F379146
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 273 | 191 | 266 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300035398|Ga0316574_0176151|Ga0316574_0176151_478_1320 |
| Length | 280 |
| Sequence | LGAVRLAILILQRLAILSLGAVGIWLIVNVFQWVDGELPSVLALAATYGLAAYVILPYIVRMGLMVLRHQHVPSFTITGDGLPGDPVNLALVGTFDELRAAFAKAGWHEADPLTLSSSWGMVRAFILNTPYPKAPFSTLYLFGRGQDIGFQKPIGKSPRKRHHVRFWAKCLTEAETVDDVFWHGTNRPDTRERVXXXXAGTKDTGFSLTRLTFQITHATDSDTMAERDFIMAELARNGTIGMVDLYDAGEELAAGTVNHYVTDGIIAVAPLLTPPAREAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 2 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 3 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 4 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 5 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 6 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 7 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 77 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 107 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 109 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 110 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 111 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 112 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 113 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 114 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 115 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 116 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 117 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 118 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 119 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 120 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 123 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 124 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 127 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 128 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 129 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 130 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 160 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 164 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 165 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 168 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 169 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 170 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 171 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 172 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 175 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 176 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 178 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 179 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 180 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 181 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 188 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.34 |
| Metatranscriptomes | 1.1 |
| Isolates | 2.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.76 |
| Nodule | 1.83 |
| Rhizoplane | 13.92 |
| Rhizosphere | 76.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10148404 | 3300003320 | Bacteria | 1267 |
| 2 | JGI25404J52841_10000089 | 3300003659 | Bacteria | 8691 |
| 3 | Ga0070676_10045841 | 3300005328 | Bacteria | 2547 |
| 4 | Ga0070670_100151540 | 3300005331 | Bacteria | 2006 |
| 5 | Ga0070677_10067131 | 3300005333 | Bacteria | 1498 |
| 6 | Ga0068869_100035273 | 3300005334 | Bacteria | 3544 |
| 7 | Ga0070666_10136507 | 3300005335 | Bacteria | 1706 |
| 8 | Ga0070680_100027644 | 3300005336 | Bacteria | 4543 |
| 9 | Ga0070682_100030069 | 3300005337 | Bacteria | 3275 |
| 10 | Ga0070675_100320336 | 3300005354 | Bacteria | 1369 |
| 11 | Ga0070674_100177309 | 3300005356 | Bacteria | 1629 |
| 12 | Ga0070688_100192735 | 3300005365 | Unclassified | 1421 |
| 13 | Ga0070659_100278044 | 3300005366 | Bacteria | 1392 |
| 14 | Ga0070667_100132524 | 3300005367 | Bacteria | 2176 |
| 15 | Ga0070709_10031855 | 3300005434 | Bacteria | 3175 |
| 16 | Ga0070709_10338942 | 3300005434 | Unclassified | 1108 |
| 17 | Ga0070713_100083286 | 3300005436 | Bacteria | 2734 |
| 18 | Ga0070713_100091308 | 3300005436 | Bacteria | 2620 |
| 19 | Ga0070710_10088264 | 3300005437 | Bacteria | 1824 |
| 20 | Ga0070711_100013248 | 3300005439 | Bacteria | 5175 |
| 21 | Ga0070711_100019894 | 3300005439 | Bacteria | 4316 |
| 22 | Ga0070663_100046733 | 3300005455 | Bacteria | 3064 |
| 23 | Ga0070678_100020861 | 3300005456 | Bacteria | 4306 |
| 24 | Ga0070678_100374537 | 3300005456 | Bacteria | 1230 |
| 25 | Ga0070678_100460280 | 3300005456 | Unclassified | 1116 |
| 26 | Ga0070662_100006286 | 3300005457 | Bacteria | 7651 |
| 27 | Ga0070681_10100870 | 3300005458 | Bacteria | 2832 |
| 28 | Ga0070698_100053090 | 3300005471 | Bacteria | 4120 |
| 29 | Ga0070679_100019324 | 3300005530 | Bacteria | 6621 |
| 30 | Ga0068853_100168974 | 3300005539 | Bacteria | 1978 |
| 31 | Ga0070693_100230343 | 3300005547 | Unclassified | 1218 |
| 32 | Ga0070665_100064927 | 3300005548 | Bacteria | 3662 |
| 33 | Ga0070665_100201195 | 3300005548 | Bacteria | 1992 |
| 34 | Ga0070664_100396535 | 3300005564 | Unclassified | 1261 |
| 35 | Ga0068852_100454307 | 3300005616 | Bacteria | 1269 |
| 36 | Ga0068859_100036907 | 3300005617 | Bacteria | 4905 |
| 37 | Ga0068864_100008150 | 3300005618 | Bacteria | 8641 |
| 38 | Ga0068864_100211257 | 3300005618 | Bacteria | 1787 |
| 39 | Ga0068866_10161522 | 3300005718 | Bacteria | 1307 |
| 40 | Ga0068870_10087775 | 3300005840 | Bacteria | 1732 |
| 41 | Ga0068863_100069373 | 3300005841 | Unclassified | 3333 |
| 42 | Ga0068858_100154580 | 3300005842 | Unclassified | 2158 |
| 43 | Ga0068858_100286609 | 3300005842 | Bacteria | 1569 |
| 44 | Ga0068860_100130903 | 3300005843 | Bacteria | 2407 |
| 45 | Ga0068860_100864671 | 3300005843 | Unclassified | 919 |
| 46 | Ga0081455_10005996 | 3300005937 | Bacteria | 13181 |
| 47 | Ga0081455_10018676 | 3300005937 | Bacteria | 6587 |
| 48 | Ga0081455_10050891 | 3300005937 | Bacteria | 3557 |
| 49 | Ga0081540_1004495 | 3300005983 | Bacteria | 10593 |
| 50 | Ga0070717_10204933 | 3300006028 | Bacteria | 1729 |
| 51 | Ga0070717_10373310 | 3300006028 | Unclassified | 1278 |
| 52 | Ga0075368_10005101 | 3300006042 | Bacteria | 4496 |
| 53 | Ga0075364_10021945 | 3300006051 | Bacteria | 4027 |
| 54 | Ga0070716_100054542 | 3300006173 | Bacteria | 2283 |
| 55 | Ga0070712_100030059 | 3300006175 | Bacteria | 3647 |
| 56 | Ga0070712_100199000 | 3300006175 | Unclassified | 1573 |
| 57 | Ga0070712_100225781 | 3300006175 | Unclassified | 1485 |
| 58 | Ga0075362_10007723 | 3300006177 | Bacteria | 4086 |
| 59 | Ga0075367_10006473 | 3300006178 | Bacteria | 5920 |
| 60 | Ga0075369_10001562 | 3300006186 | Bacteria | 7851 |
| 61 | Ga0075366_10011123 | 3300006195 | Bacteria | 5072 |
| 62 | Ga0097621_100023644 | 3300006237 | Bacteria | 4787 |
| 63 | Ga0075430_100573923 | 3300006846 | Bacteria | 930 |
| 64 | Ga0075436_100231820 | 3300006914 | Bacteria | 1312 |
| 65 | Ga0097620_100036909 | 3300006931 | Bacteria | 4905 |
| 66 | Ga0099795_10060166 | 3300007788 | Bacteria | 1407 |
| 67 | Ga0105245_10019318 | 3300009098 | Bacteria | 5966 |
| 68 | Ga0105245_10164393 | 3300009098 | Bacteria | 2108 |
| 69 | Ga0105247_10020404 | 3300009101 | Bacteria | 3984 |
| 70 | Ga0105241_10033897 | 3300009174 | Bacteria | 3835 |
| 71 | Ga0105242_10224786 | 3300009176 | Bacteria | 1679 |
| 72 | Ga0105248_10124146 | 3300009177 | Bacteria | 2912 |
| 73 | Ga0105248_10171994 | 3300009177 | Bacteria | 2441 |
| 74 | Ga0105237_10062886 | 3300009545 | Bacteria | 3710 |
| 75 | Ga0105237_10215889 | 3300009545 | Bacteria | 1918 |
| 76 | Ga0099796_10089679 | 3300010159 | Bacteria | 1141 |
| 77 | Ga0105246_10033101 | 3300011119 | Bacteria | 3433 |
| 78 | Ga0105246_10337508 | 3300011119 | Bacteria | 1230 |
| 79 | Ga0157369_10126173 | 3300013105 | Bacteria | 2713 |
| 80 | Ga0157374_10013893 | 3300013296 | Bacteria | 7036 |
| 81 | Ga0163162_10248476 | 3300013306 | Bacteria | 1911 |
| 82 | Ga0163163_10043111 | 3300014325 | Bacteria | 4422 |
| 83 | Ga0163163_10053852 | 3300014325 | Bacteria | 3973 |
| 84 | Ga0163163_10247157 | 3300014325 | Bacteria | 1834 |
| 85 | Ga0157380_10363958 | 3300014326 | Bacteria | 1358 |
| 86 | Ga0182008_10069910 | 3300014497 | Bacteria | 1727 |
| 87 | Ga0157379_10169351 | 3300014968 | Bacteria | 1972 |
| 88 | Ga0157376_10047207 | 3300014969 | Bacteria | 3554 |
| 89 | Ga0224572_1003318 | 3300024225 | Bacteria | 2707 |
| 90 | Ga0224572_1007836 | 3300024225 | Bacteria | 1965 |
| 91 | Ga0207682_10027202 | 3300025893 | Bacteria | 2276 |
| 92 | Ga0207692_10147405 | 3300025898 | Bacteria | 1344 |
| 93 | Ga0207692_10289208 | 3300025898 | Bacteria | 994 |
| 94 | Ga0207710_10058402 | 3300025900 | Bacteria | 1744 |
| 95 | Ga0207699_10315770 | 3300025906 | Unclassified | 1095 |
| 96 | Ga0207643_10054499 | 3300025908 | Bacteria | 2273 |
| 97 | Ga0207693_10075280 | 3300025915 | Bacteria | 2644 |
| 98 | Ga0207693_10147723 | 3300025915 | Bacteria | 1848 |
| 99 | Ga0207693_10166678 | 3300025915 | Bacteria | 1734 |
| 100 | Ga0207663_10316949 | 3300025916 | Bacteria | 1170 |
| 101 | Ga0207660_10020373 | 3300025917 | Bacteria | 4449 |
| 102 | Ga0207649_10486763 | 3300025920 | Bacteria | 936 |
| 103 | Ga0207652_10003812 | 3300025921 | Bacteria | 12360 |
| 104 | Ga0207650_10146565 | 3300025925 | Bacteria | 1860 |
| 105 | Ga0207687_10006993 | 3300025927 | Bacteria | 7433 |
| 106 | Ga0207665_10055658 | 3300025939 | Bacteria | 2670 |
| 107 | Ga0207665_10213572 | 3300025939 | Bacteria | 1411 |
| 108 | Ga0207711_10029518 | 3300025941 | Bacteria | 4626 |
| 109 | Ga0207667_10017893 | 3300025949 | Bacteria | 7965 |
| 110 | Ga0207668_10024113 | 3300025972 | Bacteria | 3921 |
| 111 | Ga0207677_10026778 | 3300026023 | Bacteria | 3621 |
| 112 | Ga0207703_10016819 | 3300026035 | Bacteria | 5704 |
| 113 | Ga0207702_10026251 | 3300026078 | Bacteria | 4834 |
| 114 | Ga0207641_10004827 | 3300026088 | Bacteria | 11613 |
| 115 | Ga0207641_10284484 | 3300026088 | Bacteria | 1556 |
| 116 | Ga0207676_10472433 | 3300026095 | Unclassified | 1186 |
| 117 | Ga0207674_10174536 | 3300026116 | Bacteria | 2102 |
| 118 | Ga0207683_10327490 | 3300026121 | Unclassified | 1404 |
| 119 | Ga0209813_10003162 | 3300027866 | Bacteria | 3833 |
| 120 | Ga0207428_10114926 | 3300027907 | Bacteria | 2068 |
| 121 | Ga0268266_10005868 | 3300028379 | Bacteria | 11364 |
| 122 | Ga0268266_10054374 | 3300028379 | Bacteria | 3440 |
| 123 | Ga0268264_10077089 | 3300028381 | Bacteria | 2838 |
| 124 | Ga0265763_1001412 | 3300030763 | Bacteria | 1708 |
| 125 | Ga0265760_10008034 | 3300031090 | Unclassified | 3014 |
| 126 | Ga0265760_10014312 | 3300031090 | Bacteria | 2272 |
| 127 | Ga0265340_10107001 | 3300031247 | Bacteria | 1296 |
| 128 | Ga0265339_10004749 | 3300031249 | Bacteria | 9210 |
| 129 | Ga0316575_10003555 | 3300031665 | Bacteria | 5392 |
| 130 | Ga0316575_10016489 | 3300031665 | Bacteria | 2797 |
| 131 | Ga0316579_10002372 | 3300031691 | Bacteria | 7104 |
| 132 | Ga0316579_10008780 | 3300031691 | Bacteria | 4226 |
| 133 | Ga0316578_10008004 | 3300031728 | Bacteria | 5344 |
| 134 | Ga0316578_10110416 | 3300031728 | Bacteria | 1651 |
| 135 | Ga0316583_10005885 | 3300032133 | Bacteria | 4410 |
| 136 | Ga0316580_10026385 | 3300032139 | Bacteria | 1796 |
| 137 | Ga0373944_0043557 | 3300035089 | Bacteria | 1395 |
| 138 | Ga0373949_0061106 | 3300035090 | Bacteria | 970 |
| 139 | Ga0373946_0020998 | 3300035171 | Bacteria | 2528 |
| 140 | Ga0316574_0000249 | 3300035398 | Bacteria | 19588 |
| 141 | Ga0316574_0176151 | 3300035398 | Bacteria | 1376 |
| 142 | Ga0373924_0083496 | 3300035410 | Bacteria | 1361 |
| 143 | Ga0373931_0045376 | 3300035691 | Bacteria | 2321 |
| 144 | Ga0373931_0206019 | 3300035691 | Unclassified | 1177 |
| 145 | Ga0373927_0118330 | 3300035695 | Bacteria | 1728 |
| 146 | Ga0373947_0027342 | 3300035725 | Bacteria | 3338 |
| 147 | Ga0373947_0050297 | 3300035725 | Bacteria | 2506 |
| 148 | Ga0373937_0055060 | 3300036401 | Bacteria | 3651 |
| 149 | Ga0373937_0065566 | 3300036401 | Bacteria | 3343 |
| 150 | Ga0373937_0272220 | 3300036401 | Bacteria | 1598 |
| 151 | Ga0316582_0080543 | 3300036647 | Bacteria | 2125 |
| 152 | Ga0316584_0041651 | 3300036712 | Bacteria | 3423 |
| 153 | Ga0373925_0505321 | 3300037068 | Unclassified | 992 |
| 154 | Ga0373925_0609581 | 3300037068 | Unclassified | 899 |
| 155 | Ga0395898_0014766 | 3300037466 | Bacteria | 8017 |
| 156 | Ga0436361_0435672 | 3300039447 | Bacteria | 1720 |
| 157 | Ga0466968_0052338 | 3300044735 | Bacteria | 1746 |
| 158 | Ga0466970_0166598 | 3300044765 | Bacteria | 1220 |
| 159 | Ga0466960_0201685 | 3300044901 | Bacteria | 1087 |
| 160 | Ga0495651_0139925 | 3300046462 | Unclassified | 1756 |
| 161 | Ga0495651_0146711 | 3300046462 | Bacteria | 1705 |
| 162 | Ga0495580_0033700 | 3300046472 | Bacteria | 3689 |
| 163 | Ga0495662_0066397 | 3300046476 | Unclassified | 1745 |
| 164 | Ga0495664_0239194 | 3300046477 | Bacteria | 1098 |
| 165 | Ga0495594_0073589 | 3300046499 | Bacteria | 1902 |
| 166 | Ga0495594_0264268 | 3300046499 | Bacteria | 980 |
| 167 | Ga0495608_0028601 | 3300046511 | Bacteria | 3788 |
| 168 | Ga0495618_0032403 | 3300046514 | Bacteria | 3273 |
| 169 | Ga0495618_0060699 | 3300046514 | Bacteria | 2398 |
| 170 | Ga0495628_0186823 | 3300046516 | Bacteria | 1566 |
| 171 | Ga0495630_0109656 | 3300046517 | Bacteria | 2091 |
| 172 | Ga0495630_0214822 | 3300046517 | Bacteria | 1468 |
| 173 | Ga0495642_0111142 | 3300046528 | Unclassified | 1172 |
| 174 | Ga0495640_0016950 | 3300046533 | Bacteria | 5439 |
| 175 | Ga0495587_0015477 | 3300046536 | Bacteria | 4763 |
| 176 | Ga0495645_0030325 | 3300046543 | Unclassified | 3938 |
| 177 | Ga0495667_0088045 | 3300046559 | Bacteria | 2013 |
| 178 | Ga0495634_0025247 | 3300046642 | Bacteria | 4161 |
| 179 | Ga0495634_0028918 | 3300046642 | Bacteria | 3842 |
| 180 | Ga0495635_0006253 | 3300046663 | Bacteria | 8294 |
| 181 | Ga0495635_0229316 | 3300046663 | Unclassified | 1255 |
| 182 | Ga0495588_0051850 | 3300046674 | Unclassified | 2114 |
| 183 | Ga0495657_0028817 | 3300046675 | Bacteria | 3900 |
| 184 | Ga0495657_0183355 | 3300046675 | Bacteria | 1283 |
| 185 | Ga0495623_0098897 | 3300046679 | Bacteria | 1780 |
| 186 | Ga0495646_0049879 | 3300046680 | Bacteria | 2539 |
| 187 | Ga0495624_0023647 | 3300046690 | Bacteria | 4050 |
| 188 | Ga0495581_0084313 | 3300047315 | Bacteria | 1841 |
| 189 | Ga0495604_0103443 | 3300047317 | Bacteria | 2089 |
| 190 | Ga0495674_0292055 | 3300047319 | Bacteria | 1333 |
| 191 | Ga0495680_0030393 | 3300047322 | Bacteria | 4411 |
| 192 | Ga0495680_0077837 | 3300047322 | Bacteria | 2511 |
| 193 | Ga0495680_0266034 | 3300047322 | Unclassified | 1212 |
| 194 | Ga0495675_0022889 | 3300047444 | Bacteria | 3983 |
| 195 | Ga0495675_0049950 | 3300047444 | Bacteria | 2658 |
| 196 | Ga0495675_0105642 | 3300047444 | Bacteria | 1760 |
| 197 | Ga0495675_0132774 | 3300047444 | Bacteria | 1547 |
| 198 | Ga0495684_0189703 | 3300047471 | Bacteria | 1520 |
| 199 | Ga0495684_0232522 | 3300047471 | Unclassified | 1348 |
| 200 | Ga0495602_0017221 | 3300048088 | Bacteria | 7245 |
| 201 | Ga0495602_0157697 | 3300048088 | Bacteria | 1775 |
| 202 | Ga0496101_0041679 | 3300048904 | Bacteria | 3275 |
| 203 | Ga0496102_0296513 | 3300048905 | Bacteria | 1524 |
| 204 | Ga0496103_0206428 | 3300048906 | Bacteria | 1264 |
| 205 | Ga0496103_0228456 | 3300048906 | Bacteria | 1197 |
| 206 | Ga0496104_0007587 | 3300048907 | Bacteria | 9603 |
| 207 | Ga0496104_0159763 | 3300048907 | Bacteria | 2162 |
| 208 | Ga0496104_0170506 | 3300048907 | Bacteria | 2087 |
| 209 | Ga0496104_0170930 | 3300048907 | Bacteria | 2084 |
| 210 | Ga0496104_0487569 | 3300048907 | Bacteria | 1144 |
| 211 | Ga0496105_0031690 | 3300048908 | Bacteria | 4335 |
| 212 | Ga0496105_0149682 | 3300048908 | Bacteria | 1919 |
| 213 | Ga0496105_0174202 | 3300048908 | Bacteria | 1763 |
| 214 | Ga0496105_0253352 | 3300048908 | Bacteria | 1426 |
| 215 | Ga0496106_0334816 | 3300048909 | Bacteria | 1215 |
| 216 | Ga0496107_0045948 | 3300048910 | Bacteria | 3142 |
| 217 | Ga0496107_0248707 | 3300048910 | Bacteria | 1323 |
| 218 | Ga0496108_0020459 | 3300048911 | Bacteria | 5440 |
| 219 | Ga0496108_0030070 | 3300048911 | Bacteria | 4502 |
| 220 | Ga0496108_0357544 | 3300048911 | Bacteria | 1274 |
| 221 | Ga0496109_0184919 | 3300048912 | Bacteria | 1958 |
| 222 | Ga0496109_0401162 | 3300048912 | Bacteria | 1295 |
| 223 | Ga0496110_0016474 | 3300048913 | Bacteria | 6173 |
| 224 | Ga0496110_0242037 | 3300048913 | Unclassified | 1641 |
| 225 | Ga0496110_0376209 | 3300048913 | Bacteria | 1294 |
| 226 | Ga0496111_0028482 | 3300048914 | Bacteria | 3959 |
| 227 | Ga0496111_0099297 | 3300048914 | Bacteria | 2138 |
| 228 | Ga0496111_0147430 | 3300048914 | Bacteria | 1745 |
| 229 | Ga0496112_0023849 | 3300048915 | Bacteria | 5852 |
| 230 | Ga0496112_0093054 | 3300048915 | Bacteria | 2984 |
| 231 | Ga0496112_0160606 | 3300048915 | Bacteria | 2214 |
| 232 | Ga0496112_0351995 | 3300048915 | Bacteria | 1415 |
| 233 | Ga0496113_0082740 | 3300048916 | Bacteria | 2462 |
| 234 | Ga0496115_0012518 | 3300048918 | Bacteria | 6388 |
| 235 | Ga0496115_0030154 | 3300048918 | Bacteria | 4265 |
| 236 | Ga0496115_0257742 | 3300048918 | Bacteria | 1435 |
| 237 | Ga0496115_0270218 | 3300048918 | Bacteria | 1397 |
| 238 | Ga0496115_0284190 | 3300048918 | Bacteria | 1358 |
| 239 | Ga0496115_0315023 | 3300048918 | Bacteria | 1281 |
| 240 | Ga0496117_0259014 | 3300048920 | Unclassified | 944 |
| 241 | Ga0496121_0028775 | 3300048924 | Bacteria | 5163 |
| 242 | Ga0496125_0067159 | 3300048928 | Bacteria | 2828 |
| 243 | Ga0496126_0086087 | 3300048929 | Bacteria | 2770 |
| 244 | Ga0496126_0164354 | 3300048929 | Bacteria | 1895 |
| 245 | Ga0501048_0000912 | 3300049582 | Bacteria | 21787 |
| 246 | nmdc:mga03n38_25383_c1 | 3300050490 | Bacteria | 2433 |
| 247 | nmdc:mga00v17_30429_c1 | 3300050491 | Bacteria | 3177 |
| 248 | nmdc:mga06z11_82221_c1 | 3300050494 | Bacteria | 1731 |
| 249 | nmdc:mga04h51_2676_c1 | 3300050495 | Bacteria | 4243 |
| 250 | nmdc:mga07m45_8650_c1 | 3300050496 | Bacteria | 5243 |
| 251 | nmdc:mga05p37_598926_c1 | 3300050507 | Bacteria | 1244 |
| 252 | nmdc:mga08y16_134929_c1 | 3300050511 | Bacteria | 2565 |
| 253 | nmdc:mga0n895_266134_c1 | 3300050512 | Bacteria | 1739 |
| 254 | nmdc:mga0rr50_127210_c1 | 3300050513 | Bacteria | 2036 |
| 255 | nmdc:mga08x19_213959_c1 | 3300050514 | Bacteria | 1323 |
| 256 | nmdc:mga0sz30_108829_c1 | 3300050516 | Unclassified | 1214 |
| 257 | Ga0495601_0017596 | 3300053077 | Bacteria | 4341 |
| 258 | Ga0495601_0180001 | 3300053077 | Bacteria | 1382 |
| 259 | Ga0495612_0004615 | 3300053078 | Bacteria | 5708 |
| 260 | Ga0495612_0043471 | 3300053078 | Bacteria | 1836 |
| 261 | Ga0495595_0008948 | 3300053084 | Bacteria | 4128 |
| 262 | Ga0495619_0002138 | 3300053085 | Bacteria | 13106 |
| 263 | Ga0495619_0002500 | 3300053085 | Bacteria | 12038 |
| 264 | Ga0495619_0140362 | 3300053085 | Bacteria | 1663 |
| 265 | Ga0495619_0162998 | 3300053085 | Bacteria | 1540 |
| 266 | Ga0495619_0213339 | 3300053085 | Unclassified | 1337 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050507 | nmdc:mga05p37_598926_c1 | nmdc:mga05p37_598926_c1_28_732 | 234 |
| 2 | 3300005434 | Ga0070709_10338942 | Ga0070709_103389421 | 264 |
| 3 | 3300014969 | Ga0157376_10047207 | Ga0157376_100472074 | 270 |
| 4 | 3300031665 | Ga0316575_10003555 | Ga0316575_100035555 | 270 |
| 5 | 3300031691 | Ga0316579_10008780 | Ga0316579_100087807 | 270 |
| 6 | 3300031728 | Ga0316578_10008004 | Ga0316578_100080047 | 270 |
| 7 | 3300032133 | Ga0316583_10005885 | Ga0316583_100058853 | 270 |
| 8 | 3300036647 | Ga0316582_0080543 | Ga0316582_0080543_112_936 | 270 |
| 9 | 3300005548 | Ga0070665_100064927 | Ga0070665_1000649273 | 271 |
| 10 | 3300005841 | Ga0068863_100069373 | Ga0068863_1000693734 | 271 |
| 11 | 3300006914 | Ga0075436_100231820 | Ga0075436_1002318201 | 271 |
| 12 | 3300009177 | Ga0105248_10124146 | Ga0105248_101241463 | 271 |
| 13 | 3300014325 | Ga0163163_10043111 | Ga0163163_100431113 | 271 |
| 14 | 3300026088 | Ga0207641_10004827 | Ga0207641_100048277 | 271 |
| 15 | 3300028379 | Ga0268266_10054374 | Ga0268266_100543742 | 271 |
| 16 | 3300044765 | Ga0466970_0166598 | Ga0466970_0166598_251_1069 | 271 |
| 17 | iso_pu_bacteria | 2513237104 | 2513715386 | 271 |
| 18 | iso_pu_bacteria | 2513237141 | 2513893279 | 271 |
| 19 | iso_pu_bacteria | 2524023205 | 2524439503 | 271 |
| 20 | iso_pu_bacteria | 2524023228 | 2524542715 | 271 |
| 21 | iso_pu_bacteria | 2744054633 | 2745078214 | 271 |
| 22 | iso_pu_bacteria | 2903748898 | 2903752067 | 271 |
| 23 | 3300006846 | Ga0075430_100573923 | Ga0075430_1005739231 | 272 |
| 24 | 3300035090 | Ga0373949_0061106 | Ga0373949_0061106_137_958 | 272 |
| 25 | 3300046462 | Ga0495651_0139925 | Ga0495651_0139925_169_987 | 272 |
| 26 | 3300046536 | Ga0495587_0015477 | Ga0495587_0015477_520_1338 | 272 |
| 27 | 3300046663 | Ga0495635_0229316 | Ga0495635_0229316_207_1025 | 272 |
| 28 | 3300047444 | Ga0495675_0132774 | Ga0495675_0132774_239_1057 | 272 |
| 29 | 3300050513 | nmdc:mga0rr50_127210_c1 | nmdc:mga0rr50_127210_c1_166_987 | 272 |
| 30 | 3300050514 | nmdc:mga08x19_213959_c1 | nmdc:mga08x19_213959_c1_43_864 | 272 |
| 31 | 3300053085 | Ga0495619_0213339 | Ga0495619_0213339_185_1006 | 272 |
| 32 | 3300005439 | Ga0070711_100013248 | Ga0070711_1000132482 | 273 |
| 33 | 3300006028 | Ga0070717_10373310 | Ga0070717_103733101 | 273 |
| 34 | 3300006173 | Ga0070716_100054542 | Ga0070716_1000545422 | 273 |
| 35 | 3300025939 | Ga0207665_10055658 | Ga0207665_100556582 | 273 |
| 36 | 3300031247 | Ga0265340_10107001 | Ga0265340_101070012 | 273 |
| 37 | 3300031249 | Ga0265339_10004749 | Ga0265339_100047493 | 273 |
| 38 | 3300031665 | Ga0316575_10016489 | Ga0316575_100164892 | 273 |
| 39 | 3300031691 | Ga0316579_10002372 | Ga0316579_100023725 | 273 |
| 40 | 3300031728 | Ga0316578_10110416 | Ga0316578_101104161 | 273 |
| 41 | 3300032139 | Ga0316580_10026385 | Ga0316580_100263852 | 273 |
| 42 | 3300035089 | Ga0373944_0043557 | Ga0373944_0043557_19_843 | 273 |
| 43 | 3300035398 | Ga0316574_0000249 | Ga0316574_0000249_5687_6511 | 273 |
| 44 | 3300036712 | Ga0316584_0041651 | Ga0316584_0041651_673_1497 | 273 |
| 45 | 3300037466 | Ga0395898_0014766 | Ga0395898_0014766_3627_4451 | 273 |
| 46 | 3300046642 | Ga0495634_0025247 | Ga0495634_0025247_603_1439 | 273 |
| 47 | 3300048929 | Ga0496126_0086087 | Ga0496126_0086087_1547_2371 | 273 |
| 48 | 3300053085 | Ga0495619_0162998 | Ga0495619_0162998_176_1012 | 273 |
| 49 | iso_pu_bacteria | 2902405164 | 2902409422 | 273 |
| 50 | 3300005436 | Ga0070713_100091308 | Ga0070713_1000913082 | 274 |
| 51 | 3300006175 | Ga0070712_100199000 | Ga0070712_1001990002 | 274 |
| 52 | 3300025906 | Ga0207699_10315770 | Ga0207699_103157701 | 274 |
| 53 | 3300035398 | Ga0316574_0176151 | Ga0316574_0176151_478_1320 | 274 |
| 54 | 3300036401 | Ga0373937_0065566 | Ga0373937_0065566_1094_1921 | 274 |
| 55 | 3300037068 | Ga0373925_0609581 | Ga0373925_0609581_20_847 | 274 |
| 56 | 3300044735 | Ga0466968_0052338 | Ga0466968_0052338_79_915 | 274 |
| 57 | 3300044901 | Ga0466960_0201685 | Ga0466960_0201685_241_1077 | 274 |
| 58 | 3300046476 | Ga0495662_0066397 | Ga0495662_0066397_93_920 | 274 |
| 59 | 3300046663 | Ga0495635_0006253 | Ga0495635_0006253_6086_6913 | 274 |
| 60 | 3300047319 | Ga0495674_0292055 | Ga0495674_0292055_278_1105 | 274 |
| 61 | 3300050512 | nmdc:mga0n895_266134_c1 | nmdc:mga0n895_266134_c1_848_1684 | 274 |
| 62 | 3300053077 | Ga0495601_0180001 | Ga0495601_0180001_340_1167 | 274 |
| 63 | 3300053078 | Ga0495612_0043471 | Ga0495612_0043471_424_1251 | 274 |
| 64 | 3300053084 | Ga0495595_0008948 | Ga0495595_0008948_1944_2771 | 274 |
| 65 | 3300053085 | Ga0495619_0002138 | Ga0495619_0002138_6159_6986 | 274 |
| 66 | 3300003659 | JGI25404J52841_10000089 | JGI25404J52841_100000892 | 275 |
| 67 | 3300005328 | Ga0070676_10045841 | Ga0070676_100458412 | 275 |
| 68 | 3300005331 | Ga0070670_100151540 | Ga0070670_1001515403 | 275 |
| 69 | 3300005334 | Ga0068869_100035273 | Ga0068869_1000352734 | 275 |
| 70 | 3300005335 | Ga0070666_10136507 | Ga0070666_101365072 | 275 |
| 71 | 3300005336 | Ga0070680_100027644 | Ga0070680_1000276443 | 275 |
| 72 | 3300005337 | Ga0070682_100030069 | Ga0070682_1000300694 | 275 |
| 73 | 3300005354 | Ga0070675_100320336 | Ga0070675_1003203361 | 275 |
| 74 | 3300005365 | Ga0070688_100192735 | Ga0070688_1001927352 | 275 |
| 75 | 3300005366 | Ga0070659_100278044 | Ga0070659_1002780442 | 275 |
| 76 | 3300005367 | Ga0070667_100132524 | Ga0070667_1001325243 | 275 |
| 77 | 3300005434 | Ga0070709_10031855 | Ga0070709_100318553 | 275 |
| 78 | 3300005436 | Ga0070713_100083286 | Ga0070713_1000832863 | 275 |
| 79 | 3300005439 | Ga0070711_100019894 | Ga0070711_1000198943 | 275 |
| 80 | 3300005455 | Ga0070663_100046733 | Ga0070663_1000467333 | 275 |
| 81 | 3300005456 | Ga0070678_100020861 | Ga0070678_1000208616 | 275 |
| 82 | 3300005458 | Ga0070681_10100870 | Ga0070681_101008702 | 275 |
| 83 | 3300005471 | Ga0070698_100053090 | Ga0070698_1000530905 | 275 |
| 84 | 3300005530 | Ga0070679_100019324 | Ga0070679_1000193242 | 275 |
| 85 | 3300005547 | Ga0070693_100230343 | Ga0070693_1002303431 | 275 |
| 86 | 3300005548 | Ga0070665_100201195 | Ga0070665_1002011952 | 275 |
| 87 | 3300005564 | Ga0070664_100396535 | Ga0070664_1003965352 | 275 |
| 88 | 3300005617 | Ga0068859_100036907 | Ga0068859_1000369076 | 275 |
| 89 | 3300005618 | Ga0068864_100008150 | Ga0068864_1000081503 | 275 |
| 90 | 3300005618 | Ga0068864_100211257 | Ga0068864_1002112572 | 275 |
| 91 | 3300005718 | Ga0068866_10161522 | Ga0068866_101615222 | 275 |
| 92 | 3300005840 | Ga0068870_10087775 | Ga0068870_100877753 | 275 |
| 93 | 3300005842 | Ga0068858_100154580 | Ga0068858_1001545802 | 275 |
| 94 | 3300005842 | Ga0068858_100286609 | Ga0068858_1002866092 | 275 |
| 95 | 3300005843 | Ga0068860_100130903 | Ga0068860_1001309033 | 275 |
| 96 | 3300005843 | Ga0068860_100864671 | Ga0068860_1008646711 | 275 |
| 97 | 3300005937 | Ga0081455_10005996 | Ga0081455_1000599614 | 275 |
| 98 | 3300005937 | Ga0081455_10018676 | Ga0081455_100186764 | 275 |
| 99 | 3300005937 | Ga0081455_10050891 | Ga0081455_100508915 | 275 |
| 100 | 3300005983 | Ga0081540_1004495 | Ga0081540_10044953 | 275 |
| 101 | 3300006042 | Ga0075368_10005101 | Ga0075368_100051015 | 275 |
| 102 | 3300006051 | Ga0075364_10021945 | Ga0075364_100219452 | 275 |
| 103 | 3300006175 | Ga0070712_100030059 | Ga0070712_1000300594 | 275 |
| 104 | 3300006177 | Ga0075362_10007723 | Ga0075362_100077231 | 275 |
| 105 | 3300006178 | Ga0075367_10006473 | Ga0075367_100064738 | 275 |
| 106 | 3300006186 | Ga0075369_10001562 | Ga0075369_1000156211 | 275 |
| 107 | 3300006195 | Ga0075366_10011123 | Ga0075366_100111238 | 275 |
| 108 | 3300006237 | Ga0097621_100023644 | Ga0097621_1000236445 | 275 |
| 109 | 3300006931 | Ga0097620_100036909 | Ga0097620_1000369096 | 275 |
| 110 | 3300009098 | Ga0105245_10019318 | Ga0105245_100193188 | 275 |
| 111 | 3300009098 | Ga0105245_10164393 | Ga0105245_101643932 | 275 |
| 112 | 3300009101 | Ga0105247_10020404 | Ga0105247_100204042 | 275 |
| 113 | 3300009174 | Ga0105241_10033897 | Ga0105241_100338975 | 275 |
| 114 | 3300009176 | Ga0105242_10224786 | Ga0105242_102247863 | 275 |
| 115 | 3300009177 | Ga0105248_10171994 | Ga0105248_101719942 | 275 |
| 116 | 3300009545 | Ga0105237_10062886 | Ga0105237_100628865 | 275 |
| 117 | 3300009545 | Ga0105237_10215889 | Ga0105237_102158892 | 275 |
| 118 | 3300010159 | Ga0099796_10089679 | Ga0099796_100896792 | 275 |
| 119 | 3300011119 | Ga0105246_10033101 | Ga0105246_100331012 | 275 |
| 120 | 3300011119 | Ga0105246_10337508 | Ga0105246_103375081 | 275 |
| 121 | 3300013105 | Ga0157369_10126173 | Ga0157369_101261733 | 275 |
| 122 | 3300013296 | Ga0157374_10013893 | Ga0157374_100138938 | 275 |
| 123 | 3300013306 | Ga0163162_10248476 | Ga0163162_102484762 | 275 |
| 124 | 3300014325 | Ga0163163_10053852 | Ga0163163_100538522 | 275 |
| 125 | 3300014325 | Ga0163163_10247157 | Ga0163163_102471572 | 275 |
| 126 | 3300014497 | Ga0182008_10069910 | Ga0182008_100699102 | 275 |
| 127 | 3300014968 | Ga0157379_10169351 | Ga0157379_101693512 | 275 |
| 128 | 3300025898 | Ga0207692_10147405 | Ga0207692_101474052 | 275 |
| 129 | 3300025898 | Ga0207692_10289208 | Ga0207692_102892081 | 275 |
| 130 | 3300025900 | Ga0207710_10058402 | Ga0207710_100584022 | 275 |
| 131 | 3300025908 | Ga0207643_10054499 | Ga0207643_100544993 | 275 |
| 132 | 3300025915 | Ga0207693_10075280 | Ga0207693_100752802 | 275 |
| 133 | 3300025915 | Ga0207693_10166678 | Ga0207693_101666782 | 275 |
| 134 | 3300025916 | Ga0207663_10316949 | Ga0207663_103169491 | 275 |
| 135 | 3300025917 | Ga0207660_10020373 | Ga0207660_100203734 | 275 |
| 136 | 3300025920 | Ga0207649_10486763 | Ga0207649_104867632 | 275 |
| 137 | 3300025921 | Ga0207652_10003812 | Ga0207652_100038125 | 275 |
| 138 | 3300025925 | Ga0207650_10146565 | Ga0207650_101465651 | 275 |
| 139 | 3300025927 | Ga0207687_10006993 | Ga0207687_100069937 | 275 |
| 140 | 3300025939 | Ga0207665_10213572 | Ga0207665_102135722 | 275 |
| 141 | 3300025941 | Ga0207711_10029518 | Ga0207711_100295182 | 275 |
| 142 | 3300025949 | Ga0207667_10017893 | Ga0207667_100178932 | 275 |
| 143 | 3300025972 | Ga0207668_10024113 | Ga0207668_100241133 | 275 |
| 144 | 3300026023 | Ga0207677_10026778 | Ga0207677_100267785 | 275 |
| 145 | 3300026035 | Ga0207703_10016819 | Ga0207703_100168198 | 275 |
| 146 | 3300026078 | Ga0207702_10026251 | Ga0207702_100262511 | 275 |
| 147 | 3300026088 | Ga0207641_10284484 | Ga0207641_102844841 | 275 |
| 148 | 3300026095 | Ga0207676_10472433 | Ga0207676_104724332 | 275 |
| 149 | 3300026116 | Ga0207674_10174536 | Ga0207674_101745362 | 275 |
| 150 | 3300026121 | Ga0207683_10327490 | Ga0207683_103274902 | 275 |
| 151 | 3300027866 | Ga0209813_10003162 | Ga0209813_100031622 | 275 |
| 152 | 3300027907 | Ga0207428_10114926 | Ga0207428_101149262 | 275 |
| 153 | 3300028379 | Ga0268266_10005868 | Ga0268266_100058685 | 275 |
| 154 | 3300028381 | Ga0268264_10077089 | Ga0268264_100770893 | 275 |
| 155 | 3300030763 | Ga0265763_1001412 | Ga0265763_10014121 | 275 |
| 156 | 3300035691 | Ga0373931_0206019 | Ga0373931_0206019_197_1027 | 275 |
| 157 | 3300036401 | Ga0373937_0055060 | Ga0373937_0055060_1731_2561 | 275 |
| 158 | 3300036401 | Ga0373937_0272220 | Ga0373937_0272220_704_1534 | 275 |
| 159 | 3300046462 | Ga0495651_0146711 | Ga0495651_0146711_195_1025 | 275 |
| 160 | 3300046477 | Ga0495664_0239194 | Ga0495664_0239194_64_1002 | 275 |
| 161 | 3300046499 | Ga0495594_0264268 | Ga0495594_0264268_95_925 | 275 |
| 162 | 3300046516 | Ga0495628_0186823 | Ga0495628_0186823_274_1212 | 275 |
| 163 | 3300046517 | Ga0495630_0214822 | Ga0495630_0214822_470_1408 | 275 |
| 164 | 3300046528 | Ga0495642_0111142 | Ga0495642_0111142_310_1140 | 275 |
| 165 | 3300046559 | Ga0495667_0088045 | Ga0495667_0088045_448_1386 | 275 |
| 166 | 3300046675 | Ga0495657_0028817 | Ga0495657_0028817_2047_2877 | 275 |
| 167 | 3300046675 | Ga0495657_0183355 | Ga0495657_0183355_34_930 | 275 |
| 168 | 3300047317 | Ga0495604_0103443 | Ga0495604_0103443_1088_2026 | 275 |
| 169 | 3300047322 | Ga0495680_0030393 | Ga0495680_0030393_637_1575 | 275 |
| 170 | 3300047322 | Ga0495680_0266034 | Ga0495680_0266034_53_880 | 275 |
| 171 | 3300047444 | Ga0495675_0022889 | Ga0495675_0022889_1919_2749 | 275 |
| 172 | 3300047444 | Ga0495675_0105642 | Ga0495675_0105642_605_1543 | 275 |
| 173 | 3300047471 | Ga0495684_0232522 | Ga0495684_0232522_234_1172 | 275 |
| 174 | 3300048088 | Ga0495602_0157697 | Ga0495602_0157697_570_1508 | 275 |
| 175 | 3300048904 | Ga0496101_0041679 | Ga0496101_0041679_1704_2534 | 275 |
| 176 | 3300048905 | Ga0496102_0296513 | Ga0496102_0296513_390_1220 | 275 |
| 177 | 3300048906 | Ga0496103_0206428 | Ga0496103_0206428_96_926 | 275 |
| 178 | 3300048906 | Ga0496103_0228456 | Ga0496103_0228456_328_1158 | 275 |
| 179 | 3300048907 | Ga0496104_0007587 | Ga0496104_0007587_4255_5085 | 275 |
| 180 | 3300048907 | Ga0496104_0159763 | Ga0496104_0159763_968_1810 | 275 |
| 181 | 3300048907 | Ga0496104_0170506 | Ga0496104_0170506_300_1130 | 275 |
| 182 | 3300048907 | Ga0496104_0170930 | Ga0496104_0170930_731_1561 | 275 |
| 183 | 3300048908 | Ga0496105_0031690 | Ga0496105_0031690_2436_3266 | 275 |
| 184 | 3300048908 | Ga0496105_0149682 | Ga0496105_0149682_904_1734 | 275 |
| 185 | 3300048908 | Ga0496105_0174202 | Ga0496105_0174202_421_1251 | 275 |
| 186 | 3300048908 | Ga0496105_0253352 | Ga0496105_0253352_516_1346 | 275 |
| 187 | 3300048910 | Ga0496107_0045948 | Ga0496107_0045948_660_1490 | 275 |
| 188 | 3300048911 | Ga0496108_0020459 | Ga0496108_0020459_1896_2726 | 275 |
| 189 | 3300048911 | Ga0496108_0030070 | Ga0496108_0030070_2315_3157 | 275 |
| 190 | 3300048911 | Ga0496108_0357544 | Ga0496108_0357544_406_1236 | 275 |
| 191 | 3300048912 | Ga0496109_0184919 | Ga0496109_0184919_849_1679 | 275 |
| 192 | 3300048912 | Ga0496109_0401162 | Ga0496109_0401162_246_1076 | 275 |
| 193 | 3300048913 | Ga0496110_0016474 | Ga0496110_0016474_979_1809 | 275 |
| 194 | 3300048913 | Ga0496110_0242037 | Ga0496110_0242037_521_1363 | 275 |
| 195 | 3300048913 | Ga0496110_0376209 | Ga0496110_0376209_191_1021 | 275 |
| 196 | 3300048914 | Ga0496111_0028482 | Ga0496111_0028482_391_1233 | 275 |
| 197 | 3300048914 | Ga0496111_0099297 | Ga0496111_0099297_17_847 | 275 |
| 198 | 3300048914 | Ga0496111_0147430 | Ga0496111_0147430_592_1422 | 275 |
| 199 | 3300048915 | Ga0496112_0023849 | Ga0496112_0023849_4747_5589 | 275 |
| 200 | 3300048915 | Ga0496112_0093054 | Ga0496112_0093054_1483_2313 | 275 |
| 201 | 3300048915 | Ga0496112_0160606 | Ga0496112_0160606_847_1677 | 275 |
| 202 | 3300048915 | Ga0496112_0351995 | Ga0496112_0351995_191_1021 | 275 |
| 203 | 3300048916 | Ga0496113_0082740 | Ga0496113_0082740_944_1774 | 275 |
| 204 | 3300048918 | Ga0496115_0257742 | Ga0496115_0257742_441_1271 | 275 |
| 205 | 3300048918 | Ga0496115_0270218 | Ga0496115_0270218_141_971 | 275 |
| 206 | 3300048918 | Ga0496115_0284190 | Ga0496115_0284190_50_880 | 275 |
| 207 | 3300048920 | Ga0496117_0259014 | Ga0496117_0259014_20_850 | 275 |
| 208 | 3300048924 | Ga0496121_0028775 | Ga0496121_0028775_2998_3828 | 275 |
| 209 | 3300048928 | Ga0496125_0067159 | Ga0496125_0067159_566_1396 | 275 |
| 210 | 3300048929 | Ga0496126_0164354 | Ga0496126_0164354_571_1401 | 275 |
| 211 | 3300050490 | nmdc:mga03n38_25383_c1 | nmdc:mga03n38_25383_c1_167_997 | 275 |
| 212 | 3300050491 | nmdc:mga00v17_30429_c1 | nmdc:mga00v17_30429_c1_636_1466 | 275 |
| 213 | 3300050494 | nmdc:mga06z11_82221_c1 | nmdc:mga06z11_82221_c1_69_899 | 275 |
| 214 | 3300050495 | nmdc:mga04h51_2676_c1 | nmdc:mga04h51_2676_c1_2722_3552 | 275 |
| 215 | 3300050496 | nmdc:mga07m45_8650_c1 | nmdc:mga07m45_8650_c1_833_1663 | 275 |
| 216 | 3300050511 | nmdc:mga08y16_134929_c1 | nmdc:mga08y16_134929_c1_1155_1985 | 275 |
| 217 | 3300050516 | nmdc:mga0sz30_108829_c1 | nmdc:mga0sz30_108829_c1_39_869 | 275 |
| 218 | 3300006175 | Ga0070712_100225781 | Ga0070712_1002257812 | 276 |
| 219 | 3300024225 | Ga0224572_1003318 | Ga0224572_10033183 | 276 |
| 220 | 3300024225 | Ga0224572_1007836 | Ga0224572_10078362 | 276 |
| 221 | 3300025915 | Ga0207693_10147723 | Ga0207693_101477231 | 276 |
| 222 | 3300035725 | Ga0373947_0050297 | Ga0373947_0050297_1263_2282 | 276 |
| 223 | 3300039447 | Ga0436361_0435672 | Ga0436361_0435672_576_1442 | 276 |
| 224 | 3300046511 | Ga0495608_0028601 | Ga0495608_0028601_2595_3428 | 276 |
| 225 | 3300046514 | Ga0495618_0060699 | Ga0495618_0060699_720_1553 | 276 |
| 226 | 3300046543 | Ga0495645_0030325 | Ga0495645_0030325_1007_1840 | 276 |
| 227 | 3300046679 | Ga0495623_0098897 | Ga0495623_0098897_238_1179 | 276 |
| 228 | 3300046680 | Ga0495646_0049879 | Ga0495646_0049879_1636_2469 | 276 |
| 229 | 3300047444 | Ga0495675_0049950 | Ga0495675_0049950_1124_1957 | 276 |
| 230 | 3300047471 | Ga0495684_0189703 | Ga0495684_0189703_120_953 | 276 |
| 231 | 3300048088 | Ga0495602_0017221 | Ga0495602_0017221_4139_4972 | 276 |
| 232 | 3300048909 | Ga0496106_0334816 | Ga0496106_0334816_221_1090 | 276 |
| 233 | 3300048910 | Ga0496107_0248707 | Ga0496107_0248707_306_1175 | 276 |
| 234 | 3300048918 | Ga0496115_0030154 | Ga0496115_0030154_450_1319 | 276 |
| 235 | 3300053077 | Ga0495601_0017596 | Ga0495601_0017596_892_1725 | 276 |
| 236 | 3300053085 | Ga0495619_0140362 | Ga0495619_0140362_544_1377 | 276 |
| 237 | 3300005437 | Ga0070710_10088264 | Ga0070710_100882642 | 277 |
| 238 | 3300005456 | Ga0070678_100374537 | Ga0070678_1003745371 | 277 |
| 239 | 3300005457 | Ga0070662_100006286 | Ga0070662_1000062862 | 277 |
| 240 | 3300005539 | Ga0068853_100168974 | Ga0068853_1001689742 | 277 |
| 241 | 3300005616 | Ga0068852_100454307 | Ga0068852_1004543071 | 277 |
| 242 | 3300007788 | Ga0099795_10060166 | Ga0099795_100601662 | 277 |
| 243 | 3300014326 | Ga0157380_10363958 | Ga0157380_103639581 | 277 |
| 244 | 3300031090 | Ga0265760_10008034 | Ga0265760_100080342 | 277 |
| 245 | 3300031090 | Ga0265760_10014312 | Ga0265760_100143122 | 277 |
| 246 | 3300035410 | Ga0373924_0083496 | Ga0373924_0083496_235_1077 | 277 |
| 247 | 3300003320 | rootH2_10148404 | rootH2_101484041 | 278 |
| 248 | 3300005333 | Ga0070677_10067131 | Ga0070677_100671312 | 278 |
| 249 | 3300005356 | Ga0070674_100177309 | Ga0070674_1001773091 | 278 |
| 250 | 3300005456 | Ga0070678_100460280 | Ga0070678_1004602801 | 278 |
| 251 | 3300006028 | Ga0070717_10204933 | Ga0070717_102049331 | 278 |
| 252 | 3300025893 | Ga0207682_10027202 | Ga0207682_100272021 | 278 |
| 253 | 3300035171 | Ga0373946_0020998 | Ga0373946_0020998_937_1779 | 278 |
| 254 | 3300035691 | Ga0373931_0045376 | Ga0373931_0045376_346_1185 | 278 |
| 255 | 3300035695 | Ga0373927_0118330 | Ga0373927_0118330_775_1617 | 278 |
| 256 | 3300035725 | Ga0373947_0027342 | Ga0373947_0027342_1193_2035 | 278 |
| 257 | 3300037068 | Ga0373925_0505321 | Ga0373925_0505321_42_884 | 278 |
| 258 | 3300046472 | Ga0495580_0033700 | Ga0495580_0033700_1448_2290 | 278 |
| 259 | 3300046499 | Ga0495594_0073589 | Ga0495594_0073589_890_1732 | 278 |
| 260 | 3300046514 | Ga0495618_0032403 | Ga0495618_0032403_1157_1999 | 278 |
| 261 | 3300046517 | Ga0495630_0109656 | Ga0495630_0109656_610_1452 | 278 |
| 262 | 3300046533 | Ga0495640_0016950 | Ga0495640_0016950_1954_2796 | 278 |
| 263 | 3300046642 | Ga0495634_0028918 | Ga0495634_0028918_1769_2620 | 278 |
| 264 | 3300046674 | Ga0495588_0051850 | Ga0495588_0051850_302_1144 | 278 |
| 265 | 3300046690 | Ga0495624_0023647 | Ga0495624_0023647_1301_2143 | 278 |
| 266 | 3300047315 | Ga0495581_0084313 | Ga0495581_0084313_335_1177 | 278 |
| 267 | 3300047322 | Ga0495680_0077837 | Ga0495680_0077837_1214_2056 | 278 |
| 268 | 3300048907 | Ga0496104_0487569 | Ga0496104_0487569_126_977 | 278 |
| 269 | 3300048918 | Ga0496115_0012518 | Ga0496115_0012518_5502_6341 | 278 |
| 270 | 3300048918 | Ga0496115_0315023 | Ga0496115_0315023_68_916 | 278 |
| 271 | 3300049582 | Ga0501048_0000912 | Ga0501048_0000912_16038_16874 | 278 |
| 272 | 3300053078 | Ga0495612_0004615 | Ga0495612_0004615_2501_3343 | 278 |
| 273 | 3300053085 | Ga0495619_0002500 | Ga0495619_0002500_7200_8042 | 278 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1qd5-assembly1.cif.gz_A | outer membrane phospholipase a from escherichia coli | 0.4568 | 146 | 202 |
| 3cqn-assembly2.cif.gz_B | crystal structure of the lipocalin domain of violaxanthin de-epoxidase (vde) at ph7 | 0.4375 | 147 | 203 |
| 2znl-assembly1.cif.gz_A | crystal structure of pa-pb1 complex form influenza virus rna polymerase | 0.4024 | 143 | 202 |
| 6w1s-assembly1.cif.gz_I | atomic model of the mammalian mediator complex | 0.4023 | 140 | 198 |
| 2x56-assembly1.cif.gz_A | yersinia pestis plasminogen activator pla (native) | 0.3834 | 146 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PN63_77_207_3.30.70.270 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.7453 | 8 | 61 | 3.30.70.270 |
| af_K7WGR9_24_124_3.10.450.10 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.6047 | 143 | 203 | 3.10.450.10 |
| af_A4HSA1_1_99_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5577 | 9 | 70 | 1.25.10.10 |
| af_D4A6T9_642_752_3.30.310.80 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 | 0.557 | 95 | 237 | 3.30.310.80 |
| af_A0A1D8PQK1_7_271_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.5213 | 16 | 71 | 1.50.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9EB37-F1-model_v4 | LssY C-terminal domain-containing protein | 0.8552 | 90 | 245 |
|
| AF-A0A2V9JZ37-F1-model_v4 | LssY-like C-terminal domain-containing protein | 0.8435 | 81 | 238 |
|
| AF-A0A5C7R3C9-F1-model_v4 | deleted | 0.8335 | 94 | 152 |
|
| AF-A0A534A2G4-F1-model_v4 | LssY-like C-terminal domain-containing protein | 0.83 | 79 | 238 |
|
| AF-A0A2V9HD53-F1-model_v4 | LssY-like C-terminal domain-containing protein | 0.8083 | 79 | 238 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar