F379262
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 273 | 147 | 547 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300047470|Ga0495681_0286365|Ga0495681_0286365_46_564 |
| Length | 172 |
| Sequence | MKLTEDYYLGNDVVAISKNLLGKYLFTCIDGVTTGGYIVETEAYNGIVDKASHSFGNRMTPRTKTMFMQGGIAYVYLCDGIEAMQARRNMLVLKSTITSGPGSVAKALGISRNINAISLQSDTLWLEDRGLNFTDEQINIGPRIGVSYAAEDAFLPYRFYVKGNKYVSKPNK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 55 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 58 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 85 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 86 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 87 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 88 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 89 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 90 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 91 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 92 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 93 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 94 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 95 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 96 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 97 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 98 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 99 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 100 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 101 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 102 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 103 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 130 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 131 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 132 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 133 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 134 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 135 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 136 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 137 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 138 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 139 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 140 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 141 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 142 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 143 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 144 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 145 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 146 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 147 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.07 |
| Metatranscriptomes | 0 |
| Isolates | 2.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.26 |
| Nodule | 0 |
| Rhizoplane | 0.37 |
| Rhizosphere | 80.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495681_0286365 | 3300047470 | Bacteria | 641 |
| 2 | JGI24740J21852_10014047 | 3300001979 | Bacteria | 2967 |
| 3 | JGI24740J21852_10061352 | 3300001979 | Bacteria | 1036 |
| 4 | JGI24739J22299_10048441 | 3300001989 | Bacteria | 1382 |
| 5 | JGI24735J21928_10000014 | 3300002067 | Bacteria | 186670 |
| 6 | JGI25162J39368_1000020 | 3300002737 | Bacteria | 254723 |
| 7 | JGI25162J39368_1002504 | 3300002737 | Bacteria | 7033 |
| 8 | JGI25406J46586_10008238 | 3300003203 | Bacteria | 4730 |
| 9 | JGI25165J46597_1002118 | 3300003214 | Bacteria | 7197 |
| 10 | rootH1_10051256 | 3300003316 | Bacteria | 2259 |
| 11 | rootH1_10055859 | 3300003316 | Bacteria | 4271 |
| 12 | rootH1_10055859 | 3300003323 | Bacteria | 4451 |
| 13 | rootH2_10045710 | 3300003320 | Bacteria | 24416 |
| 14 | rootH2_10048269 | 3300003320 | Bacteria | 27648 |
| 15 | rootH2_10162030 | 3300003320 | Unclassified | 1156 |
| 16 | rootL2_10169808 | 3300003322 | Bacteria | 1395 |
| 17 | rootL2_10332650 | 3300003322 | Bacteria | 1589 |
| 18 | rootH1_10006920 | 3300003323 | Bacteria | 63684 |
| 19 | rootH1_10048752 | 3300003323 | Bacteria | 4770 |
| 20 | rootH1_10127552 | 3300003323 | Bacteria | 5677 |
| 21 | rootH1_10136779 | 3300003323 | Bacteria | 1914 |
| 22 | rootH1_10194945 | 3300003323 | Bacteria | 2159 |
| 23 | rootH1_10296372 | 3300003323 | Bacteria | 1212 |
| 24 | Ga0065714_10071632 | 3300005288 | Bacteria | 3526 |
| 25 | Ga0065714_10111482 | 3300005288 | Bacteria | 1470 |
| 26 | Ga0070658_10136213 | 3300005327 | Bacteria | 2049 |
| 27 | Ga0070658_10401583 | 3300005327 | Unclassified | 1177 |
| 28 | Ga0068868_100269499 | 3300005338 | Bacteria | 1438 |
| 29 | Ga0070660_100207715 | 3300005339 | Bacteria | 1589 |
| 30 | Ga0070671_100025645 | 3300005355 | Bacteria | 4839 |
| 31 | Ga0070673_100006179 | 3300005364 | Bacteria | 7766 |
| 32 | Ga0070673_100310818 | 3300005364 | Bacteria | 1390 |
| 33 | Ga0070659_100000231 | 3300005366 | Bacteria | 43452 |
| 34 | Ga0070659_100014529 | 3300005366 | Bacteria | 5884 |
| 35 | Ga0070659_100767562 | 3300005366 | Bacteria | 837 |
| 36 | Ga0070663_100002347 | 3300005455 | Bacteria | 10638 |
| 37 | Ga0070678_100005787 | 3300005456 | Bacteria | 7194 |
| 38 | Ga0070662_100000068 | 3300005457 | Bacteria | 56624 |
| 39 | Ga0068867_100000938 | 3300005459 | Bacteria | 19833 |
| 40 | Ga0070685_10391814 | 3300005466 | Unclassified | 960 |
| 41 | Ga0070684_100134125 | 3300005535 | Unclassified | 2235 |
| 42 | Ga0068853_100089869 | 3300005539 | Bacteria | 2698 |
| 43 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 44 | Ga0068855_100000042 | 3300005563 | Bacteria | 149332 |
| 45 | Ga0068855_100000652 | 3300005563 | Bacteria | 42351 |
| 46 | Ga0068855_100009351 | 3300005563 | Bacteria | 11833 |
| 47 | Ga0068855_100023662 | 3300005563 | Bacteria | 7356 |
| 48 | Ga0068855_100024512 | 3300005563 | Bacteria | 7219 |
| 49 | Ga0068855_100032375 | 3300005563 | Bacteria | 6244 |
| 50 | Ga0068855_100158733 | 3300005563 | Bacteria | 2568 |
| 51 | Ga0068855_100175661 | 3300005563 | Unclassified | 2424 |
| 52 | Ga0068855_100260225 | 3300005563 | Bacteria | 1933 |
| 53 | Ga0068857_100015205 | 3300005577 | Bacteria | 6716 |
| 54 | Ga0068854_100735030 | 3300005578 | Unclassified | 855 |
| 55 | Ga0068856_100252360 | 3300005614 | Bacteria | 1779 |
| 56 | Ga0068856_100322847 | 3300005614 | Bacteria | 1561 |
| 57 | Ga0068852_100000852 | 3300005616 | Bacteria | 20278 |
| 58 | Ga0068852_100629157 | 3300005616 | Bacteria | 1079 |
| 59 | Ga0068852_100676702 | 3300005616 | Bacteria | 1041 |
| 60 | Ga0075366_10000185 | 3300006195 | Bacteria | 27369 |
| 61 | Ga0097621_100000152 | 3300006237 | Bacteria | 42727 |
| 62 | Ga0097621_100608511 | 3300006237 | Bacteria | 999 |
| 63 | Ga0075370_10220006 | 3300006353 | Bacteria | 1122 |
| 64 | Ga0068871_100000229 | 3300006358 | Bacteria | 39643 |
| 65 | Ga0068865_100000505 | 3300006881 | Bacteria | 21848 |
| 66 | Ga0068865_100952101 | 3300006881 | Unclassified | 749 |
| 67 | Ga0105240_10000068 | 3300009093 | Bacteria | 207756 |
| 68 | Ga0105240_10040923 | 3300009093 | Bacteria | 5921 |
| 69 | Ga0105240_10045873 | 3300009093 | Bacteria | 5542 |
| 70 | Ga0105240_10069608 | 3300009093 | Bacteria | 4354 |
| 71 | Ga0105240_10126425 | 3300009093 | Unclassified | 3072 |
| 72 | Ga0105240_10380527 | 3300009093 | Bacteria | 1594 |
| 73 | Ga0105240_10925590 | 3300009093 | Unclassified | 936 |
| 74 | Ga0105240_11115279 | 3300009093 | Bacteria | 839 |
| 75 | Ga0105243_10187221 | 3300009148 | Unclassified | 1805 |
| 76 | Ga0105241_10001074 | 3300009174 | Bacteria | 20835 |
| 77 | Ga0105241_10145372 | 3300009174 | Bacteria | 1934 |
| 78 | Ga0105241_10178381 | 3300009174 | Unclassified | 1760 |
| 79 | Ga0105241_10270390 | 3300009174 | Bacteria | 1448 |
| 80 | Ga0105241_10883847 | 3300009174 | Bacteria | 829 |
| 81 | Ga0105237_10000274 | 3300009545 | Bacteria | 72354 |
| 82 | Ga0105237_10000356 | 3300009545 | Bacteria | 64629 |
| 83 | Ga0105237_10001345 | 3300009545 | Bacteria | 32570 |
| 84 | Ga0105237_10008288 | 3300009545 | Bacteria | 11285 |
| 85 | Ga0105237_10200823 | 3300009545 | Bacteria | 1994 |
| 86 | Ga0105237_10855974 | 3300009545 | Bacteria | 916 |
| 87 | Ga0105238_10204668 | 3300009551 | Bacteria | 1949 |
| 88 | Ga0105239_10000010 | 3300010375 | Bacteria | 341545 |
| 89 | Ga0105239_10000081 | 3300010375 | Bacteria | 133686 |
| 90 | Ga0105239_10002065 | 3300010375 | Bacteria | 26034 |
| 91 | Ga0105239_10025167 | 3300010375 | Bacteria | 6555 |
| 92 | Ga0105239_10052997 | 3300010375 | Bacteria | 4450 |
| 93 | Ga0105239_10069429 | 3300010375 | Bacteria | 3872 |
| 94 | Ga0105239_10103603 | 3300010375 | Bacteria | 3150 |
| 95 | Ga0105246_10025468 | 3300011119 | Bacteria | 3856 |
| 96 | Ga0105246_10085374 | 3300011119 | Bacteria | 2260 |
| 97 | Ga0105246_10376561 | 3300011119 | Bacteria | 1171 |
| 98 | Ga0157373_10000362 | 3300013100 | Bacteria | 36427 |
| 99 | Ga0157373_10005177 | 3300013100 | Bacteria | 9798 |
| 100 | Ga0157371_10000382 | 3300013102 | Bacteria | 55677 |
| 101 | Ga0157371_10005952 | 3300013102 | Bacteria | 10180 |
| 102 | Ga0157371_10077739 | 3300013102 | Bacteria | 2350 |
| 103 | Ga0157370_10036830 | 3300013104 | Bacteria | 4745 |
| 104 | Ga0157370_10070043 | 3300013104 | Bacteria | 3311 |
| 105 | Ga0157369_10008581 | 3300013105 | Bacteria | 11719 |
| 106 | Ga0157369_10123317 | 3300013105 | Unclassified | 2748 |
| 107 | Ga0157369_10281662 | 3300013105 | Bacteria | 1731 |
| 108 | Ga0157374_10022762 | 3300013296 | Bacteria | 5595 |
| 109 | Ga0157374_10203545 | 3300013296 | Bacteria | 1939 |
| 110 | Ga0157374_10326382 | 3300013296 | Bacteria | 1522 |
| 111 | Ga0157378_10024121 | 3300013297 | Bacteria | 5351 |
| 112 | Ga0157378_10027723 | 3300013297 | Bacteria | 4995 |
| 113 | Ga0163162_10006202 | 3300013306 | Bacteria | 11584 |
| 114 | Ga0163162_10013403 | 3300013306 | Bacteria | 8004 |
| 115 | Ga0157372_10000001 | 3300013307 | Bacteria | 791349 |
| 116 | Ga0157372_10000372 | 3300013307 | Bacteria | 49527 |
| 117 | Ga0157372_10001733 | 3300013307 | Bacteria | 23656 |
| 118 | Ga0157372_10006491 | 3300013307 | Bacteria | 12448 |
| 119 | Ga0157372_10055309 | 3300013307 | Bacteria | 4431 |
| 120 | Ga0157372_10328259 | 3300013307 | Bacteria | 1781 |
| 121 | Ga0182007_10060252 | 3300015262 | Bacteria | 1244 |
| 122 | Ga0163161_10384106 | 3300017792 | Bacteria | 1123 |
| 123 | Ga0213872_10141526 | 3300021361 | Unclassified | 1055 |
| 124 | Ga0207427_100163 | 3300025231 | Bacteria | 74501 |
| 125 | Ga0209437_100085 | 3300025233 | Bacteria | 254790 |
| 126 | Ga0209437_100101 | 3300025233 | Bacteria | 226668 |
| 127 | Ga0209026_1001403 | 3300025250 | Bacteria | 10725 |
| 128 | Ga0209026_1002949 | 3300025250 | Bacteria | 5931 |
| 129 | Ga0209026_1007155 | 3300025250 | Bacteria | 2576 |
| 130 | Ga0209129_1022985 | 3300025258 | Bacteria | 1119 |
| 131 | Ga0209233_1000124 | 3300025261 | Bacteria | 226743 |
| 132 | Ga0209233_1001261 | 3300025261 | Bacteria | 10166 |
| 133 | Ga0209233_1001786 | 3300025261 | Bacteria | 8285 |
| 134 | Ga0207647_10000356 | 3300025904 | Bacteria | 37148 |
| 135 | Ga0207647_10001659 | 3300025904 | Bacteria | 17144 |
| 136 | Ga0207645_10001018 | 3300025907 | Bacteria | 23159 |
| 137 | Ga0207705_10000015 | 3300025909 | Bacteria | 382901 |
| 138 | Ga0207705_10219997 | 3300025909 | Bacteria | 1442 |
| 139 | Ga0207705_10307288 | 3300025909 | Bacteria | 1217 |
| 140 | Ga0207654_10004098 | 3300025911 | Bacteria | 7340 |
| 141 | Ga0207654_10029576 | 3300025911 | Bacteria | 3001 |
| 142 | Ga0207654_10075802 | 3300025911 | Unclassified | 2011 |
| 143 | Ga0207654_10108716 | 3300025911 | Bacteria | 1721 |
| 144 | Ga0207695_10000131 | 3300025913 | Bacteria | 223762 |
| 145 | Ga0207695_10002296 | 3300025913 | Bacteria | 28532 |
| 146 | Ga0207695_10004588 | 3300025913 | Bacteria | 18767 |
| 147 | Ga0207695_10043863 | 3300025913 | Bacteria | 4761 |
| 148 | Ga0207695_10095141 | 3300025913 | Unclassified | 2984 |
| 149 | Ga0207671_10000993 | 3300025914 | Bacteria | 34894 |
| 150 | Ga0207671_10002287 | 3300025914 | Bacteria | 20732 |
| 151 | Ga0207671_10006260 | 3300025914 | Bacteria | 10658 |
| 152 | Ga0207671_10008102 | 3300025914 | Bacteria | 8971 |
| 153 | Ga0207671_10352397 | 3300025914 | Bacteria | 1167 |
| 154 | Ga0207657_10310008 | 3300025919 | Bacteria | 1249 |
| 155 | Ga0207657_10386130 | 3300025919 | Unclassified | 1102 |
| 156 | Ga0207694_10132022 | 3300025924 | Bacteria | 2002 |
| 157 | Ga0207659_10473675 | 3300025926 | Bacteria | 1057 |
| 158 | Ga0207690_10001548 | 3300025932 | Bacteria | 14396 |
| 159 | Ga0207690_10020021 | 3300025932 | Bacteria | 4128 |
| 160 | Ga0207706_10000126 | 3300025933 | Bacteria | 82630 |
| 161 | Ga0207709_10157875 | 3300025935 | Bacteria | 1578 |
| 162 | Ga0207704_10000209 | 3300025938 | Bacteria | 29657 |
| 163 | Ga0207667_10000037 | 3300025949 | Bacteria | 297252 |
| 164 | Ga0207667_10001001 | 3300025949 | Bacteria | 36044 |
| 165 | Ga0207667_10010192 | 3300025949 | Bacteria | 11007 |
| 166 | Ga0207667_10027834 | 3300025949 | Bacteria | 6146 |
| 167 | Ga0207667_10052456 | 3300025949 | Bacteria | 4295 |
| 168 | Ga0207667_10226344 | 3300025949 | Unclassified | 1916 |
| 169 | Ga0207667_10297447 | 3300025949 | Bacteria | 1649 |
| 170 | Ga0207651_10215298 | 3300025960 | Bacteria | 1549 |
| 171 | Ga0207677_10117779 | 3300026023 | Bacteria | 1992 |
| 172 | Ga0207639_10019697 | 3300026041 | Bacteria | 4817 |
| 173 | Ga0207639_10126153 | 3300026041 | Bacteria | 2111 |
| 174 | Ga0207678_10018122 | 3300026067 | Bacteria | 6184 |
| 175 | Ga0207702_11291704 | 3300026078 | Bacteria | 724 |
| 176 | Ga0207648_10000155 | 3300026089 | Bacteria | 69524 |
| 177 | Ga0207674_10308789 | 3300026116 | Unclassified | 1531 |
| 178 | Ga0207683_10012596 | 3300026121 | Bacteria | 7213 |
| 179 | Ga0207698_10032979 | 3300026142 | Bacteria | 3757 |
| 180 | Ga0207698_10839921 | 3300026142 | Bacteria | 923 |
| 181 | Ga0268266_10000052 | 3300028379 | Bacteria | 296230 |
| 182 | Ga0307517_10002873 | 3300028786 | Bacteria | 27309 |
| 183 | Ga0307515_10000432 | 3300028794 | Bacteria | 100348 |
| 184 | Ga0307515_10001738 | 3300028794 | Bacteria | 48492 |
| 185 | Ga0265338_10042858 | 3300028800 | Bacteria | 4207 |
| 186 | Ga0307509_10223004 | 3300031507 | Bacteria | 1696 |
| 187 | Ga0307507_10002988 | 3300033179 | Bacteria | 33879 |
| 188 | Ga0307510_10005315 | 3300033180 | Bacteria | 15324 |
| 189 | Ga0373941_0029350 | 3300035115 | Bacteria | 1622 |
| 190 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 191 | Ga0395899_0000402 | 3300037312 | Bacteria | 50694 |
| 192 | Ga0395899_0000608 | 3300037312 | Bacteria | 37382 |
| 193 | Ga0395900_0000330 | 3300037418 | Bacteria | 69819 |
| 194 | Ga0395900_0002451 | 3300037418 | Bacteria | 20441 |
| 195 | Ga0395900_0331139 | 3300037418 | Unclassified | 1501 |
| 196 | Ga0395898_0012298 | 3300037466 | Bacteria | 8851 |
| 197 | Ga0395905_0000301 | 3300037471 | Bacteria | 72121 |
| 198 | Ga0395901_0004292 | 3300038443 | Bacteria | 14381 |
| 199 | Ga0395901_0082308 | 3300038443 | Bacteria | 3363 |
| 200 | Ga0395901_0696589 | 3300038443 | Unclassified | 1014 |
| 201 | Ga0436361_0849165 | 3300039447 | Bacteria | 5333 |
| 202 | Ga0439448_0063359 | 3300042005 | Unclassified | 1224 |
| 203 | Ga0466972_0005073 | 3300044658 | Bacteria | 6599 |
| 204 | Ga0466966_0002565 | 3300044684 | Bacteria | 11899 |
| 205 | Ga0466968_0038883 | 3300044735 | Unclassified | 2000 |
| 206 | Ga0466968_0132649 | 3300044735 | Unclassified | 1135 |
| 207 | Ga0466959_0026531 | 3300045049 | Bacteria | 4294 |
| 208 | Ga0466958_0127838 | 3300045836 | Unclassified | 1594 |
| 209 | Ga0495592_0148421 | 3300046454 | Bacteria | 1624 |
| 210 | Ga0495651_0157345 | 3300046462 | Bacteria | 1632 |
| 211 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 212 | Ga0495585_0000085 | 3300046492 | Bacteria | 97836 |
| 213 | Ga0495585_0000156 | 3300046492 | Bacteria | 72941 |
| 214 | Ga0495596_0097644 | 3300046500 | Bacteria | 1140 |
| 215 | Ga0495583_0099242 | 3300046506 | Bacteria | 1244 |
| 216 | Ga0495606_0000145 | 3300046507 | Bacteria | 122857 |
| 217 | Ga0495606_0002178 | 3300046507 | Bacteria | 23544 |
| 218 | Ga0495606_0041545 | 3300046507 | Bacteria | 3083 |
| 219 | Ga0495610_0001185 | 3300046512 | Bacteria | 23579 |
| 220 | Ga0495616_0009353 | 3300046513 | Bacteria | 5743 |
| 221 | Ga0495628_0215581 | 3300046516 | Bacteria | 1443 |
| 222 | Ga0495631_0008380 | 3300046518 | Bacteria | 5210 |
| 223 | Ga0495637_0198993 | 3300046520 | Bacteria | 737 |
| 224 | Ga0495648_0053468 | 3300046524 | Bacteria | 2447 |
| 225 | Ga0495648_0202723 | 3300046524 | Bacteria | 991 |
| 226 | Ga0495652_0223293 | 3300046529 | Bacteria | 1414 |
| 227 | Ga0495609_0018878 | 3300046538 | Bacteria | 3193 |
| 228 | Ga0495633_0000014 | 3300046558 | Bacteria | 261742 |
| 229 | Ga0495633_0109290 | 3300046558 | Unclassified | 1282 |
| 230 | Ga0495668_0000012 | 3300046616 | Bacteria | 458817 |
| 231 | Ga0495625_0000005 | 3300046660 | Bacteria | 596135 |
| 232 | Ga0495625_0007620 | 3300046660 | Bacteria | 9396 |
| 233 | Ga0495625_0014911 | 3300046660 | Bacteria | 6181 |
| 234 | Ga0495625_0021801 | 3300046660 | Bacteria | 4921 |
| 235 | Ga0495625_0044333 | 3300046660 | Bacteria | 3221 |
| 236 | Ga0495625_0090988 | 3300046660 | Bacteria | 2109 |
| 237 | Ga0495661_0001748 | 3300046665 | Bacteria | 17477 |
| 238 | Ga0495661_0007842 | 3300046665 | Bacteria | 7427 |
| 239 | Ga0495658_0121874 | 3300046683 | Bacteria | 1578 |
| 240 | Ga0495649_0000003 | 3300046694 | Bacteria | 880817 |
| 241 | Ga0495660_0091292 | 3300046810 | Bacteria | 1582 |
| 242 | Ga0495683_0146466 | 3300047323 | Unclassified | 1103 |
| 243 | Ga0495687_000672 | 3300047443 | Bacteria | 38920 |
| 244 | Ga0495687_000762 | 3300047443 | Bacteria | 34827 |
| 245 | Ga0495686_0001125 | 3300047472 | Bacteria | 31631 |
| 246 | Ga0495686_0006898 | 3300047472 | Bacteria | 8599 |
| 247 | Ga0495686_0032325 | 3300047472 | Bacteria | 3387 |
| 248 | Ga0495686_0034808 | 3300047472 | Bacteria | 3241 |
| 249 | Ga0495686_0181768 | 3300047472 | Bacteria | 1218 |
| 250 | Ga0495678_012208 | 3300049459 | Bacteria | 4079 |
| 251 | nmdc:mga0k408_16962_c1 | 3300050493 | Bacteria | 4049 |
| 252 | nmdc:mga0k408_16_c2 | 3300050493 | Bacteria | 101089 |
| 253 | nmdc:mga0k408_295_c2 | 3300050493 | Bacteria | 15899 |
| 254 | nmdc:mga07m45_17261_c4 | 3300050496 | Bacteria | 1611 |
| 255 | Ga0500635_0007068 | 3300053080 | Bacteria | 3029 |
| 256 | Ga0500635_0017993 | 3300053080 | Unclassified | 2126 |
| 257 | Ga0500578_0234751 | 3300053086 | Bacteria | 1110 |
| 258 | Ga0500647_0144701 | 3300053091 | Bacteria | 1113 |
| 259 | Ga0500608_000451 | 3300053122 | Bacteria | 15387 |
| 260 | Ga0500608_081105 | 3300053122 | Bacteria | 1530 |
| 261 | Ga0500614_040320 | 3300053123 | Bacteria | 1184 |
| 262 | Ga0500618_000526 | 3300053125 | Bacteria | 24101 |
| 263 | Ga0500618_012037 | 3300053125 | Bacteria | 2276 |
| 264 | Ga0500616_0098813 | 3300053153 | Bacteria | 1431 |
| 265 | Ga0500622_0000679 | 3300053156 | Bacteria | 30085 |
| 266 | Ga0500624_000290 | 3300053157 | Bacteria | 17334 |
| 267 | 2599477686 | 2599185184 | Bacteria | 6430550 |
| 268 | 2852623643 | 2852623160 | Bacteria | 4376875 |
| 269 | 2884937454 | 2884933994 | Bacteria | 4535041 |
| 270 | 2919441126 | 2919437846 | Bacteria | 6199444 |
| 271 | 2928079600 | 2928078545 | Bacteria | 6534839 |
| 272 | 2928147918 | 2928147474 | Bacteria | 6512076 |
| 273 | 2932086768 | 2932082852 | Bacteria | 6563563 |
| 274 | 2977232879 | 2977232053 | Bacteria | 5485925 |
| 275 | Ga0495681_0286365 | |||
| 276 | JGI24740J21852_10014047 | |||
| 277 | JGI24740J21852_10061352 | |||
| 278 | JGI24739J22299_10048441 | |||
| 279 | JGI24735J21928_10000014 | |||
| 280 | JGI25162J39368_1000020 | |||
| 281 | JGI25162J39368_1002504 | |||
| 282 | JGI25406J46586_10008238 | |||
| 283 | JGI25165J46597_1002118 | |||
| 284 | rootH1_10051256 | |||
| 285 | rootH1_10055859 | |||
| 286 | rootH2_10045710 | |||
| 287 | rootH2_10048269 | |||
| 288 | rootH2_10162030 | |||
| 289 | rootL2_10169808 | |||
| 290 | rootL2_10332650 | |||
| 291 | rootH1_10006920 | |||
| 292 | rootH1_10048752 | |||
| 293 | rootH1_10127552 | |||
| 294 | rootH1_10136779 | |||
| 295 | rootH1_10194945 | |||
| 296 | rootH1_10296372 | |||
| 297 | Ga0065714_10071632 | |||
| 298 | Ga0065714_10111482 | |||
| 299 | Ga0070658_10136213 | |||
| 300 | Ga0070658_10401583 | |||
| 301 | Ga0068868_100269499 | |||
| 302 | Ga0070660_100207715 | |||
| 303 | Ga0070671_100025645 | |||
| 304 | Ga0070673_100006179 | |||
| 305 | Ga0070673_100310818 | |||
| 306 | Ga0070659_100000231 | |||
| 307 | Ga0070659_100014529 | |||
| 308 | Ga0070659_100767562 | |||
| 309 | Ga0070663_100002347 | |||
| 310 | Ga0070678_100005787 | |||
| 311 | Ga0070662_100000068 | |||
| 312 | Ga0068867_100000938 | |||
| 313 | Ga0070685_10391814 | |||
| 314 | Ga0070684_100134125 | |||
| 315 | Ga0068853_100089869 | |||
| 316 | Ga0070665_100000003 | |||
| 317 | Ga0068855_100000042 | |||
| 318 | Ga0068855_100000652 | |||
| 319 | Ga0068855_100009351 | |||
| 320 | Ga0068855_100023662 | |||
| 321 | Ga0068855_100024512 | |||
| 322 | Ga0068855_100032375 | |||
| 323 | Ga0068855_100158733 | |||
| 324 | Ga0068855_100175661 | |||
| 325 | Ga0068855_100260225 | |||
| 326 | Ga0068857_100015205 | |||
| 327 | Ga0068854_100735030 | |||
| 328 | Ga0068856_100252360 | |||
| 329 | Ga0068856_100322847 | |||
| 330 | Ga0068852_100000852 | |||
| 331 | Ga0068852_100629157 | |||
| 332 | Ga0068852_100676702 | |||
| 333 | Ga0075366_10000185 | |||
| 334 | Ga0097621_100000152 | |||
| 335 | Ga0097621_100608511 | |||
| 336 | Ga0075370_10220006 | |||
| 337 | Ga0068871_100000229 | |||
| 338 | Ga0068865_100000505 | |||
| 339 | Ga0068865_100952101 | |||
| 340 | Ga0105240_10000068 | |||
| 341 | Ga0105240_10040923 | |||
| 342 | Ga0105240_10045873 | |||
| 343 | Ga0105240_10069608 | |||
| 344 | Ga0105240_10126425 | |||
| 345 | Ga0105240_10380527 | |||
| 346 | Ga0105240_10925590 | |||
| 347 | Ga0105240_11115279 | |||
| 348 | Ga0105243_10187221 | |||
| 349 | Ga0105241_10001074 | |||
| 350 | Ga0105241_10145372 | |||
| 351 | Ga0105241_10178381 | |||
| 352 | Ga0105241_10270390 | |||
| 353 | Ga0105241_10883847 | |||
| 354 | Ga0105237_10000274 | |||
| 355 | Ga0105237_10000356 | |||
| 356 | Ga0105237_10001345 | |||
| 357 | Ga0105237_10008288 | |||
| 358 | Ga0105237_10200823 | |||
| 359 | Ga0105237_10855974 | |||
| 360 | Ga0105238_10204668 | |||
| 361 | Ga0105239_10000010 | |||
| 362 | Ga0105239_10000081 | |||
| 363 | Ga0105239_10002065 | |||
| 364 | Ga0105239_10025167 | |||
| 365 | Ga0105239_10052997 | |||
| 366 | Ga0105239_10069429 | |||
| 367 | Ga0105239_10103603 | |||
| 368 | Ga0105246_10025468 | |||
| 369 | Ga0105246_10085374 | |||
| 370 | Ga0105246_10376561 | |||
| 371 | Ga0157373_10000362 | |||
| 372 | Ga0157373_10005177 | |||
| 373 | Ga0157371_10000382 | |||
| 374 | Ga0157371_10005952 | |||
| 375 | Ga0157371_10077739 | |||
| 376 | Ga0157370_10036830 | |||
| 377 | Ga0157370_10070043 | |||
| 378 | Ga0157369_10008581 | |||
| 379 | Ga0157369_10123317 | |||
| 380 | Ga0157369_10281662 | |||
| 381 | Ga0157374_10022762 | |||
| 382 | Ga0157374_10203545 | |||
| 383 | Ga0157374_10326382 | |||
| 384 | Ga0157378_10024121 | |||
| 385 | Ga0157378_10027723 | |||
| 386 | Ga0163162_10006202 | |||
| 387 | Ga0163162_10013403 | |||
| 388 | Ga0157372_10000001 | |||
| 389 | Ga0157372_10000372 | |||
| 390 | Ga0157372_10001733 | |||
| 391 | Ga0157372_10006491 | |||
| 392 | Ga0157372_10055309 | |||
| 393 | Ga0157372_10328259 | |||
| 394 | Ga0182007_10060252 | |||
| 395 | Ga0163161_10384106 | |||
| 396 | Ga0213872_10141526 | |||
| 397 | Ga0207427_100163 | |||
| 398 | Ga0209437_100085 | |||
| 399 | Ga0209437_100101 | |||
| 400 | Ga0209026_1001403 | |||
| 401 | Ga0209026_1002949 | |||
| 402 | Ga0209026_1007155 | |||
| 403 | Ga0209129_1022985 | |||
| 404 | Ga0209233_1000124 | |||
| 405 | Ga0209233_1001261 | |||
| 406 | Ga0209233_1001786 | |||
| 407 | Ga0207647_10000356 | |||
| 408 | Ga0207647_10001659 | |||
| 409 | Ga0207645_10001018 | |||
| 410 | Ga0207705_10000015 | |||
| 411 | Ga0207705_10219997 | |||
| 412 | Ga0207705_10307288 | |||
| 413 | Ga0207654_10004098 | |||
| 414 | Ga0207654_10029576 | |||
| 415 | Ga0207654_10075802 | |||
| 416 | Ga0207654_10108716 | |||
| 417 | Ga0207695_10000131 | |||
| 418 | Ga0207695_10002296 | |||
| 419 | Ga0207695_10004588 | |||
| 420 | Ga0207695_10043863 | |||
| 421 | Ga0207695_10095141 | |||
| 422 | Ga0207671_10000993 | |||
| 423 | Ga0207671_10002287 | |||
| 424 | Ga0207671_10006260 | |||
| 425 | Ga0207671_10008102 | |||
| 426 | Ga0207671_10352397 | |||
| 427 | Ga0207657_10310008 | |||
| 428 | Ga0207657_10386130 | |||
| 429 | Ga0207694_10132022 | |||
| 430 | Ga0207659_10473675 | |||
| 431 | Ga0207690_10001548 | |||
| 432 | Ga0207690_10020021 | |||
| 433 | Ga0207706_10000126 | |||
| 434 | Ga0207709_10157875 | |||
| 435 | Ga0207704_10000209 | |||
| 436 | Ga0207667_10000037 | |||
| 437 | Ga0207667_10001001 | |||
| 438 | Ga0207667_10010192 | |||
| 439 | Ga0207667_10027834 | |||
| 440 | Ga0207667_10052456 | |||
| 441 | Ga0207667_10226344 | |||
| 442 | Ga0207667_10297447 | |||
| 443 | Ga0207651_10215298 | |||
| 444 | Ga0207677_10117779 | |||
| 445 | Ga0207639_10019697 | |||
| 446 | Ga0207639_10126153 | |||
| 447 | Ga0207678_10018122 | |||
| 448 | Ga0207702_11291704 | |||
| 449 | Ga0207648_10000155 | |||
| 450 | Ga0207674_10308789 | |||
| 451 | Ga0207683_10012596 | |||
| 452 | Ga0207698_10032979 | |||
| 453 | Ga0207698_10839921 | |||
| 454 | Ga0268266_10000052 | |||
| 455 | Ga0307517_10002873 | |||
| 456 | Ga0307515_10000432 | |||
| 457 | Ga0307515_10001738 | |||
| 458 | Ga0265338_10042858 | |||
| 459 | Ga0307509_10223004 | |||
| 460 | Ga0307507_10002988 | |||
| 461 | Ga0307510_10005315 | |||
| 462 | Ga0373941_0029350 | |||
| 463 | Ga0395899_0000001 | |||
| 464 | Ga0395899_0000402 | |||
| 465 | Ga0395899_0000608 | |||
| 466 | Ga0395900_0000330 | |||
| 467 | Ga0395900_0002451 | |||
| 468 | Ga0395900_0331139 | |||
| 469 | Ga0395898_0012298 | |||
| 470 | Ga0395905_0000301 | |||
| 471 | Ga0395901_0004292 | |||
| 472 | Ga0395901_0082308 | |||
| 473 | Ga0395901_0696589 | |||
| 474 | Ga0436361_0849165 | |||
| 475 | Ga0439448_0063359 | |||
| 476 | Ga0466972_0005073 | |||
| 477 | Ga0466966_0002565 | |||
| 478 | Ga0466968_0038883 | |||
| 479 | Ga0466968_0132649 | |||
| 480 | Ga0466959_0026531 | |||
| 481 | Ga0466958_0127838 | |||
| 482 | Ga0495592_0148421 | |||
| 483 | Ga0495651_0157345 | |||
| 484 | Ga0495650_0000003 | |||
| 485 | Ga0495585_0000085 | |||
| 486 | Ga0495585_0000156 | |||
| 487 | Ga0495596_0097644 | |||
| 488 | Ga0495583_0099242 | |||
| 489 | Ga0495606_0000145 | |||
| 490 | Ga0495606_0002178 | |||
| 491 | Ga0495606_0041545 | |||
| 492 | Ga0495610_0001185 | |||
| 493 | Ga0495616_0009353 | |||
| 494 | Ga0495628_0215581 | |||
| 495 | Ga0495631_0008380 | |||
| 496 | Ga0495637_0198993 | |||
| 497 | Ga0495648_0053468 | |||
| 498 | Ga0495648_0202723 | |||
| 499 | Ga0495652_0223293 | |||
| 500 | Ga0495609_0018878 | |||
| 501 | Ga0495633_0000014 | |||
| 502 | Ga0495633_0109290 | |||
| 503 | Ga0495668_0000012 | |||
| 504 | Ga0495625_0000005 | |||
| 505 | Ga0495625_0007620 | |||
| 506 | Ga0495625_0014911 | |||
| 507 | Ga0495625_0021801 | |||
| 508 | Ga0495625_0044333 | |||
| 509 | Ga0495625_0090988 | |||
| 510 | Ga0495661_0001748 | |||
| 511 | Ga0495661_0007842 | |||
| 512 | Ga0495658_0121874 | |||
| 513 | Ga0495649_0000003 | |||
| 514 | Ga0495660_0091292 | |||
| 515 | Ga0495683_0146466 | |||
| 516 | Ga0495687_000672 | |||
| 517 | Ga0495687_000762 | |||
| 518 | Ga0495686_0001125 | |||
| 519 | Ga0495686_0006898 | |||
| 520 | Ga0495686_0032325 | |||
| 521 | Ga0495686_0034808 | |||
| 522 | Ga0495686_0181768 | |||
| 523 | Ga0495678_012208 | |||
| 524 | nmdc:mga0k408_16962_c1 | |||
| 525 | nmdc:mga0k408_16_c2 | |||
| 526 | nmdc:mga0k408_295_c2 | |||
| 527 | nmdc:mga07m45_17261_c4 | |||
| 528 | Ga0500635_0007068 | |||
| 529 | Ga0500635_0017993 | |||
| 530 | Ga0500578_0234751 | |||
| 531 | Ga0500647_0144701 | |||
| 532 | Ga0500608_000451 | |||
| 533 | Ga0500608_081105 | |||
| 534 | Ga0500614_040320 | |||
| 535 | Ga0500618_000526 | |||
| 536 | Ga0500618_012037 | |||
| 537 | Ga0500616_0098813 | |||
| 538 | Ga0500622_0000679 | |||
| 539 | Ga0500624_000290 | |||
| 540 | 2599477686 | |||
| 541 | 2852623643 | |||
| 542 | 2884937454 | |||
| 543 | 2919441126 | |||
| 544 | 2928079600 | |||
| 545 | 2928147918 | |||
| 546 | 2932086768 | |||
| 547 | 2977232879 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1bnk-assembly1.cif.gz_A | human 3-methyladenine dna glycosylase complexed to dna | 0.9545 | 2 | 195 |
| 3uby-assembly1.cif.gz_A | crystal structure of human alklyadenine dna glycosylase in a lower and higher-affinity complex with dna | 0.9499 | 1 | 200 |
| 1f4r-assembly1.cif.gz_A | crystal structure of the human aag dna repair glycosylase complexed with 1,n6-ethenoadenine-dna | 0.9458 | 2 | 195 |
| 1ewn-assembly1.cif.gz_A | crystal structure of the human aag dna repair glycosylase complexed with 1,n6-ethenoadenine-dna | 0.9413 | 2 | 195 |
| 3qi5-assembly2.cif.gz_B | crystal structure of human alkyladenine dna glycosylase in complex with 3,n4-ethenocystosine containing duplex dna | 0.9341 | 1 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVS1_1_195_3.10.300.10 | Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) | 0.9605 | 8 | 197 | 3.10.300.10 |
| 1f4rA00 | Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) | 0.9458 | 2 | 195 | 3.10.300.10 |
| af_Q0DX49_88_284_3.10.300.10 | Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) | 0.9302 | 2 | 199 | 3.10.300.10 |
| af_Q8IKG6_109_302_3.10.300.10 | Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) | 0.9293 | 20 | 145 | 3.10.300.10 |
| af_Q2FVS1_1_195_3.10.300.10 | Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) | 0.9127 | 8 | 197 | 3.10.300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I4INA1-F1-model_v4 | Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) | 0.9994 | 1 | 200 |
GO:0003677
GO:0003905 GO:0006284 |
| AF-A0A7Y3WBV2-F1-model_v4 | deleted | 0.9987 | 1 | 200 |
|
| AF-A0A563U431-F1-model_v4 | Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) | 0.9987 | 1 | 200 |
GO:0003677
GO:0003905 GO:0006284 |
| AF-A0A4V1SRQ7-F1-model_v4 | Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) | 0.9986 | 1 | 200 |
GO:0003677
GO:0003905 GO:0006284 |
| AF-A0A3S0E6D0-F1-model_v4 | Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) | 0.9967 | 2 | 196 |
GO:0003677
GO:0003905 GO:0006284 |