F379146

General Info

Members Datasets Scaffolds Average Seq Length
273 191 266 278

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0176151|Ga0316574_0176151_478_1320
Length 280
Sequence LGAVRLAILILQRLAILSLGAVGIWLIVNVFQWVDGELPSVLALAATYGLAAYVILPYIVRMGLMVLRHQHVPSFTITGDGLPGDPVNLALVGTFDELRAAFAKAGWHEADPLTLSSSWGMVRAFILNTPYPKAPFSTLYLFGRGQDIGFQKPIGKSPRKRHHVRFWAKCLTEAETVDDVFWHGTNRPDTRERVXXXXAGTKDTGFSLTRLTFQITHATDSDTMAERDFIMAELARNGTIGMVDLYDAGEELAAGTVNHYVTDGIIAVAPLLTPPAREAG

Samples

Sample ID Description Type Environment
1 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
4 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
5 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
6 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
7 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
109 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
110 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
111 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
112 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 1.1
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 1.83
Rhizoplane 13.92
Rhizosphere 76.56
Stem 0
Stem Tuber 0
Unclassified 2.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10148404 3300003320 Bacteria 1267
2 JGI25404J52841_10000089 3300003659 Bacteria 8691
3 Ga0070676_10045841 3300005328 Bacteria 2547
4 Ga0070670_100151540 3300005331 Bacteria 2006
5 Ga0070677_10067131 3300005333 Bacteria 1498
6 Ga0068869_100035273 3300005334 Bacteria 3544
7 Ga0070666_10136507 3300005335 Bacteria 1706
8 Ga0070680_100027644 3300005336 Bacteria 4543
9 Ga0070682_100030069 3300005337 Bacteria 3275
10 Ga0070675_100320336 3300005354 Bacteria 1369
11 Ga0070674_100177309 3300005356 Bacteria 1629
12 Ga0070688_100192735 3300005365 Unclassified 1421
13 Ga0070659_100278044 3300005366 Bacteria 1392
14 Ga0070667_100132524 3300005367 Bacteria 2176
15 Ga0070709_10031855 3300005434 Bacteria 3175
16 Ga0070709_10338942 3300005434 Unclassified 1108
17 Ga0070713_100083286 3300005436 Bacteria 2734
18 Ga0070713_100091308 3300005436 Bacteria 2620
19 Ga0070710_10088264 3300005437 Bacteria 1824
20 Ga0070711_100013248 3300005439 Bacteria 5175
21 Ga0070711_100019894 3300005439 Bacteria 4316
22 Ga0070663_100046733 3300005455 Bacteria 3064
23 Ga0070678_100020861 3300005456 Bacteria 4306
24 Ga0070678_100374537 3300005456 Bacteria 1230
25 Ga0070678_100460280 3300005456 Unclassified 1116
26 Ga0070662_100006286 3300005457 Bacteria 7651
27 Ga0070681_10100870 3300005458 Bacteria 2832
28 Ga0070698_100053090 3300005471 Bacteria 4120
29 Ga0070679_100019324 3300005530 Bacteria 6621
30 Ga0068853_100168974 3300005539 Bacteria 1978
31 Ga0070693_100230343 3300005547 Unclassified 1218
32 Ga0070665_100064927 3300005548 Bacteria 3662
33 Ga0070665_100201195 3300005548 Bacteria 1992
34 Ga0070664_100396535 3300005564 Unclassified 1261
35 Ga0068852_100454307 3300005616 Bacteria 1269
36 Ga0068859_100036907 3300005617 Bacteria 4905
37 Ga0068864_100008150 3300005618 Bacteria 8641
38 Ga0068864_100211257 3300005618 Bacteria 1787
39 Ga0068866_10161522 3300005718 Bacteria 1307
40 Ga0068870_10087775 3300005840 Bacteria 1732
41 Ga0068863_100069373 3300005841 Unclassified 3333
42 Ga0068858_100154580 3300005842 Unclassified 2158
43 Ga0068858_100286609 3300005842 Bacteria 1569
44 Ga0068860_100130903 3300005843 Bacteria 2407
45 Ga0068860_100864671 3300005843 Unclassified 919
46 Ga0081455_10005996 3300005937 Bacteria 13181
47 Ga0081455_10018676 3300005937 Bacteria 6587
48 Ga0081455_10050891 3300005937 Bacteria 3557
49 Ga0081540_1004495 3300005983 Bacteria 10593
50 Ga0070717_10204933 3300006028 Bacteria 1729
51 Ga0070717_10373310 3300006028 Unclassified 1278
52 Ga0075368_10005101 3300006042 Bacteria 4496
53 Ga0075364_10021945 3300006051 Bacteria 4027
54 Ga0070716_100054542 3300006173 Bacteria 2283
55 Ga0070712_100030059 3300006175 Bacteria 3647
56 Ga0070712_100199000 3300006175 Unclassified 1573
57 Ga0070712_100225781 3300006175 Unclassified 1485
58 Ga0075362_10007723 3300006177 Bacteria 4086
59 Ga0075367_10006473 3300006178 Bacteria 5920
60 Ga0075369_10001562 3300006186 Bacteria 7851
61 Ga0075366_10011123 3300006195 Bacteria 5072
62 Ga0097621_100023644 3300006237 Bacteria 4787
63 Ga0075430_100573923 3300006846 Bacteria 930
64 Ga0075436_100231820 3300006914 Bacteria 1312
65 Ga0097620_100036909 3300006931 Bacteria 4905
66 Ga0099795_10060166 3300007788 Bacteria 1407
67 Ga0105245_10019318 3300009098 Bacteria 5966
68 Ga0105245_10164393 3300009098 Bacteria 2108
69 Ga0105247_10020404 3300009101 Bacteria 3984
70 Ga0105241_10033897 3300009174 Bacteria 3835
71 Ga0105242_10224786 3300009176 Bacteria 1679
72 Ga0105248_10124146 3300009177 Bacteria 2912
73 Ga0105248_10171994 3300009177 Bacteria 2441
74 Ga0105237_10062886 3300009545 Bacteria 3710
75 Ga0105237_10215889 3300009545 Bacteria 1918
76 Ga0099796_10089679 3300010159 Bacteria 1141
77 Ga0105246_10033101 3300011119 Bacteria 3433
78 Ga0105246_10337508 3300011119 Bacteria 1230
79 Ga0157369_10126173 3300013105 Bacteria 2713
80 Ga0157374_10013893 3300013296 Bacteria 7036
81 Ga0163162_10248476 3300013306 Bacteria 1911
82 Ga0163163_10043111 3300014325 Bacteria 4422
83 Ga0163163_10053852 3300014325 Bacteria 3973
84 Ga0163163_10247157 3300014325 Bacteria 1834
85 Ga0157380_10363958 3300014326 Bacteria 1358
86 Ga0182008_10069910 3300014497 Bacteria 1727
87 Ga0157379_10169351 3300014968 Bacteria 1972
88 Ga0157376_10047207 3300014969 Bacteria 3554
89 Ga0224572_1003318 3300024225 Bacteria 2707
90 Ga0224572_1007836 3300024225 Bacteria 1965
91 Ga0207682_10027202 3300025893 Bacteria 2276
92 Ga0207692_10147405 3300025898 Bacteria 1344
93 Ga0207692_10289208 3300025898 Bacteria 994
94 Ga0207710_10058402 3300025900 Bacteria 1744
95 Ga0207699_10315770 3300025906 Unclassified 1095
96 Ga0207643_10054499 3300025908 Bacteria 2273
97 Ga0207693_10075280 3300025915 Bacteria 2644
98 Ga0207693_10147723 3300025915 Bacteria 1848
99 Ga0207693_10166678 3300025915 Bacteria 1734
100 Ga0207663_10316949 3300025916 Bacteria 1170
101 Ga0207660_10020373 3300025917 Bacteria 4449
102 Ga0207649_10486763 3300025920 Bacteria 936
103 Ga0207652_10003812 3300025921 Bacteria 12360
104 Ga0207650_10146565 3300025925 Bacteria 1860
105 Ga0207687_10006993 3300025927 Bacteria 7433
106 Ga0207665_10055658 3300025939 Bacteria 2670
107 Ga0207665_10213572 3300025939 Bacteria 1411
108 Ga0207711_10029518 3300025941 Bacteria 4626
109 Ga0207667_10017893 3300025949 Bacteria 7965
110 Ga0207668_10024113 3300025972 Bacteria 3921
111 Ga0207677_10026778 3300026023 Bacteria 3621
112 Ga0207703_10016819 3300026035 Bacteria 5704
113 Ga0207702_10026251 3300026078 Bacteria 4834
114 Ga0207641_10004827 3300026088 Bacteria 11613
115 Ga0207641_10284484 3300026088 Bacteria 1556
116 Ga0207676_10472433 3300026095 Unclassified 1186
117 Ga0207674_10174536 3300026116 Bacteria 2102
118 Ga0207683_10327490 3300026121 Unclassified 1404
119 Ga0209813_10003162 3300027866 Bacteria 3833
120 Ga0207428_10114926 3300027907 Bacteria 2068
121 Ga0268266_10005868 3300028379 Bacteria 11364
122 Ga0268266_10054374 3300028379 Bacteria 3440
123 Ga0268264_10077089 3300028381 Bacteria 2838
124 Ga0265763_1001412 3300030763 Bacteria 1708
125 Ga0265760_10008034 3300031090 Unclassified 3014
126 Ga0265760_10014312 3300031090 Bacteria 2272
127 Ga0265340_10107001 3300031247 Bacteria 1296
128 Ga0265339_10004749 3300031249 Bacteria 9210
129 Ga0316575_10003555 3300031665 Bacteria 5392
130 Ga0316575_10016489 3300031665 Bacteria 2797
131 Ga0316579_10002372 3300031691 Bacteria 7104
132 Ga0316579_10008780 3300031691 Bacteria 4226
133 Ga0316578_10008004 3300031728 Bacteria 5344
134 Ga0316578_10110416 3300031728 Bacteria 1651
135 Ga0316583_10005885 3300032133 Bacteria 4410
136 Ga0316580_10026385 3300032139 Bacteria 1796
137 Ga0373944_0043557 3300035089 Bacteria 1395
138 Ga0373949_0061106 3300035090 Bacteria 970
139 Ga0373946_0020998 3300035171 Bacteria 2528
140 Ga0316574_0000249 3300035398 Bacteria 19588
141 Ga0316574_0176151 3300035398 Bacteria 1376
142 Ga0373924_0083496 3300035410 Bacteria 1361
143 Ga0373931_0045376 3300035691 Bacteria 2321
144 Ga0373931_0206019 3300035691 Unclassified 1177
145 Ga0373927_0118330 3300035695 Bacteria 1728
146 Ga0373947_0027342 3300035725 Bacteria 3338
147 Ga0373947_0050297 3300035725 Bacteria 2506
148 Ga0373937_0055060 3300036401 Bacteria 3651
149 Ga0373937_0065566 3300036401 Bacteria 3343
150 Ga0373937_0272220 3300036401 Bacteria 1598
151 Ga0316582_0080543 3300036647 Bacteria 2125
152 Ga0316584_0041651 3300036712 Bacteria 3423
153 Ga0373925_0505321 3300037068 Unclassified 992
154 Ga0373925_0609581 3300037068 Unclassified 899
155 Ga0395898_0014766 3300037466 Bacteria 8017
156 Ga0436361_0435672 3300039447 Bacteria 1720
157 Ga0466968_0052338 3300044735 Bacteria 1746
158 Ga0466970_0166598 3300044765 Bacteria 1220
159 Ga0466960_0201685 3300044901 Bacteria 1087
160 Ga0495651_0139925 3300046462 Unclassified 1756
161 Ga0495651_0146711 3300046462 Bacteria 1705
162 Ga0495580_0033700 3300046472 Bacteria 3689
163 Ga0495662_0066397 3300046476 Unclassified 1745
164 Ga0495664_0239194 3300046477 Bacteria 1098
165 Ga0495594_0073589 3300046499 Bacteria 1902
166 Ga0495594_0264268 3300046499 Bacteria 980
167 Ga0495608_0028601 3300046511 Bacteria 3788
168 Ga0495618_0032403 3300046514 Bacteria 3273
169 Ga0495618_0060699 3300046514 Bacteria 2398
170 Ga0495628_0186823 3300046516 Bacteria 1566
171 Ga0495630_0109656 3300046517 Bacteria 2091
172 Ga0495630_0214822 3300046517 Bacteria 1468
173 Ga0495642_0111142 3300046528 Unclassified 1172
174 Ga0495640_0016950 3300046533 Bacteria 5439
175 Ga0495587_0015477 3300046536 Bacteria 4763
176 Ga0495645_0030325 3300046543 Unclassified 3938
177 Ga0495667_0088045 3300046559 Bacteria 2013
178 Ga0495634_0025247 3300046642 Bacteria 4161
179 Ga0495634_0028918 3300046642 Bacteria 3842
180 Ga0495635_0006253 3300046663 Bacteria 8294
181 Ga0495635_0229316 3300046663 Unclassified 1255
182 Ga0495588_0051850 3300046674 Unclassified 2114
183 Ga0495657_0028817 3300046675 Bacteria 3900
184 Ga0495657_0183355 3300046675 Bacteria 1283
185 Ga0495623_0098897 3300046679 Bacteria 1780
186 Ga0495646_0049879 3300046680 Bacteria 2539
187 Ga0495624_0023647 3300046690 Bacteria 4050
188 Ga0495581_0084313 3300047315 Bacteria 1841
189 Ga0495604_0103443 3300047317 Bacteria 2089
190 Ga0495674_0292055 3300047319 Bacteria 1333
191 Ga0495680_0030393 3300047322 Bacteria 4411
192 Ga0495680_0077837 3300047322 Bacteria 2511
193 Ga0495680_0266034 3300047322 Unclassified 1212
194 Ga0495675_0022889 3300047444 Bacteria 3983
195 Ga0495675_0049950 3300047444 Bacteria 2658
196 Ga0495675_0105642 3300047444 Bacteria 1760
197 Ga0495675_0132774 3300047444 Bacteria 1547
198 Ga0495684_0189703 3300047471 Bacteria 1520
199 Ga0495684_0232522 3300047471 Unclassified 1348
200 Ga0495602_0017221 3300048088 Bacteria 7245
201 Ga0495602_0157697 3300048088 Bacteria 1775
202 Ga0496101_0041679 3300048904 Bacteria 3275
203 Ga0496102_0296513 3300048905 Bacteria 1524
204 Ga0496103_0206428 3300048906 Bacteria 1264
205 Ga0496103_0228456 3300048906 Bacteria 1197
206 Ga0496104_0007587 3300048907 Bacteria 9603
207 Ga0496104_0159763 3300048907 Bacteria 2162
208 Ga0496104_0170506 3300048907 Bacteria 2087
209 Ga0496104_0170930 3300048907 Bacteria 2084
210 Ga0496104_0487569 3300048907 Bacteria 1144
211 Ga0496105_0031690 3300048908 Bacteria 4335
212 Ga0496105_0149682 3300048908 Bacteria 1919
213 Ga0496105_0174202 3300048908 Bacteria 1763
214 Ga0496105_0253352 3300048908 Bacteria 1426
215 Ga0496106_0334816 3300048909 Bacteria 1215
216 Ga0496107_0045948 3300048910 Bacteria 3142
217 Ga0496107_0248707 3300048910 Bacteria 1323
218 Ga0496108_0020459 3300048911 Bacteria 5440
219 Ga0496108_0030070 3300048911 Bacteria 4502
220 Ga0496108_0357544 3300048911 Bacteria 1274
221 Ga0496109_0184919 3300048912 Bacteria 1958
222 Ga0496109_0401162 3300048912 Bacteria 1295
223 Ga0496110_0016474 3300048913 Bacteria 6173
224 Ga0496110_0242037 3300048913 Unclassified 1641
225 Ga0496110_0376209 3300048913 Bacteria 1294
226 Ga0496111_0028482 3300048914 Bacteria 3959
227 Ga0496111_0099297 3300048914 Bacteria 2138
228 Ga0496111_0147430 3300048914 Bacteria 1745
229 Ga0496112_0023849 3300048915 Bacteria 5852
230 Ga0496112_0093054 3300048915 Bacteria 2984
231 Ga0496112_0160606 3300048915 Bacteria 2214
232 Ga0496112_0351995 3300048915 Bacteria 1415
233 Ga0496113_0082740 3300048916 Bacteria 2462
234 Ga0496115_0012518 3300048918 Bacteria 6388
235 Ga0496115_0030154 3300048918 Bacteria 4265
236 Ga0496115_0257742 3300048918 Bacteria 1435
237 Ga0496115_0270218 3300048918 Bacteria 1397
238 Ga0496115_0284190 3300048918 Bacteria 1358
239 Ga0496115_0315023 3300048918 Bacteria 1281
240 Ga0496117_0259014 3300048920 Unclassified 944
241 Ga0496121_0028775 3300048924 Bacteria 5163
242 Ga0496125_0067159 3300048928 Bacteria 2828
243 Ga0496126_0086087 3300048929 Bacteria 2770
244 Ga0496126_0164354 3300048929 Bacteria 1895
245 Ga0501048_0000912 3300049582 Bacteria 21787
246 nmdc:mga03n38_25383_c1 3300050490 Bacteria 2433
247 nmdc:mga00v17_30429_c1 3300050491 Bacteria 3177
248 nmdc:mga06z11_82221_c1 3300050494 Bacteria 1731
249 nmdc:mga04h51_2676_c1 3300050495 Bacteria 4243
250 nmdc:mga07m45_8650_c1 3300050496 Bacteria 5243
251 nmdc:mga05p37_598926_c1 3300050507 Bacteria 1244
252 nmdc:mga08y16_134929_c1 3300050511 Bacteria 2565
253 nmdc:mga0n895_266134_c1 3300050512 Bacteria 1739
254 nmdc:mga0rr50_127210_c1 3300050513 Bacteria 2036
255 nmdc:mga08x19_213959_c1 3300050514 Bacteria 1323
256 nmdc:mga0sz30_108829_c1 3300050516 Unclassified 1214
257 Ga0495601_0017596 3300053077 Bacteria 4341
258 Ga0495601_0180001 3300053077 Bacteria 1382
259 Ga0495612_0004615 3300053078 Bacteria 5708
260 Ga0495612_0043471 3300053078 Bacteria 1836
261 Ga0495595_0008948 3300053084 Bacteria 4128
262 Ga0495619_0002138 3300053085 Bacteria 13106
263 Ga0495619_0002500 3300053085 Bacteria 12038
264 Ga0495619_0140362 3300053085 Bacteria 1663
265 Ga0495619_0162998 3300053085 Bacteria 1540
266 Ga0495619_0213339 3300053085 Unclassified 1337

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_598926_c1 nmdc:mga05p37_598926_c1_28_732 234
2 3300005434 Ga0070709_10338942 Ga0070709_103389421 264
3 3300014969 Ga0157376_10047207 Ga0157376_100472074 270
4 3300031665 Ga0316575_10003555 Ga0316575_100035555 270
5 3300031691 Ga0316579_10008780 Ga0316579_100087807 270
6 3300031728 Ga0316578_10008004 Ga0316578_100080047 270
7 3300032133 Ga0316583_10005885 Ga0316583_100058853 270
8 3300036647 Ga0316582_0080543 Ga0316582_0080543_112_936 270
9 3300005548 Ga0070665_100064927 Ga0070665_1000649273 271
10 3300005841 Ga0068863_100069373 Ga0068863_1000693734 271
11 3300006914 Ga0075436_100231820 Ga0075436_1002318201 271
12 3300009177 Ga0105248_10124146 Ga0105248_101241463 271
13 3300014325 Ga0163163_10043111 Ga0163163_100431113 271
14 3300026088 Ga0207641_10004827 Ga0207641_100048277 271
15 3300028379 Ga0268266_10054374 Ga0268266_100543742 271
16 3300044765 Ga0466970_0166598 Ga0466970_0166598_251_1069 271
17 iso_pu_bacteria 2513237104 2513715386 271
18 iso_pu_bacteria 2513237141 2513893279 271
19 iso_pu_bacteria 2524023205 2524439503 271
20 iso_pu_bacteria 2524023228 2524542715 271
21 iso_pu_bacteria 2744054633 2745078214 271
22 iso_pu_bacteria 2903748898 2903752067 271
23 3300006846 Ga0075430_100573923 Ga0075430_1005739231 272
24 3300035090 Ga0373949_0061106 Ga0373949_0061106_137_958 272
25 3300046462 Ga0495651_0139925 Ga0495651_0139925_169_987 272
26 3300046536 Ga0495587_0015477 Ga0495587_0015477_520_1338 272
27 3300046663 Ga0495635_0229316 Ga0495635_0229316_207_1025 272
28 3300047444 Ga0495675_0132774 Ga0495675_0132774_239_1057 272
29 3300050513 nmdc:mga0rr50_127210_c1 nmdc:mga0rr50_127210_c1_166_987 272
30 3300050514 nmdc:mga08x19_213959_c1 nmdc:mga08x19_213959_c1_43_864 272
31 3300053085 Ga0495619_0213339 Ga0495619_0213339_185_1006 272
32 3300005439 Ga0070711_100013248 Ga0070711_1000132482 273
33 3300006028 Ga0070717_10373310 Ga0070717_103733101 273
34 3300006173 Ga0070716_100054542 Ga0070716_1000545422 273
35 3300025939 Ga0207665_10055658 Ga0207665_100556582 273
36 3300031247 Ga0265340_10107001 Ga0265340_101070012 273
37 3300031249 Ga0265339_10004749 Ga0265339_100047493 273
38 3300031665 Ga0316575_10016489 Ga0316575_100164892 273
39 3300031691 Ga0316579_10002372 Ga0316579_100023725 273
40 3300031728 Ga0316578_10110416 Ga0316578_101104161 273
41 3300032139 Ga0316580_10026385 Ga0316580_100263852 273
42 3300035089 Ga0373944_0043557 Ga0373944_0043557_19_843 273
43 3300035398 Ga0316574_0000249 Ga0316574_0000249_5687_6511 273
44 3300036712 Ga0316584_0041651 Ga0316584_0041651_673_1497 273
45 3300037466 Ga0395898_0014766 Ga0395898_0014766_3627_4451 273
46 3300046642 Ga0495634_0025247 Ga0495634_0025247_603_1439 273
47 3300048929 Ga0496126_0086087 Ga0496126_0086087_1547_2371 273
48 3300053085 Ga0495619_0162998 Ga0495619_0162998_176_1012 273
49 iso_pu_bacteria 2902405164 2902409422 273
50 3300005436 Ga0070713_100091308 Ga0070713_1000913082 274
51 3300006175 Ga0070712_100199000 Ga0070712_1001990002 274
52 3300025906 Ga0207699_10315770 Ga0207699_103157701 274
53 3300035398 Ga0316574_0176151 Ga0316574_0176151_478_1320 274
54 3300036401 Ga0373937_0065566 Ga0373937_0065566_1094_1921 274
55 3300037068 Ga0373925_0609581 Ga0373925_0609581_20_847 274
56 3300044735 Ga0466968_0052338 Ga0466968_0052338_79_915 274
57 3300044901 Ga0466960_0201685 Ga0466960_0201685_241_1077 274
58 3300046476 Ga0495662_0066397 Ga0495662_0066397_93_920 274
59 3300046663 Ga0495635_0006253 Ga0495635_0006253_6086_6913 274
60 3300047319 Ga0495674_0292055 Ga0495674_0292055_278_1105 274
61 3300050512 nmdc:mga0n895_266134_c1 nmdc:mga0n895_266134_c1_848_1684 274
62 3300053077 Ga0495601_0180001 Ga0495601_0180001_340_1167 274
63 3300053078 Ga0495612_0043471 Ga0495612_0043471_424_1251 274
64 3300053084 Ga0495595_0008948 Ga0495595_0008948_1944_2771 274
65 3300053085 Ga0495619_0002138 Ga0495619_0002138_6159_6986 274
66 3300003659 JGI25404J52841_10000089 JGI25404J52841_100000892 275
67 3300005328 Ga0070676_10045841 Ga0070676_100458412 275
68 3300005331 Ga0070670_100151540 Ga0070670_1001515403 275
69 3300005334 Ga0068869_100035273 Ga0068869_1000352734 275
70 3300005335 Ga0070666_10136507 Ga0070666_101365072 275
71 3300005336 Ga0070680_100027644 Ga0070680_1000276443 275
72 3300005337 Ga0070682_100030069 Ga0070682_1000300694 275
73 3300005354 Ga0070675_100320336 Ga0070675_1003203361 275
74 3300005365 Ga0070688_100192735 Ga0070688_1001927352 275
75 3300005366 Ga0070659_100278044 Ga0070659_1002780442 275
76 3300005367 Ga0070667_100132524 Ga0070667_1001325243 275
77 3300005434 Ga0070709_10031855 Ga0070709_100318553 275
78 3300005436 Ga0070713_100083286 Ga0070713_1000832863 275
79 3300005439 Ga0070711_100019894 Ga0070711_1000198943 275
80 3300005455 Ga0070663_100046733 Ga0070663_1000467333 275
81 3300005456 Ga0070678_100020861 Ga0070678_1000208616 275
82 3300005458 Ga0070681_10100870 Ga0070681_101008702 275
83 3300005471 Ga0070698_100053090 Ga0070698_1000530905 275
84 3300005530 Ga0070679_100019324 Ga0070679_1000193242 275
85 3300005547 Ga0070693_100230343 Ga0070693_1002303431 275
86 3300005548 Ga0070665_100201195 Ga0070665_1002011952 275
87 3300005564 Ga0070664_100396535 Ga0070664_1003965352 275
88 3300005617 Ga0068859_100036907 Ga0068859_1000369076 275
89 3300005618 Ga0068864_100008150 Ga0068864_1000081503 275
90 3300005618 Ga0068864_100211257 Ga0068864_1002112572 275
91 3300005718 Ga0068866_10161522 Ga0068866_101615222 275
92 3300005840 Ga0068870_10087775 Ga0068870_100877753 275
93 3300005842 Ga0068858_100154580 Ga0068858_1001545802 275
94 3300005842 Ga0068858_100286609 Ga0068858_1002866092 275
95 3300005843 Ga0068860_100130903 Ga0068860_1001309033 275
96 3300005843 Ga0068860_100864671 Ga0068860_1008646711 275
97 3300005937 Ga0081455_10005996 Ga0081455_1000599614 275
98 3300005937 Ga0081455_10018676 Ga0081455_100186764 275
99 3300005937 Ga0081455_10050891 Ga0081455_100508915 275
100 3300005983 Ga0081540_1004495 Ga0081540_10044953 275
101 3300006042 Ga0075368_10005101 Ga0075368_100051015 275
102 3300006051 Ga0075364_10021945 Ga0075364_100219452 275
103 3300006175 Ga0070712_100030059 Ga0070712_1000300594 275
104 3300006177 Ga0075362_10007723 Ga0075362_100077231 275
105 3300006178 Ga0075367_10006473 Ga0075367_100064738 275
106 3300006186 Ga0075369_10001562 Ga0075369_1000156211 275
107 3300006195 Ga0075366_10011123 Ga0075366_100111238 275
108 3300006237 Ga0097621_100023644 Ga0097621_1000236445 275
109 3300006931 Ga0097620_100036909 Ga0097620_1000369096 275
110 3300009098 Ga0105245_10019318 Ga0105245_100193188 275
111 3300009098 Ga0105245_10164393 Ga0105245_101643932 275
112 3300009101 Ga0105247_10020404 Ga0105247_100204042 275
113 3300009174 Ga0105241_10033897 Ga0105241_100338975 275
114 3300009176 Ga0105242_10224786 Ga0105242_102247863 275
115 3300009177 Ga0105248_10171994 Ga0105248_101719942 275
116 3300009545 Ga0105237_10062886 Ga0105237_100628865 275
117 3300009545 Ga0105237_10215889 Ga0105237_102158892 275
118 3300010159 Ga0099796_10089679 Ga0099796_100896792 275
119 3300011119 Ga0105246_10033101 Ga0105246_100331012 275
120 3300011119 Ga0105246_10337508 Ga0105246_103375081 275
121 3300013105 Ga0157369_10126173 Ga0157369_101261733 275
122 3300013296 Ga0157374_10013893 Ga0157374_100138938 275
123 3300013306 Ga0163162_10248476 Ga0163162_102484762 275
124 3300014325 Ga0163163_10053852 Ga0163163_100538522 275
125 3300014325 Ga0163163_10247157 Ga0163163_102471572 275
126 3300014497 Ga0182008_10069910 Ga0182008_100699102 275
127 3300014968 Ga0157379_10169351 Ga0157379_101693512 275
128 3300025898 Ga0207692_10147405 Ga0207692_101474052 275
129 3300025898 Ga0207692_10289208 Ga0207692_102892081 275
130 3300025900 Ga0207710_10058402 Ga0207710_100584022 275
131 3300025908 Ga0207643_10054499 Ga0207643_100544993 275
132 3300025915 Ga0207693_10075280 Ga0207693_100752802 275
133 3300025915 Ga0207693_10166678 Ga0207693_101666782 275
134 3300025916 Ga0207663_10316949 Ga0207663_103169491 275
135 3300025917 Ga0207660_10020373 Ga0207660_100203734 275
136 3300025920 Ga0207649_10486763 Ga0207649_104867632 275
137 3300025921 Ga0207652_10003812 Ga0207652_100038125 275
138 3300025925 Ga0207650_10146565 Ga0207650_101465651 275
139 3300025927 Ga0207687_10006993 Ga0207687_100069937 275
140 3300025939 Ga0207665_10213572 Ga0207665_102135722 275
141 3300025941 Ga0207711_10029518 Ga0207711_100295182 275
142 3300025949 Ga0207667_10017893 Ga0207667_100178932 275
143 3300025972 Ga0207668_10024113 Ga0207668_100241133 275
144 3300026023 Ga0207677_10026778 Ga0207677_100267785 275
145 3300026035 Ga0207703_10016819 Ga0207703_100168198 275
146 3300026078 Ga0207702_10026251 Ga0207702_100262511 275
147 3300026088 Ga0207641_10284484 Ga0207641_102844841 275
148 3300026095 Ga0207676_10472433 Ga0207676_104724332 275
149 3300026116 Ga0207674_10174536 Ga0207674_101745362 275
150 3300026121 Ga0207683_10327490 Ga0207683_103274902 275
151 3300027866 Ga0209813_10003162 Ga0209813_100031622 275
152 3300027907 Ga0207428_10114926 Ga0207428_101149262 275
153 3300028379 Ga0268266_10005868 Ga0268266_100058685 275
154 3300028381 Ga0268264_10077089 Ga0268264_100770893 275
155 3300030763 Ga0265763_1001412 Ga0265763_10014121 275
156 3300035691 Ga0373931_0206019 Ga0373931_0206019_197_1027 275
157 3300036401 Ga0373937_0055060 Ga0373937_0055060_1731_2561 275
158 3300036401 Ga0373937_0272220 Ga0373937_0272220_704_1534 275
159 3300046462 Ga0495651_0146711 Ga0495651_0146711_195_1025 275
160 3300046477 Ga0495664_0239194 Ga0495664_0239194_64_1002 275
161 3300046499 Ga0495594_0264268 Ga0495594_0264268_95_925 275
162 3300046516 Ga0495628_0186823 Ga0495628_0186823_274_1212 275
163 3300046517 Ga0495630_0214822 Ga0495630_0214822_470_1408 275
164 3300046528 Ga0495642_0111142 Ga0495642_0111142_310_1140 275
165 3300046559 Ga0495667_0088045 Ga0495667_0088045_448_1386 275
166 3300046675 Ga0495657_0028817 Ga0495657_0028817_2047_2877 275
167 3300046675 Ga0495657_0183355 Ga0495657_0183355_34_930 275
168 3300047317 Ga0495604_0103443 Ga0495604_0103443_1088_2026 275
169 3300047322 Ga0495680_0030393 Ga0495680_0030393_637_1575 275
170 3300047322 Ga0495680_0266034 Ga0495680_0266034_53_880 275
171 3300047444 Ga0495675_0022889 Ga0495675_0022889_1919_2749 275
172 3300047444 Ga0495675_0105642 Ga0495675_0105642_605_1543 275
173 3300047471 Ga0495684_0232522 Ga0495684_0232522_234_1172 275
174 3300048088 Ga0495602_0157697 Ga0495602_0157697_570_1508 275
175 3300048904 Ga0496101_0041679 Ga0496101_0041679_1704_2534 275
176 3300048905 Ga0496102_0296513 Ga0496102_0296513_390_1220 275
177 3300048906 Ga0496103_0206428 Ga0496103_0206428_96_926 275
178 3300048906 Ga0496103_0228456 Ga0496103_0228456_328_1158 275
179 3300048907 Ga0496104_0007587 Ga0496104_0007587_4255_5085 275
180 3300048907 Ga0496104_0159763 Ga0496104_0159763_968_1810 275
181 3300048907 Ga0496104_0170506 Ga0496104_0170506_300_1130 275
182 3300048907 Ga0496104_0170930 Ga0496104_0170930_731_1561 275
183 3300048908 Ga0496105_0031690 Ga0496105_0031690_2436_3266 275
184 3300048908 Ga0496105_0149682 Ga0496105_0149682_904_1734 275
185 3300048908 Ga0496105_0174202 Ga0496105_0174202_421_1251 275
186 3300048908 Ga0496105_0253352 Ga0496105_0253352_516_1346 275
187 3300048910 Ga0496107_0045948 Ga0496107_0045948_660_1490 275
188 3300048911 Ga0496108_0020459 Ga0496108_0020459_1896_2726 275
189 3300048911 Ga0496108_0030070 Ga0496108_0030070_2315_3157 275
190 3300048911 Ga0496108_0357544 Ga0496108_0357544_406_1236 275
191 3300048912 Ga0496109_0184919 Ga0496109_0184919_849_1679 275
192 3300048912 Ga0496109_0401162 Ga0496109_0401162_246_1076 275
193 3300048913 Ga0496110_0016474 Ga0496110_0016474_979_1809 275
194 3300048913 Ga0496110_0242037 Ga0496110_0242037_521_1363 275
195 3300048913 Ga0496110_0376209 Ga0496110_0376209_191_1021 275
196 3300048914 Ga0496111_0028482 Ga0496111_0028482_391_1233 275
197 3300048914 Ga0496111_0099297 Ga0496111_0099297_17_847 275
198 3300048914 Ga0496111_0147430 Ga0496111_0147430_592_1422 275
199 3300048915 Ga0496112_0023849 Ga0496112_0023849_4747_5589 275
200 3300048915 Ga0496112_0093054 Ga0496112_0093054_1483_2313 275
201 3300048915 Ga0496112_0160606 Ga0496112_0160606_847_1677 275
202 3300048915 Ga0496112_0351995 Ga0496112_0351995_191_1021 275
203 3300048916 Ga0496113_0082740 Ga0496113_0082740_944_1774 275
204 3300048918 Ga0496115_0257742 Ga0496115_0257742_441_1271 275
205 3300048918 Ga0496115_0270218 Ga0496115_0270218_141_971 275
206 3300048918 Ga0496115_0284190 Ga0496115_0284190_50_880 275
207 3300048920 Ga0496117_0259014 Ga0496117_0259014_20_850 275
208 3300048924 Ga0496121_0028775 Ga0496121_0028775_2998_3828 275
209 3300048928 Ga0496125_0067159 Ga0496125_0067159_566_1396 275
210 3300048929 Ga0496126_0164354 Ga0496126_0164354_571_1401 275
211 3300050490 nmdc:mga03n38_25383_c1 nmdc:mga03n38_25383_c1_167_997 275
212 3300050491 nmdc:mga00v17_30429_c1 nmdc:mga00v17_30429_c1_636_1466 275
213 3300050494 nmdc:mga06z11_82221_c1 nmdc:mga06z11_82221_c1_69_899 275
214 3300050495 nmdc:mga04h51_2676_c1 nmdc:mga04h51_2676_c1_2722_3552 275
215 3300050496 nmdc:mga07m45_8650_c1 nmdc:mga07m45_8650_c1_833_1663 275
216 3300050511 nmdc:mga08y16_134929_c1 nmdc:mga08y16_134929_c1_1155_1985 275
217 3300050516 nmdc:mga0sz30_108829_c1 nmdc:mga0sz30_108829_c1_39_869 275
218 3300006175 Ga0070712_100225781 Ga0070712_1002257812 276
219 3300024225 Ga0224572_1003318 Ga0224572_10033183 276
220 3300024225 Ga0224572_1007836 Ga0224572_10078362 276
221 3300025915 Ga0207693_10147723 Ga0207693_101477231 276
222 3300035725 Ga0373947_0050297 Ga0373947_0050297_1263_2282 276
223 3300039447 Ga0436361_0435672 Ga0436361_0435672_576_1442 276
224 3300046511 Ga0495608_0028601 Ga0495608_0028601_2595_3428 276
225 3300046514 Ga0495618_0060699 Ga0495618_0060699_720_1553 276
226 3300046543 Ga0495645_0030325 Ga0495645_0030325_1007_1840 276
227 3300046679 Ga0495623_0098897 Ga0495623_0098897_238_1179 276
228 3300046680 Ga0495646_0049879 Ga0495646_0049879_1636_2469 276
229 3300047444 Ga0495675_0049950 Ga0495675_0049950_1124_1957 276
230 3300047471 Ga0495684_0189703 Ga0495684_0189703_120_953 276
231 3300048088 Ga0495602_0017221 Ga0495602_0017221_4139_4972 276
232 3300048909 Ga0496106_0334816 Ga0496106_0334816_221_1090 276
233 3300048910 Ga0496107_0248707 Ga0496107_0248707_306_1175 276
234 3300048918 Ga0496115_0030154 Ga0496115_0030154_450_1319 276
235 3300053077 Ga0495601_0017596 Ga0495601_0017596_892_1725 276
236 3300053085 Ga0495619_0140362 Ga0495619_0140362_544_1377 276
237 3300005437 Ga0070710_10088264 Ga0070710_100882642 277
238 3300005456 Ga0070678_100374537 Ga0070678_1003745371 277
239 3300005457 Ga0070662_100006286 Ga0070662_1000062862 277
240 3300005539 Ga0068853_100168974 Ga0068853_1001689742 277
241 3300005616 Ga0068852_100454307 Ga0068852_1004543071 277
242 3300007788 Ga0099795_10060166 Ga0099795_100601662 277
243 3300014326 Ga0157380_10363958 Ga0157380_103639581 277
244 3300031090 Ga0265760_10008034 Ga0265760_100080342 277
245 3300031090 Ga0265760_10014312 Ga0265760_100143122 277
246 3300035410 Ga0373924_0083496 Ga0373924_0083496_235_1077 277
247 3300003320 rootH2_10148404 rootH2_101484041 278
248 3300005333 Ga0070677_10067131 Ga0070677_100671312 278
249 3300005356 Ga0070674_100177309 Ga0070674_1001773091 278
250 3300005456 Ga0070678_100460280 Ga0070678_1004602801 278
251 3300006028 Ga0070717_10204933 Ga0070717_102049331 278
252 3300025893 Ga0207682_10027202 Ga0207682_100272021 278
253 3300035171 Ga0373946_0020998 Ga0373946_0020998_937_1779 278
254 3300035691 Ga0373931_0045376 Ga0373931_0045376_346_1185 278
255 3300035695 Ga0373927_0118330 Ga0373927_0118330_775_1617 278
256 3300035725 Ga0373947_0027342 Ga0373947_0027342_1193_2035 278
257 3300037068 Ga0373925_0505321 Ga0373925_0505321_42_884 278
258 3300046472 Ga0495580_0033700 Ga0495580_0033700_1448_2290 278
259 3300046499 Ga0495594_0073589 Ga0495594_0073589_890_1732 278
260 3300046514 Ga0495618_0032403 Ga0495618_0032403_1157_1999 278
261 3300046517 Ga0495630_0109656 Ga0495630_0109656_610_1452 278
262 3300046533 Ga0495640_0016950 Ga0495640_0016950_1954_2796 278
263 3300046642 Ga0495634_0028918 Ga0495634_0028918_1769_2620 278
264 3300046674 Ga0495588_0051850 Ga0495588_0051850_302_1144 278
265 3300046690 Ga0495624_0023647 Ga0495624_0023647_1301_2143 278
266 3300047315 Ga0495581_0084313 Ga0495581_0084313_335_1177 278
267 3300047322 Ga0495680_0077837 Ga0495680_0077837_1214_2056 278
268 3300048907 Ga0496104_0487569 Ga0496104_0487569_126_977 278
269 3300048918 Ga0496115_0012518 Ga0496115_0012518_5502_6341 278
270 3300048918 Ga0496115_0315023 Ga0496115_0315023_68_916 278
271 3300049582 Ga0501048_0000912 Ga0501048_0000912_16038_16874 278
272 3300053078 Ga0495612_0004615 Ga0495612_0004615_2501_3343 278
273 3300053085 Ga0495619_0002500 Ga0495619_0002500_7200_8042 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14067

LssY_C

LssY C-terminus

69

266

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qd5-assembly1.cif.gz_A outer membrane phospholipase a from escherichia coli 0.4568 146 202
3cqn-assembly2.cif.gz_B crystal structure of the lipocalin domain of violaxanthin de-epoxidase (vde) at ph7 0.4375 147 203
2znl-assembly1.cif.gz_A crystal structure of pa-pb1 complex form influenza virus rna polymerase 0.4024 143 202
6w1s-assembly1.cif.gz_I atomic model of the mammalian mediator complex 0.4023 140 198
2x56-assembly1.cif.gz_A yersinia pestis plasminogen activator pla (native) 0.3834 146 202
ID Description Score Start End Superfamily
af_A0A1D8PN63_77_207_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.7453 8 61 3.30.70.270
af_K7WGR9_24_124_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6047 143 203 3.10.450.10
af_A4HSA1_1_99_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5577 9 70 1.25.10.10
af_D4A6T9_642_752_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.557 95 237 3.30.310.80
af_A0A1D8PQK1_7_271_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5213 16 71 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A7V9EB37-F1-model_v4 LssY C-terminal domain-containing protein 0.8552 90 245
AF-A0A2V9JZ37-F1-model_v4 LssY-like C-terminal domain-containing protein 0.8435 81 238
AF-A0A5C7R3C9-F1-model_v4 deleted 0.8335 94 152
AF-A0A534A2G4-F1-model_v4 LssY-like C-terminal domain-containing protein 0.83 79 238
AF-A0A2V9HD53-F1-model_v4 LssY-like C-terminal domain-containing protein 0.8083 79 238

Feature Viewer

pLDDT pTM Quality
71.45 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map