005548 Bacteria 811857
44 Ga0068855_100000042 3300005563 Bacteria 149332
45 Ga0068855_100000652 3300005563 Bacteria 42351
46 Ga0068855_100009351 3300005563 Bacteria 11833
47 Ga0068855_100023662 3300005563 Bacteria 7356
48 Ga0068855_100024512 3300005563 Bacteria 7219
49 Ga0068855_100032375 3300005563 Bacteria 6244
50 Ga0068855_100158733 3300005563 Bacteria 2568
51 Ga0068855_100175661 3300005563 Unclassified 2424
52 Ga0068855_100260225 3300005563 Bacteria 1933
53 Ga0068857_100015205 3300005577 Bacteria 6716
54 Ga0068854_100735030 3300005578 Unclassified 855
55 Ga0068856_100252360 3300005614 Bacteria 1779
56 Ga0068856_100322847 3300005614 Bacteria 1561
57 Ga0068852_100000852 3300005616 Bacteria 20278
58 Ga0068852_100629157 3300005616 Bacteria 1079
59 Ga0068852_100676702 3300005616 Bacteria 1041
60 Ga0075366_10000185 3300006195 Bacteria 27369
61 Ga0097621_100000152 3300006237 Bacteria 42727
62 Ga0097621_100608511 3300006237 Bacteria 999
63 Ga0075370_10220006 3300006353 Bacteria 1122
64 Ga0068871_100000229 3300006358 Bacteria 39643
65 Ga0068865_100000505 3300006881 Bacteria 21848
66 Ga0068865_100952101 3300006881 Unclassified 749
67 Ga0105240_10000068 3300009093 Bacteria 207756
68 Ga0105240_10040923 3300009093 Bacteria 5921
69 Ga0105240_10045873 3300009093 Bacteria 5542
70 Ga0105240_10069608 3300009093 Bacteria 4354
71 Ga0105240_10126425 3300009093 Unclassified 3072
72 Ga0105240_10380527 3300009093 Bacteria 1594
73 Ga0105240_10925590 3300009093 Unclassified 936
74 Ga0105240_11115279 3300009093 Bacteria 839
75 Ga0105243_10187221 3300009148 Unclassified 1805
76 Ga0105241_10001074 3300009174 Bacteria 20835
77 Ga0105241_10145372 3300009174 Bacteria 1934
78 Ga0105241_10178381 3300009174 Unclassified 1760
79 Ga0105241_10270390 3300009174 Bacteria 1448
80 Ga0105241_10883847 3300009174 Bacteria 829
81 Ga0105237_10000274 3300009545 Bacteria 72354
82 Ga0105237_10000356 3300009545 Bacteria 64629
83 Ga0105237_10001345 3300009545 Bacteria 32570
84 Ga0105237_10008288 3300009545 Bacteria 11285
85 Ga0105237_10200823 3300009545 Bacteria 1994
86 Ga0105237_10855974 3300009545 Bacteria 916
87 Ga0105238_10204668 3300009551 Bacteria 1949
88 Ga0105239_10000010 3300010375 Bacteria 341545
89 Ga0105239_10000081 3300010375 Bacteria 133686
90 Ga0105239_10002065 3300010375 Bacteria 26034
91 Ga0105239_10025167 3300010375 Bacteria 6555
92 Ga0105239_10052997 3300010375 Bacteria 4450
93 Ga0105239_10069429 3300010375 Bacteria 3872
94 Ga0105239_10103603 3300010375 Bacteria 3150
95 Ga0105246_10025468 3300011119 Bacteria 3856
96 Ga0105246_10085374 3300011119 Bacteria 2260
97 Ga0105246_10376561 3300011119 Bacteria 1171
98 Ga0157373_10000362 3300013100 Bacteria 36427
99 Ga0157373_10005177 3300013100 Bacteria 9798
100 Ga0157371_10000382 3300013102 Bacteria 55677
101 Ga0157371_10005952 3300013102 Bacteria 10180
102 Ga0157371_10077739 3300013102 Bacteria 2350
103 Ga0157370_10036830 3300013104 Bacteria 4745
104 Ga0157370_10070043 3300013104 Bacteria 3311
105 Ga0157369_10008581 3300013105 Bacteria 11719
106 Ga0157369_10123317 3300013105 Unclassified 2748
107 Ga0157369_10281662 3300013105 Bacteria 1731
108 Ga0157374_10022762 3300013296 Bacteria 5595
109 Ga0157374_10203545 3300013296 Bacteria 1939
110 Ga0157374_10326382 3300013296 Bacteria 1522
111 Ga0157378_10024121 3300013297 Bacteria 5351
112 Ga0157378_10027723 3300013297 Bacteria 4995
113 Ga0163162_10006202 3300013306 Bacteria 11584
114 Ga0163162_10013403 3300013306 Bacteria 8004
115 Ga0157372_10000001 3300013307 Bacteria 791349
116 Ga0157372_10000372 3300013307 Bacteria 49527
117 Ga0157372_10001733 3300013307 Bacteria 23656
118 Ga0157372_10006491 3300013307 Bacteria 12448
119 Ga0157372_10055309 3300013307 Bacteria 4431
120 Ga0157372_10328259 3300013307 Bacteria 1781
121 Ga0182007_10060252 3300015262 Bacteria 1244
122 Ga0163161_10384106 3300017792 Bacteria 1123
123 Ga0213872_10141526 3300021361 Unclassified 1055
124 Ga0207427_100163 3300025231 Bacteria 74501
125 Ga0209437_100085 3300025233 Bacteria 254790
126 Ga0209437_100101 3300025233 Bacteria 226668
127 Ga0209026_1001403 3300025250 Bacteria 10725
128 Ga0209026_1002949 3300025250 Bacteria 5931
129 Ga0209026_1007155 3300025250 Bacteria 2576
130 Ga0209129_1022985 3300025258 Bacteria 1119
131 Ga0209233_1000124 3300025261 Bacteria 226743
132 Ga0209233_1001261 3300025261 Bacteria 10166
133 Ga0209233_1001786 3300025261 Bacteria 8285
134 Ga0207647_10000356 3300025904 Bacteria 37148
135 Ga0207647_10001659 3300025904 Bacteria 17144
136 Ga0207645_10001018 3300025907 Bacteria 23159
137 Ga0207705_10000015 3300025909 Bacteria 382901
138 Ga0207705_10219997 3300025909 Bacteria 1442
139 Ga0207705_10307288 3300025909 Bacteria 1217
140 Ga0207654_10004098 3300025911 Bacteria 7340
141 Ga0207654_10029576 3300025911 Bacteria 3001
142 Ga0207654_10075802 3300025911 Unclassified 2011
143 Ga0207654_10108716 3300025911 Bacteria 1721
144 Ga0207695_10000131 3300025913 Bacteria 223762
145 Ga0207695_10002296 3300025913 Bacteria 28532
146 Ga0207695_10004588 3300025913 Bacteria 18767
147 Ga0207695_10043863 3300025913 Bacteria 4761
148 Ga0207695_10095141 3300025913 Unclassified 2984
149 Ga0207671_10000993 3300025914 Bacteria 34894
150 Ga0207671_10002287 3300025914 Bacteria 20732
151 Ga0207671_10006260 3300025914 Bacteria 10658
152 Ga0207671_10008102 3300025914 Bacteria 8971
153 Ga0207671_10352397 3300025914 Bacteria 1167
154 Ga0207657_10310008 3300025919 Bacteria 1249
155 Ga0207657_10386130 3300025919 Unclassified 1102
156 Ga0207694_10132022 3300025924 Bacteria 2002
157 Ga0207659_10473675 3300025926 Bacteria 1057
158 Ga0207690_10001548 3300025932 Bacteria 14396
159 Ga0207690_10020021 3300025932 Bacteria 4128
160 Ga0207706_10000126 3300025933 Bacteria 82630
161 Ga0207709_10157875 3300025935 Bacteria 1578
162 Ga0207704_10000209 3300025938 Bacteria 29657
163 Ga0207667_10000037 3300025949 Bacteria 297252
164 Ga0207667_10001001 3300025949 Bacteria 36044
165 Ga0207667_10010192 3300025949 Bacteria 11007
166 Ga0207667_10027834 3300025949 Bacteria 6146
167 Ga0207667_10052456 3300025949 Bacteria 4295
168 Ga0207667_10226344 3300025949 Unclassified 1916
169 Ga0207667_10297447 3300025949 Bacteria 1649
170 Ga0207651_10215298 3300025960 Bacteria 1549
171 Ga0207677_10117779 3300026023 Bacteria 1992
172 Ga0207639_10019697 3300026041 Bacteria 4817
173 Ga0207639_10126153 3300026041 Bacteria 2111
174 Ga0207678_10018122 3300026067 Bacteria 6184
175 Ga0207702_11291704 3300026078 Bacteria 724
176 Ga0207648_10000155 3300026089 Bacteria 69524
177 Ga0207674_10308789 3300026116 Unclassified 1531
178 Ga0207683_10012596 3300026121 Bacteria 7213
179 Ga0207698_10032979 3300026142 Bacteria 3757
180 Ga0207698_10839921 3300026142 Bacteria 923
181 Ga0268266_10000052 3300028379 Bacteria 296230
182 Ga0307517_10002873 3300028786 Bacteria 27309
183 Ga0307515_10000432 3300028794 Bacteria 100348
184 Ga0307515_10001738 3300028794 Bacteria 48492
185 Ga0265338_10042858 3300028800 Bacteria 4207
186 Ga0307509_10223004 3300031507 Bacteria 1696
187 Ga0307507_10002988 3300033179 Bacteria 33879
188 Ga0307510_10005315 3300033180 Bacteria 15324
189 Ga0373941_0029350 3300035115 Bacteria 1622
190 Ga0395899_0000001 3300037312 Bacteria 1750322
191 Ga0395899_0000402 3300037312 Bacteria 50694
192 Ga0395899_0000608 3300037312 Bacteria 37382
193 Ga0395900_0000330 3300037418 Bacteria 69819
194 Ga0395900_0002451 3300037418 Bacteria 20441
195 Ga0395900_0331139 3300037418 Unclassified 1501
196 Ga0395898_0012298 3300037466 Bacteria 8851
197 Ga0395905_0000301 3300037471 Bacteria 72121
198 Ga0395901_0004292 3300038443 Bacteria 14381
199 Ga0395901_0082308 3300038443 Bacteria 3363
200 Ga0395901_0696589 3300038443 Unclassified 1014
201 Ga0436361_0849165 3300039447 Bacteria 5333
202 Ga0439448_0063359 3300042005 Unclassified 1224
203 Ga0466972_0005073 3300044658 Bacteria 6599
204 Ga0466966_0002565 3300044684 Bacteria 11899
205 Ga0466968_0038883 3300044735 Unclassified 2000
206 Ga0466968_0132649 3300044735 Unclassified 1135
207 Ga0466959_0026531 3300045049 Bacteria 4294
208 Ga0466958_0127838 3300045836 Unclassified 1594
209 Ga0495592_0148421 3300046454 Bacteria 1624
210 Ga0495651_0157345 3300046462 Bacteria 1632
211 Ga0495650_0000003 3300046471 Bacteria 900730
212 Ga0495585_0000085 3300046492 Bacteria 97836
213 Ga0495585_0000156 3300046492 Bacteria 72941
214 Ga0495596_0097644 3300046500 Bacteria 1140
215 Ga0495583_0099242 3300046506 Bacteria 1244
216 Ga0495606_0000145 3300046507 Bacteria 122857
217 Ga0495606_0002178 3300046507 Bacteria 23544
218 Ga0495606_0041545 3300046507 Bacteria 3083
219 Ga0495610_0001185 3300046512 Bacteria 23579
220 Ga0495616_0009353 3300046513 Bacteria 5743
221 Ga0495628_0215581 3300046516 Bacteria 1443
222 Ga0495631_0008380 3300046518 Bacteria 5210
223 Ga0495637_0198993 3300046520 Bacteria 737
224 Ga0495648_0053468 3300046524 Bacteria 2447
225 Ga0495648_0202723 3300046524 Bacteria 991
226 Ga0495652_0223293 3300046529 Bacteria 1414
227 Ga0495609_0018878 3300046538 Bacteria 3193
228 Ga0495633_0000014 3300046558 Bacteria 261742
229 Ga0495633_0109290 3300046558 Unclassified 1282
230 Ga0495668_0000012 3300046616 Bacteria 458817
231 Ga0495625_0000005 3300046660 Bacteria 596135
232 Ga0495625_0007620 3300046660 Bacteria 9396
233 Ga0495625_0014911 3300046660 Bacteria 6181
234 Ga0495625_0021801 3300046660 Bacteria 4921
235 Ga0495625_0044333 3300046660 Bacteria 3221
236 Ga0495625_0090988 3300046660 Bacteria 2109
237 Ga0495661_0001748 3300046665 Bacteria 17477
238 Ga0495661_0007842 3300046665 Bacteria 7427
239 Ga0495658_0121874 3300046683 Bacteria 1578
240 Ga0495649_0000003 3300046694 Bacteria 880817
241 Ga0495660_0091292 3300046810 Bacteria 1582
242 Ga0495683_0146466 3300047323 Unclassified 1103
243 Ga0495687_000672 3300047443 Bacteria 38920
244 Ga0495687_000762 3300047443 Bacteria 34827
245 Ga0495686_0001125 3300047472 Bacteria 31631
246 Ga0495686_0006898 3300047472 Bacteria 8599
247 Ga0495686_0032325 3300047472 Bacteria 3387
248 Ga0495686_0034808 3300047472 Bacteria 3241
249 Ga0495686_0181768 3300047472 Bacteria 1218
250 Ga0495678_012208 3300049459 Bacteria 4079
251 nmdc:mga0k408_16962_c1 3300050493 Bacteria 4049
252 nmdc:mga0k408_16_c2 3300050493 Bacteria 101089
253 nmdc:mga0k408_295_c2 3300050493 Bacteria 15899
254 nmdc:mga07m45_17261_c4 3300050496 Bacteria 1611
255 Ga0500635_0007068 3300053080 Bacteria 3029
256 Ga0500635_0017993 3300053080 Unclassified 2126
257 Ga0500578_0234751 3300053086 Bacteria 1110
258 Ga0500647_0144701 3300053091 Bacteria 1113
259 Ga0500608_000451 3300053122 Bacteria 15387
260 Ga0500608_081105 3300053122 Bacteria 1530
261 Ga0500614_040320 3300053123 Bacteria 1184
262 Ga0500618_000526 3300053125 Bacteria 24101
263 Ga0500618_012037 3300053125 Bacteria 2276
264 Ga0500616_0098813 3300053153 Bacteria 1431
265 Ga0500622_0000679 3300053156 Bacteria 30085
266 Ga0500624_000290 3300053157 Bacteria 17334
267 2599477686 2599185184 Bacteria 6430550
268 2852623643 2852623160 Bacteria 4376875
269 2884937454 2884933994 Bacteria 4535041
270 2919441126 2919437846 Bacteria 6199444
271 2928079600 2928078545 Bacteria 6534839
272 2928147918 2928147474 Bacteria 6512076
273 2932086768 2932082852 Bacteria 6563563
274 2977232879 2977232053 Bacteria 5485925
275 Ga0495681_0286365
276 JGI24740J21852_10014047
277 JGI24740J21852_10061352
278 JGI24739J22299_10048441
279 JGI24735J21928_10000014
280 JGI25162J39368_1000020
281 JGI25162J39368_1002504
282 JGI25406J46586_10008238
283 JGI25165J46597_1002118
284 rootH1_10051256
285 rootH1_10055859
286 rootH2_10045710
287 rootH2_10048269
288 rootH2_10162030
289 rootL2_10169808
290 rootL2_10332650
291 rootH1_10006920
292 rootH1_10048752
293 rootH1_10127552
294 rootH1_10136779
295 rootH1_10194945
296 rootH1_10296372
297 Ga0065714_10071632
298 Ga0065714_10111482
299 Ga0070658_10136213
300 Ga0070658_10401583
301 Ga0068868_100269499
302 Ga0070660_100207715
303 Ga0070671_100025645
304 Ga0070673_100006179
305 Ga0070673_100310818
306 Ga0070659_100000231
307 Ga0070659_100014529
308 Ga0070659_100767562
309 Ga0070663_100002347
310 Ga0070678_100005787
311 Ga0070662_100000068
312 Ga0068867_100000938
313 Ga0070685_10391814
314 Ga0070684_100134125
315 Ga0068853_100089869
316 Ga0070665_100000003
317 Ga0068855_100000042
318 Ga0068855_100000652
319 Ga0068855_100009351
320 Ga0068855_100023662
321 Ga0068855_100024512
322 Ga0068855_100032375
323 Ga0068855_100158733
324 Ga0068855_100175661
325 Ga0068855_100260225
326 Ga0068857_100015205
327 Ga0068854_100735030
328 Ga0068856_100252360
329 Ga0068856_100322847
330 Ga0068852_100000852
331 Ga0068852_100629157
332 Ga0068852_100676702
333 Ga0075366_10000185
334 Ga0097621_100000152
335 Ga0097621_100608511
336 Ga0075370_10220006
337 Ga0068871_100000229
338 Ga0068865_100000505
339 Ga0068865_100952101
340 Ga0105240_10000068
341 Ga0105240_10040923
342 Ga0105240_10045873
343 Ga0105240_10069608
344 Ga0105240_10126425
345 Ga0105240_10380527
346 Ga0105240_10925590
347 Ga0105240_11115279
348 Ga0105243_10187221
349 Ga0105241_10001074
350 Ga0105241_10145372
351 Ga0105241_10178381
352 Ga0105241_10270390
353 Ga0105241_10883847
354 Ga0105237_10000274
355 Ga0105237_10000356
356 Ga0105237_10001345
357 Ga0105237_10008288
358 Ga0105237_10200823
359 Ga0105237_10855974
360 Ga0105238_10204668
361 Ga0105239_10000010
362 Ga0105239_10000081
363 Ga0105239_10002065
364 Ga0105239_10025167
365 Ga0105239_10052997
366 Ga0105239_10069429
367 Ga0105239_10103603
368 Ga0105246_10025468
369 Ga0105246_10085374
370 Ga0105246_10376561
371 Ga0157373_10000362
372 Ga0157373_10005177
373 Ga0157371_10000382
374 Ga0157371_10005952
375 Ga0157371_10077739
376 Ga0157370_10036830
377 Ga0157370_10070043
378 Ga0157369_10008581
379 Ga0157369_10123317
380 Ga0157369_10281662
381 Ga0157374_10022762
382 Ga0157374_10203545
383 Ga0157374_10326382
384 Ga0157378_10024121
385 Ga0157378_10027723
386 Ga0163162_10006202
387 Ga0163162_10013403
388 Ga0157372_10000001
389 Ga0157372_10000372
390 Ga0157372_10001733
391 Ga0157372_10006491
392 Ga0157372_10055309
393 Ga0157372_10328259
394 Ga0182007_10060252
395 Ga0163161_10384106
396 Ga0213872_10141526
397 Ga0207427_100163
398 Ga0209437_100085
399 Ga0209437_100101
400 Ga0209026_1001403
401 Ga0209026_1002949
402 Ga0209026_1007155
403 Ga0209129_1022985
404 Ga0209233_1000124
405 Ga0209233_1001261
406 Ga0209233_1001786
407 Ga0207647_10000356
408 Ga0207647_10001659
409 Ga0207645_10001018
410 Ga0207705_10000015
411 Ga0207705_10219997
412 Ga0207705_10307288
413 Ga0207654_10004098
414 Ga0207654_10029576
415 Ga0207654_10075802
416 Ga0207654_10108716
417 Ga0207695_10000131
418 Ga0207695_10002296
419 Ga0207695_10004588
420 Ga0207695_10043863
421 Ga0207695_10095141
422 Ga0207671_10000993
423 Ga0207671_10002287
424 Ga0207671_10006260
425 Ga0207671_10008102
426 Ga0207671_10352397
427 Ga0207657_10310008
428 Ga0207657_10386130
429 Ga0207694_10132022
430 Ga0207659_10473675
431 Ga0207690_10001548
432 Ga0207690_10020021
433 Ga0207706_10000126
434 Ga0207709_10157875
435 Ga0207704_10000209
436 Ga0207667_10000037
437 Ga0207667_10001001
438 Ga0207667_10010192
439 Ga0207667_10027834
440 Ga0207667_10052456
441 Ga0207667_10226344
442 Ga0207667_10297447
443 Ga0207651_10215298
444 Ga0207677_10117779
445 Ga0207639_10019697
446 Ga0207639_10126153
447 Ga0207678_10018122
448 Ga0207702_11291704
449 Ga0207648_10000155
450 Ga0207674_10308789
451 Ga0207683_10012596
452 Ga0207698_10032979
453 Ga0207698_10839921
454 Ga0268266_10000052
455 Ga0307517_10002873
456 Ga0307515_10000432
457 Ga0307515_10001738
458 Ga0265338_10042858
459 Ga0307509_10223004
460 Ga0307507_10002988
461 Ga0307510_10005315
462 Ga0373941_0029350
463 Ga0395899_0000001
464 Ga0395899_0000402
465 Ga0395899_0000608
466 Ga0395900_0000330
467 Ga0395900_0002451
468 Ga0395900_0331139
469 Ga0395898_0012298
470 Ga0395905_0000301
471 Ga0395901_0004292
472 Ga0395901_0082308
473 Ga0395901_0696589
474 Ga0436361_0849165
475 Ga0439448_0063359
476 Ga0466972_0005073
477 Ga0466966_0002565
478 Ga0466968_0038883
479 Ga0466968_0132649
480 Ga0466959_0026531
481 Ga0466958_0127838
482 Ga0495592_0148421
483 Ga0495651_0157345
484 Ga0495650_0000003
485 Ga0495585_0000085
486 Ga0495585_0000156
487 Ga0495596_0097644
488 Ga0495583_0099242
489 Ga0495606_0000145
490 Ga0495606_0002178
491 Ga0495606_0041545
492 Ga0495610_0001185
493 Ga0495616_0009353
494 Ga0495628_0215581
495 Ga0495631_0008380
496 Ga0495637_0198993
497 Ga0495648_0053468
498 Ga0495648_0202723
499 Ga0495652_0223293
500 Ga0495609_0018878
501 Ga0495633_0000014
502 Ga0495633_0109290
503 Ga0495668_0000012
504 Ga0495625_0000005
505 Ga0495625_0007620
506 Ga0495625_0014911
507 Ga0495625_0021801
508 Ga0495625_0044333
509 Ga0495625_0090988
510 Ga0495661_0001748
511 Ga0495661_0007842
512 Ga0495658_0121874
513 Ga0495649_0000003
514 Ga0495660_0091292
515 Ga0495683_0146466
516 Ga0495687_000672
517 Ga0495687_000762
518 Ga0495686_0001125
519 Ga0495686_0006898
520 Ga0495686_0032325
521 Ga0495686_0034808
522 Ga0495686_0181768
523 Ga0495678_012208
524 nmdc:mga0k408_16962_c1
525 nmdc:mga0k408_16_c2
526 nmdc:mga0k408_295_c2
527 nmdc:mga07m45_17261_c4
528 Ga0500635_0007068
529 Ga0500635_0017993
530 Ga0500578_0234751
531 Ga0500647_0144701
532 Ga0500608_000451
533 Ga0500608_081105
534 Ga0500614_040320
535 Ga0500618_000526
536 Ga0500618_012037
537 Ga0500616_0098813
538 Ga0500622_0000679
539 Ga0500624_000290
540 2599477686
541 2852623643
542 2884937454
543 2919441126
544 2928079600
545 2928147918
546 2932086768
547 2977232879

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02245

Pur_DNA_glyco

Methylpurine-DNA glycosylase (MPG)

7

83

0.95

PF02245

Pur_DNA_glyco

Methylpurine-DNA glycosylase (MPG)

77

165

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bnk-assembly1.cif.gz_A human 3-methyladenine dna glycosylase complexed to dna 0.9545 2 195
3uby-assembly1.cif.gz_A crystal structure of human alklyadenine dna glycosylase in a lower and higher-affinity complex with dna 0.9499 1 200
1f4r-assembly1.cif.gz_A crystal structure of the human aag dna repair glycosylase complexed with 1,n6-ethenoadenine-dna 0.9458 2 195
1ewn-assembly1.cif.gz_A crystal structure of the human aag dna repair glycosylase complexed with 1,n6-ethenoadenine-dna 0.9413 2 195
3qi5-assembly2.cif.gz_B crystal structure of human alkyladenine dna glycosylase in complex with 3,n4-ethenocystosine containing duplex dna 0.9341 1 195
ID Description Score Start End Superfamily
af_Q2FVS1_1_195_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9605 8 197 3.10.300.10
1f4rA00 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9458 2 195 3.10.300.10
af_Q0DX49_88_284_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9302 2 199 3.10.300.10
af_Q8IKG6_109_302_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9293 20 145 3.10.300.10
af_Q2FVS1_1_195_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9127 8 197 3.10.300.10
ID Description Score Start End GO Terms
AF-A0A6I4INA1-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.9994 1 200 GO:0003677
GO:0003905
GO:0006284
AF-A0A7Y3WBV2-F1-model_v4 deleted 0.9987 1 200
AF-A0A563U431-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.9987 1 200 GO:0003677
GO:0003905
GO:0006284
AF-A0A4V1SRQ7-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.9986 1 200 GO:0003677
GO:0003905
GO:0006284
AF-A0A3S0E6D0-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.9967 2 196 GO:0003677
GO:0003905
GO:0006284

Map