F379115

General Info

Members Datasets Scaffolds Average Seq Length
273 208 257 93

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100000128|Ga0307408_1000001286
Length 107
Sequence MSPNTASPTDTLLAPITRHLCIRGRVQGVGYRWSLVMAARQRGVQGWVRNRRDGSVEAEATGPAEAVQSLIDWAHHGPEHAKVEAVEVHSLPAPTEPLAGFVQRETV

Samples

Sample ID Description Type Environment
1 2643221566 Microbacterium sp. Root166 Isolate Unclassified
2 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
3 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
4 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
5 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
6 2818991446 Variovorax sp. 1180 Isolate Unclassified
7 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
8 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
9 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
10 2899924645 Variovorax sp. 369 Isolate Unclassified
11 2928037797 Variovorax sp. 1126 Isolate Unclassified
12 2928044640 Variovorax sp. 1128 Isolate Unclassified
13 2928051484 Variovorax sp. 1133 Isolate Unclassified
14 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
15 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
29 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
153 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
154 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
157 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
158 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
159 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
160 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
161 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
162 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.04
Metatranscriptomes 1.1
Isolates 5.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.64
Nodule 0.37
Rhizoplane 5.86
Rhizosphere 54.58
Stem 0
Stem Tuber 0
Unclassified 13.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10022912 3300001979 Bacteria 2141
2 JGI24739J22299_10015333 3300001989 Bacteria 2782
3 JGI25158J39367_1004232 3300002739 Bacteria 2163
4 JGI25152J39213_1033250 3300002773 Bacteria 777
5 JGI25150J39212_1007805 3300002774 Bacteria 2129
6 JGI25159J45721_1001862 3300002987 Bacteria 8433
7 JGI25151J46595_10010691 3300003187 Bacteria 4247
8 JGI25153J46596_10085262 3300003215 Bacteria 777
9 rootH2_10037848 3300003320 Bacteria 2193
10 rootL2_10001569 3300003322 Bacteria 1250
11 rootH1_10011970 3300003323 Bacteria 1705
12 JGI25160J50197_1042030 3300003354 Bacteria 1044
13 JGI25160J50197_1045858 3300003354 Bacteria 963
14 JGI25161J50226_1006519 3300003374 Bacteria 2098
15 Ga0006562J51391_1178820 3300003578 Bacteria 2920
16 Ga0006562J51391_1178821 3300003578 Bacteria 4330
17 Ga0055535_1000308 3300003761 Bacteria 49802
18 Ga0055542_1000036 3300003762 Bacteria 227346
19 Ga0055526_1009987 3300003771 Bacteria 4481
20 Ga0055537_1009280 3300003773 Bacteria 2186
21 Ga0055524_1065467 3300003775 Bacteria 727
22 Ga0055536_1002851 3300003781 Bacteria 9523
23 Ga0055534_1005559 3300003784 Bacteria 3341
24 Ga0055534_1053843 3300003784 Bacteria 568
25 Ga0055528_1024484 3300003790 Bacteria 1807
26 Ga0055530_10001874 3300003791 Bacteria 14467
27 Ga0055540_1005442 3300003792 Bacteria 5349
28 Ga0055531_10003968 3300003794 Bacteria 9182
29 Ga0055543_1004599 3300004625 Bacteria 3704
30 Ga0065165_1045652 3300005262 Bacteria 1275
31 Ga0065714_10091918 3300005288 Bacteria 1893
32 Ga0070660_100324223 3300005339 Bacteria 1266
33 Ga0070689_101910992 3300005340 Bacteria 542
34 Ga0070669_100853298 3300005353 Bacteria 776
35 Ga0070675_101099157 3300005354 Bacteria 731
36 Ga0070674_100190680 3300005356 Bacteria 1577
37 Ga0070674_100790332 3300005356 Bacteria 819
38 Ga0070673_100184048 3300005364 Bacteria 1790
39 Ga0070673_101152395 3300005364 Bacteria 725
40 Ga0070659_100161128 3300005366 Bacteria 1834
41 Ga0070667_100843729 3300005367 Bacteria 852
42 Ga0070701_10536839 3300005438 Bacteria 765
43 Ga0070663_100245136 3300005455 Bacteria 1416
44 Ga0070663_100517367 3300005455 Bacteria 993
45 Ga0070678_100292961 3300005456 Bacteria 1380
46 Ga0070662_100959447 3300005457 Bacteria 731
47 Ga0068867_100067568 3300005459 Bacteria 2666
48 Ga0068853_101450916 3300005539 Bacteria 664
49 Ga0070665_100424641 3300005548 Bacteria 1338
50 Ga0068857_100406180 3300005577 Bacteria 1268
51 Ga0068854_100059220 3300005578 Bacteria 2767
52 Ga0068861_100006467 3300005719 Bacteria 7982
53 Ga0068851_10009910 3300005834 Bacteria 4437
54 Ga0068860_100085561 3300005843 Bacteria 3000
55 Ga0075365_10022476 3300006038 Bacteria 3952
56 Ga0075365_10048323 3300006038 Bacteria 2800
57 Ga0075368_10166626 3300006042 Bacteria 925
58 Ga0075364_10071564 3300006051 Bacteria 2284
59 Ga0075364_10127232 3300006051 Bacteria 1708
60 Ga0075367_10022539 3300006178 Bacteria 3534
61 Ga0075369_10016329 3300006186 Bacteria 2994
62 Ga0075369_10212790 3300006186 Bacteria 894
63 Ga0075366_10882560 3300006195 Bacteria 557
64 Ga0097621_100258913 3300006237 Bacteria 1526
65 Ga0097621_100711427 3300006237 Bacteria 925
66 Ga0075370_10034026 3300006353 Bacteria 2856
67 Ga0075370_10100614 3300006353 Bacteria 1672
68 Ga0068865_100120694 3300006881 Bacteria 1949
69 Ga0105244_10443822 3300009036 Bacteria 597
70 Ga0105240_10253865 3300009093 Bacteria 2032
71 Ga0105245_11752603 3300009098 Bacteria 674
72 Ga0105242_10007567 3300009176 Bacteria 8361
73 Ga0105242_10028327 3300009176 Bacteria 4458
74 Ga0105248_10024355 3300009177 Bacteria 6731
75 Ga0105248_11432374 3300009177 Bacteria 782
76 Ga0105248_11522470 3300009177 Bacteria 757
77 Ga0105248_12930577 3300009177 Bacteria 544
78 Ga0105238_10744290 3300009551 Unclassified 994
79 Ga0105249_10180733 3300009553 Bacteria 2052
80 Ga0105249_10268166 3300009553 Bacteria 1700
81 Ga0105249_12268957 3300009553 Unclassified 616
82 Ga0105239_10745559 3300010375 Bacteria 1121
83 Ga0157339_1002583 3300012505 Bacteria 1237
84 Ga0157371_10409363 3300013102 Bacteria 993
85 Ga0157370_10195845 3300013104 Bacteria 1875
86 Ga0157370_11396551 3300013104 Bacteria 630
87 Ga0157370_11651180 3300013104 Bacteria 575
88 Ga0157370_12036684 3300013104 Bacteria 515
89 Ga0157369_10903903 3300013105 Bacteria 905
90 Ga0171462_1004 3300013250 Bacteria 678877
91 Ga0157378_10082780 3300013297 Bacteria 2903
92 Ga0163162_10131397 3300013306 Bacteria 2612
93 Ga0163162_10262374 3300013306 Bacteria 1859
94 Ga0163162_11162283 3300013306 Bacteria 875
95 Ga0163162_13252625 3300013306 Bacteria 521
96 Ga0157372_10166183 3300013307 Bacteria 2552
97 Ga0157372_11544280 3300013307 Bacteria 765
98 Ga0157375_10003639 3300013308 Bacteria 13369
99 Ga0157375_10828433 3300013308 Bacteria 1073
100 Ga0157375_11876481 3300013308 Bacteria 711
101 Ga0157375_12926825 3300013308 Bacteria 570
102 Ga0157380_10106071 3300014326 Bacteria 2350
103 Ga0157380_10305592 3300014326 Bacteria 1467
104 Ga0157380_10907472 3300014326 Bacteria 908
105 Ga0157379_10341615 3300014968 Bacteria 1369
106 Ga0157379_11470103 3300014968 Bacteria 662
107 Ga0157376_10962774 3300014969 Bacteria 874
108 Ga0157376_11477862 3300014969 Unclassified 712
109 Ga0157376_12528797 3300014969 Bacteria 553
110 Ga0163161_10075464 3300017792 Bacteria 2474
111 Ga0163161_10087316 3300017792 Bacteria 2304
112 Ga0163161_12087786 3300017792 Bacteria 504
113 Ga0197907_10013745 3300020069 Bacteria 655
114 Ga0209436_108055 3300025208 Bacteria 2137
115 Ga0209672_100522 3300025228 Bacteria 21031
116 Ga0209147_102197 3300025229 Bacteria 5272
117 Ga0209258_100091 3300025242 Bacteria 227454
118 Ga0207425_1018358 3300025245 Bacteria 1518
119 Ga0209148_1000033 3300025254 Bacteria 555508
120 Ga0209129_1004022 3300025258 Bacteria 6023
121 Ga0209565_1000141 3300025263 Bacteria 99867
122 Ga0209565_1000690 3300025263 Bacteria 20988
123 Ga0209673_1001271 3300025273 Bacteria 25880
124 Ga0209130_1001442 3300025284 Bacteria 15742
125 Ga0209675_1003753 3300025291 Bacteria 7036
126 Ga0209675_1065869 3300025291 Bacteria 702
127 Ga0209676_1000088 3300025292 Bacteria 263010
128 Ga0209025_1007873 3300025294 Bacteria 7815
129 Ga0209025_1086346 3300025294 Bacteria 1043
130 Ga0209564_1000103 3300025295 Bacteria 221166
131 Ga0209758_1008910 3300025297 Bacteria 6366
132 Ga0209050_1000110 3300025298 Bacteria 216664
133 Ga0209050_1052190 3300025298 Bacteria 1025
134 Ga0209256_1000065 3300025299 Bacteria 248104
135 Ga0207426_1000124 3300025302 Bacteria 218145
136 Ga0209051_1000069 3300025303 Bacteria 219208
137 Ga0209051_1001134 3300025303 Bacteria 24388
138 Ga0209257_1000093 3300025304 Bacteria 263088
139 Ga0207656_10165631 3300025321 Bacteria 1054
140 Ga0207682_10139485 3300025893 Bacteria 1087
141 Ga0207642_11116383 3300025899 Bacteria 510
142 Ga0207695_10097169 3300025913 Bacteria 2946
143 Ga0207657_10336906 3300025919 Bacteria 1191
144 Ga0207681_10170036 3300025923 Bacteria 1651
145 Ga0207659_11425490 3300025926 Bacteria 593
146 Ga0207709_10937019 3300025935 Bacteria 705
147 Ga0207669_10075416 3300025937 Bacteria 2137
148 Ga0207704_10015913 3300025938 Bacteria 3849
149 Ga0207691_10597297 3300025940 Bacteria 934
150 Ga0207711_11141465 3300025941 Bacteria 720
151 Ga0207679_11991133 3300025945 Bacteria 529
152 Ga0207639_10208532 3300026041 Bacteria 1681
153 Ga0207678_10632386 3300026067 Bacteria 940
154 Ga0207678_11887034 3300026067 Bacteria 521
155 Ga0207708_10530315 3300026075 Bacteria 990
156 Ga0207641_11224415 3300026088 Bacteria 751
157 Ga0207648_10072317 3300026089 Bacteria 3006
158 Ga0207674_10920462 3300026116 Bacteria 843
159 Ga0207675_100039668 3300026118 Bacteria 4394
160 Ga0207683_10088825 3300026121 Bacteria 2750
161 Ga0209813_10268209 3300027866 Bacteria 654
162 Ga0268264_10192726 3300028381 Bacteria 1859
163 Ga0307509_10849439 3300031507 Bacteria 577
164 Ga0307408_100000128 3300031548 Bacteria 84297
165 Ga0307408_100373677 3300031548 Bacteria 1216
166 Ga0307408_101344456 3300031548 Bacteria 671
167 Ga0307408_101510057 3300031548 Bacteria 635
168 Ga0307514_10037045 3300031649 Bacteria 3872
169 Ga0307405_10279187 3300031731 Bacteria 1256
170 Ga0307410_10292540 3300031852 Bacteria 1282
171 Ga0307406_10000933 3300031901 Bacteria 16331
172 Ga0307406_10373984 3300031901 Bacteria 1121
173 Ga0307406_10470317 3300031901 Bacteria 1013
174 Ga0307407_10189833 3300031903 Bacteria 1368
175 Ga0307407_10637535 3300031903 Bacteria 797
176 Ga0307412_10058045 3300031911 Bacteria 2587
177 Ga0307412_10679198 3300031911 Bacteria 881
178 Ga0307409_100429998 3300031995 Bacteria 1269
179 Ga0307411_10090382 3300032005 Bacteria 2135
180 Ga0395898_0405535 3300037466 Bacteria 1300
181 Ga0395901_0028515 3300038443 Bacteria 5741
182 Ga0439466_0166627 3300041411 Bacteria 673
183 Ga0439465_0012462 3300041413 Bacteria 2658
184 Ga0439465_0022624 3300041413 Bacteria 1975
185 Ga0451837_0559343 3300041494 Bacteria 601
186 Ga0451837_1432647 3300041494 Bacteria 519
187 Ga0451839_1153469 3300041496 Bacteria 500
188 Ga0451841_0491543 3300041498 Bacteria 607
189 Ga0439431_0231266 3300041997 Bacteria 545
190 Ga0439442_004768 3300042002 Bacteria 2696
191 Ga0450920_032561 3300042122 Bacteria 1029
192 Ga0450922_038404 3300042124 Bacteria 537
193 Ga0450923_006828 3300042125 Bacteria 1907
194 Ga0450902_103349 3300042137 Bacteria 508
195 Ga0450906_005663 3300042145 Bacteria 2554
196 Ga0450910_001850 3300042147 Bacteria 2732
197 Ga0439434_0005980 3300042435 Bacteria 3550
198 Ga0450918_005411 3300042531 Bacteria 2299
199 Ga0451577_1791622 3300042876 Bacteria 539
200 Ga0466965_0031478 3300044683 Bacteria 2587
201 Ga0466965_0463950 3300044683 Bacteria 706
202 Ga0466968_0179017 3300044735 Bacteria 985
203 Ga0466970_0112234 3300044765 Bacteria 1489
204 Ga0466960_0008091 3300044901 Bacteria 4296
205 Ga0466960_0919089 3300044901 Bacteria 534
206 Ga0451576_2676448 3300045051 Bacteria 508
207 Ga0495620_0112109 3300046515 Bacteria 1080
208 Ga0495621_0189970 3300046539 Bacteria 823
209 Ga0495621_0273503 3300046539 Bacteria 695
210 Ga0495671_0569600 3300046692 Bacteria 539
211 Ga0496100_0227658 3300048903 Bacteria 1370
212 Ga0496101_0016261 3300048904 Bacteria 5021
213 Ga0496103_0005097 3300048906 Bacteria 7914
214 Ga0496104_0195718 3300048907 Bacteria 1933
215 Ga0496105_0015456 3300048908 Bacteria 6083
216 Ga0496107_0016202 3300048910 Bacteria 5231
217 Ga0496109_0019876 3300048912 Bacteria 5928
218 Ga0496110_1119422 3300048913 Bacteria 696
219 Ga0496111_0217496 3300048914 Bacteria 1419
220 Ga0496112_0056880 3300048915 Bacteria 3850
221 Ga0496113_0034756 3300048916 Bacteria 3680
222 Ga0496114_0138891 3300048917 Bacteria 2102
223 Ga0496114_0199406 3300048917 Bacteria 1753
224 Ga0496114_0369182 3300048917 Bacteria 1270
225 Ga0496114_0437922 3300048917 Bacteria 1158
226 Ga0496115_0764344 3300048918 Bacteria 754
227 Ga0496116_0038634 3300048919 Bacteria 3311
228 Ga0496117_0018387 3300048920 Bacteria 5789
229 Ga0496117_0162292 3300048920 Bacteria 1307
230 Ga0496118_0014397 3300048921 Bacteria 7408
231 Ga0496119_0111211 3300048922 Bacteria 1520
232 Ga0496121_0184868 3300048924 Bacteria 1500
233 Ga0496122_0079223 3300048925 Bacteria 2297
234 Ga0496122_0418093 3300048925 Bacteria 675
235 Ga0496123_0195111 3300048926 Bacteria 1043
236 Ga0496124_0071833 3300048927 Bacteria 2867
237 Ga0496124_0300153 3300048927 Bacteria 1161
238 Ga0496124_0716470 3300048927 Bacteria 632
239 Ga0496125_0031328 3300048928 Bacteria 4741
240 Ga0496125_0081502 3300048928 Bacteria 2472
241 Ga0501032_0146399 3300049569 Bacteria 1555
242 Ga0501034_0888192 3300049571 Bacteria 780
243 Ga0501038_0320524 3300049574 Bacteria 1213
244 Ga0501038_0607784 3300049574 Bacteria 827
245 Ga0501043_0868690 3300049579 Bacteria 649
246 Ga0501070_0003038 3300049586 Bacteria 14613
247 nmdc:mga00v17_357172_c1 3300050491 Bacteria 950
248 nmdc:mga00v17_8921_c1 3300050491 Bacteria 5409
249 nmdc:mga0yw44_170749_c1 3300050492 Bacteria 1428
250 nmdc:mga0yw44_243532_c1 3300050492 Bacteria 1196
251 nmdc:mga06z11_216060_c1 3300050494 Bacteria 1119
252 nmdc:mga04h51_110144_c1 3300050495 Bacteria 1014
253 nmdc:mga07m45_193108_c1 3300050496 Bacteria 1184
254 nmdc:mga07m45_524484_c1 3300050496 Bacteria 685
255 nmdc:mga0sz30_29836_c1 3300050516 Bacteria 2250
256 nmdc:mga0sz30_318141_c1 3300050516 Bacteria 694
257 Ga0495619_0345999 3300053085 Bacteria 1029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025940 Ga0207691_10597297 Ga0207691_105972973 77
2 iso_pu_bacteria 2643221566 2643846487 82
3 3300005288 Ga0065714_10091918 Ga0065714_100919182 83
4 3300005364 Ga0070673_101152395 Ga0070673_1011523952 83
5 3300005548 Ga0070665_100424641 Ga0070665_1004246413 83
6 3300013308 Ga0157375_12926825 Ga0157375_129268252 83
7 3300014326 Ga0157380_10907472 Ga0157380_109074722 83
8 3300017792 Ga0163161_10087316 Ga0163161_100873162 83
9 3300041494 Ga0451837_0559343 Ga0451837_0559343_238_489 83
10 3300046515 Ga0495620_0112109 Ga0495620_0112109_49_300 83
11 3300046539 Ga0495621_0273503 Ga0495621_0273503_90_341 83
12 3300046692 Ga0495671_0569600 Ga0495671_0569600_246_497 83
13 3300005340 Ga0070689_101910992 Ga0070689_1019109921 85
14 3300005354 Ga0070675_101099157 Ga0070675_1010991572 85
15 3300005356 Ga0070674_100790332 Ga0070674_1007903322 85
16 3300005367 Ga0070667_100843729 Ga0070667_1008437291 85
17 3300005457 Ga0070662_100959447 Ga0070662_1009594471 85
18 3300005459 Ga0068867_100067568 Ga0068867_1000675683 85
19 3300005843 Ga0068860_100085561 Ga0068860_1000855613 85
20 3300006038 Ga0075365_10048323 Ga0075365_100483232 85
21 3300006042 Ga0075368_10166626 Ga0075368_101666262 85
22 3300006051 Ga0075364_10127232 Ga0075364_101272322 85
23 3300006178 Ga0075367_10022539 Ga0075367_100225394 85
24 3300006186 Ga0075369_10212790 Ga0075369_102127902 85
25 3300006195 Ga0075366_10882560 Ga0075366_108825602 85
26 3300006353 Ga0075370_10034026 Ga0075370_100340265 85
27 3300009176 Ga0105242_10028327 Ga0105242_100283274 85
28 3300009177 Ga0105248_10024355 Ga0105248_100243553 85
29 3300009177 Ga0105248_11432374 Ga0105248_114323741 85
30 3300009551 Ga0105238_10744290 Ga0105238_107442902 85
31 3300009553 Ga0105249_12268957 Ga0105249_122689571 85
32 3300013297 Ga0157378_10082780 Ga0157378_100827803 85
33 3300013307 Ga0157372_11544280 Ga0157372_115442802 85
34 3300013308 Ga0157375_10003639 Ga0157375_1000363912 85
35 3300013308 Ga0157375_11876481 Ga0157375_118764811 85
36 3300014969 Ga0157376_10962774 Ga0157376_109627742 85
37 3300014969 Ga0157376_11477862 Ga0157376_114778622 85
38 3300025893 Ga0207682_10139485 Ga0207682_101394851 85
39 3300025926 Ga0207659_11425490 Ga0207659_114254902 85
40 3300026075 Ga0207708_10530315 Ga0207708_105303152 85
41 3300027866 Ga0209813_10268209 Ga0209813_102682091 85
42 3300050491 nmdc:mga00v17_357172_c1 nmdc:mga00v17_357172_c1_351_608 85
43 3300050492 nmdc:mga0yw44_243532_c1 nmdc:mga0yw44_243532_c1_540_797 85
44 3300050494 nmdc:mga06z11_216060_c1 nmdc:mga06z11_216060_c1_492_749 85
45 3300050495 nmdc:mga04h51_110144_c1 nmdc:mga04h51_110144_c1_431_688 85
46 3300050516 nmdc:mga0sz30_318141_c1 nmdc:mga0sz30_318141_c1_408_665 85
47 3300031548 Ga0307408_101344456 Ga0307408_1013444562 86
48 3300042124 Ga0450922_038404 Ga0450922_038404_70_333 87
49 iso_pu_bacteria 2773857763 2774398444 87
50 iso_pu_bacteria 2808606306 2808630254 87
51 iso_pu_bacteria 2870628048 2870631285 87
52 iso_pu_bacteria 2977264416 2977267675 87
53 iso_pu_bacteria 8045830549 8045834147 87
54 3300031901 Ga0307406_10470317 Ga0307406_104703171 88
55 iso_pu_bacteria 2808606368 2808883597 88
56 iso_pu_bacteria 2811994872 2812324278 88
57 3300041496 Ga0451839_1153469 Ga0451839_1153469_35_304 89
58 3300041498 Ga0451841_0491543 Ga0451841_0491543_217_486 89
59 3300005339 Ga0070660_100324223 Ga0070660_1003242232 91
60 3300005366 Ga0070659_100161128 Ga0070659_1001611282 91
61 3300005539 Ga0068853_101450916 Ga0068853_1014509162 91
62 3300005577 Ga0068857_100406180 Ga0068857_1004061802 91
63 3300009177 Ga0105248_12930577 Ga0105248_129305772 91
64 3300010375 Ga0105239_10745559 Ga0105239_107455592 91
65 3300013104 Ga0157370_10195845 Ga0157370_101958452 91
66 3300013104 Ga0157370_11651180 Ga0157370_116511801 91
67 3300013105 Ga0157369_10903903 Ga0157369_109039032 91
68 3300013250 Ga0171462_1004 Ga0171462_1004607 91
69 3300013306 Ga0163162_11162283 Ga0163162_111622832 91
70 3300013307 Ga0157372_10166183 Ga0157372_101661834 91
71 3300020069 Ga0197907_10013745 Ga0197907_100137452 91
72 3300025919 Ga0207657_10336906 Ga0207657_103369062 91
73 3300026041 Ga0207639_10208532 Ga0207639_102085323 91
74 3300026116 Ga0207674_10920462 Ga0207674_109204621 91
75 3300031903 Ga0307407_10637535 Ga0307407_106375352 91
76 3300031911 Ga0307412_10058045 Ga0307412_100580452 91
77 3300037466 Ga0395898_0405535 Ga0395898_0405535_265_549 91
78 3300038443 Ga0395901_0028515 Ga0395901_0028515_3537_3821 91
79 3300041413 Ga0439465_0022624 Ga0439465_0022624_335_610 91
80 3300044683 Ga0466965_0031478 Ga0466965_0031478_1147_1422 91
81 3300044683 Ga0466965_0463950 Ga0466965_0463950_414_689 91
82 3300044735 Ga0466968_0179017 Ga0466968_0179017_561_836 91
83 3300044765 Ga0466970_0112234 Ga0466970_0112234_163_438 91
84 3300044901 Ga0466960_0008091 Ga0466960_0008091_971_1246 91
85 3300044901 Ga0466960_0919089 Ga0466960_0919089_171_446 91
86 3300045051 Ga0451576_2676448 Ga0451576_2676448_132_413 91
87 3300048903 Ga0496100_0227658 Ga0496100_0227658_539_814 91
88 3300048904 Ga0496101_0016261 Ga0496101_0016261_298_573 91
89 3300048906 Ga0496103_0005097 Ga0496103_0005097_4149_4424 91
90 3300048907 Ga0496104_0195718 Ga0496104_0195718_33_308 91
91 3300048908 Ga0496105_0015456 Ga0496105_0015456_801_1076 91
92 3300048910 Ga0496107_0016202 Ga0496107_0016202_53_328 91
93 3300048912 Ga0496109_0019876 Ga0496109_0019876_1250_1525 91
94 3300048913 Ga0496110_1119422 Ga0496110_1119422_341_616 91
95 3300048914 Ga0496111_0217496 Ga0496111_0217496_402_677 91
96 3300048915 Ga0496112_0056880 Ga0496112_0056880_464_739 91
97 3300048916 Ga0496113_0034756 Ga0496113_0034756_79_354 91
98 3300048917 Ga0496114_0138891 Ga0496114_0138891_1445_1720 91
99 3300048917 Ga0496114_0199406 Ga0496114_0199406_155_430 91
100 3300048918 Ga0496115_0764344 Ga0496115_0764344_190_465 91
101 3300048922 Ga0496119_0111211 Ga0496119_0111211_1235_1510 91
102 3300048925 Ga0496122_0418093 Ga0496122_0418093_103_387 91
103 3300048927 Ga0496124_0300153 Ga0496124_0300153_402_677 91
104 3300048927 Ga0496124_0716470 Ga0496124_0716470_96_380 91
105 3300049569 Ga0501032_0146399 Ga0501032_0146399_21_305 91
106 3300049571 Ga0501034_0888192 Ga0501034_0888192_112_396 91
107 3300049574 Ga0501038_0320524 Ga0501038_0320524_324_599 91
108 3300049574 Ga0501038_0607784 Ga0501038_0607784_124_408 91
109 3300049579 Ga0501043_0868690 Ga0501043_0868690_13_297 91
110 3300049586 Ga0501070_0003038 Ga0501070_0003038_2256_2540 91
111 3300053085 Ga0495619_0345999 Ga0495619_0345999_347_622 91
112 3300005353 Ga0070669_100853298 Ga0070669_1008532982 92
113 3300005356 Ga0070674_100190680 Ga0070674_1001906803 92
114 3300005364 Ga0070673_100184048 Ga0070673_1001840482 92
115 3300005438 Ga0070701_10536839 Ga0070701_105368391 92
116 3300005455 Ga0070663_100245136 Ga0070663_1002451362 92
117 3300005455 Ga0070663_100517367 Ga0070663_1005173672 92
118 3300005456 Ga0070678_100292961 Ga0070678_1002929612 92
119 3300005719 Ga0068861_100006467 Ga0068861_10000646710 92
120 3300006237 Ga0097621_100258913 Ga0097621_1002589133 92
121 3300006881 Ga0068865_100120694 Ga0068865_1001206943 92
122 3300009098 Ga0105245_11752603 Ga0105245_117526032 92
123 3300009176 Ga0105242_10007567 Ga0105242_100075678 92
124 3300009177 Ga0105248_11522470 Ga0105248_115224702 92
125 3300009553 Ga0105249_10180733 Ga0105249_101807331 92
126 3300009553 Ga0105249_10268166 Ga0105249_102681662 92
127 3300013306 Ga0163162_10131397 Ga0163162_101313974 92
128 3300013306 Ga0163162_13252625 Ga0163162_132526252 92
129 3300013308 Ga0157375_10828433 Ga0157375_108284332 92
130 3300014326 Ga0157380_10106071 Ga0157380_101060714 92
131 3300014326 Ga0157380_10305592 Ga0157380_103055922 92
132 3300014968 Ga0157379_10341615 Ga0157379_103416153 92
133 3300014968 Ga0157379_11470103 Ga0157379_114701031 92
134 3300014969 Ga0157376_12528797 Ga0157376_125287971 92
135 3300017792 Ga0163161_10075464 Ga0163161_100754643 92
136 3300017792 Ga0163161_12087786 Ga0163161_120877862 92
137 3300025899 Ga0207642_11116383 Ga0207642_111163832 92
138 3300025923 Ga0207681_10170036 Ga0207681_101700363 92
139 3300025937 Ga0207669_10075416 Ga0207669_100754162 92
140 3300025938 Ga0207704_10015913 Ga0207704_100159135 92
141 3300025941 Ga0207711_11141465 Ga0207711_111414652 92
142 3300026067 Ga0207678_10632386 Ga0207678_106323862 92
143 3300026088 Ga0207641_11224415 Ga0207641_112244152 92
144 3300026089 Ga0207648_10072317 Ga0207648_100723173 92
145 3300026118 Ga0207675_100039668 Ga0207675_1000396686 92
146 3300026121 Ga0207683_10088825 Ga0207683_100888252 92
147 3300028381 Ga0268264_10192726 Ga0268264_101927262 92
148 3300031507 Ga0307509_10849439 Ga0307509_108494392 92
149 3300031901 Ga0307406_10000933 Ga0307406_1000093314 92
150 3300041494 Ga0451837_1432647 Ga0451837_1432647_190_468 92
151 3300042876 Ga0451577_1791622 Ga0451577_1791622_149_427 92
152 3300046539 Ga0495621_0189970 Ga0495621_0189970_297_575 92
153 3300048917 Ga0496114_0437922 Ga0496114_0437922_684_962 92
154 3300006038 Ga0075365_10022476 Ga0075365_100224762 93
155 3300006051 Ga0075364_10071564 Ga0075364_100715642 93
156 3300006186 Ga0075369_10016329 Ga0075369_100163293 93
157 3300050491 nmdc:mga00v17_8921_c1 nmdc:mga00v17_8921_c1_3321_3605 93
158 3300050492 nmdc:mga0yw44_170749_c1 nmdc:mga0yw44_170749_c1_264_548 93
159 3300050516 nmdc:mga0sz30_29836_c1 nmdc:mga0sz30_29836_c1_1649_1933 93
160 3300042137 Ga0450902_103349 Ga0450902_103349_55_360 94
161 iso_pu_bacteria 2818991446 2819601412 94
162 iso_pu_bacteria 2831265667 2831272335 94
163 iso_pu_bacteria 2838054893 2838059493 94
164 iso_pu_bacteria 2899924645 2899931047 94
165 iso_pu_bacteria 2928037797 2928040721 94
166 iso_pu_bacteria 2928044640 2928047563 94
167 iso_pu_bacteria 2928051484 2928055340 94
168 iso_pu_bacteria 2928064002 2928069441 94
169 3300006237 Ga0097621_100711427 Ga0097621_1007114272 95
170 3300006353 Ga0075370_10100614 Ga0075370_101006142 95
171 3300013306 Ga0163162_10262374 Ga0163162_102623743 95
172 3300025294 Ga0209025_1086346 Ga0209025_10863461 95
173 3300025935 Ga0207709_10937019 Ga0207709_109370192 95
174 3300031548 Ga0307408_100000128 Ga0307408_1000001286 95
175 3300031548 Ga0307408_100373677 Ga0307408_1003736772 95
176 3300031548 Ga0307408_101510057 Ga0307408_1015100571 95
177 3300031649 Ga0307514_10037045 Ga0307514_100370453 95
178 3300031731 Ga0307405_10279187 Ga0307405_102791872 95
179 3300031852 Ga0307410_10292540 Ga0307410_102925402 95
180 3300031901 Ga0307406_10373984 Ga0307406_103739842 95
181 3300031903 Ga0307407_10189833 Ga0307407_101898332 95
182 3300031911 Ga0307412_10679198 Ga0307412_106791982 95
183 3300031995 Ga0307409_100429998 Ga0307409_1004299982 95
184 3300032005 Ga0307411_10090382 Ga0307411_100903822 95
185 3300041411 Ga0439466_0166627 Ga0439466_0166627_112_405 95
186 3300041413 Ga0439465_0012462 Ga0439465_0012462_1932_2225 95
187 3300041997 Ga0439431_0231266 Ga0439431_0231266_140_433 95
188 3300042002 Ga0439442_004768 Ga0439442_004768_748_1041 95
189 3300042122 Ga0450920_032561 Ga0450920_032561_680_973 95
190 3300042125 Ga0450923_006828 Ga0450923_006828_448_741 95
191 3300042145 Ga0450906_005663 Ga0450906_005663_2164_2457 95
192 3300042147 Ga0450910_001850 Ga0450910_001850_1984_2277 95
193 3300042435 Ga0439434_0005980 Ga0439434_0005980_439_732 95
194 3300042531 Ga0450918_005411 Ga0450918_005411_566_859 95
195 3300048917 Ga0496114_0369182 Ga0496114_0369182_451_738 95
196 3300050496 nmdc:mga07m45_524484_c1 nmdc:mga07m45_524484_c1_259_555 95
197 3300001979 JGI24740J21852_10022912 JGI24740J21852_100229122 98
198 3300001989 JGI24739J22299_10015333 JGI24739J22299_100153333 98
199 3300002739 JGI25158J39367_1004232 JGI25158J39367_10042322 98
200 3300002773 JGI25152J39213_1033250 JGI25152J39213_10332502 98
201 3300002774 JGI25150J39212_1007805 JGI25150J39212_10078052 98
202 3300002987 JGI25159J45721_1001862 JGI25159J45721_100186210 98
203 3300003187 JGI25151J46595_10010691 JGI25151J46595_100106918 98
204 3300003215 JGI25153J46596_10085262 JGI25153J46596_100852622 98
205 3300003320 rootH2_10037848 rootH2_100378484 98
206 3300003322 rootL2_10001569 rootL2_100015692 98
207 3300003323 rootH1_10011970 rootH1_100119702 98
208 3300003354 JGI25160J50197_1042030 JGI25160J50197_10420301 98
209 3300003354 JGI25160J50197_1045858 JGI25160J50197_10458582 98
210 3300003374 JGI25161J50226_1006519 JGI25161J50226_10065192 98
211 3300003578 Ga0006562J51391_1178820 Ga0006562J51391_11788202 98
212 3300003578 Ga0006562J51391_1178821 Ga0006562J51391_11788216 98
213 3300003761 Ga0055535_1000308 Ga0055535_100030826 98
214 3300003762 Ga0055542_1000036 Ga0055542_100003621 98
215 3300003771 Ga0055526_1009987 Ga0055526_10099877 98
216 3300003773 Ga0055537_1009280 Ga0055537_10092803 98
217 3300003775 Ga0055524_1065467 Ga0055524_10654671 98
218 3300003781 Ga0055536_1002851 Ga0055536_10028517 98
219 3300003784 Ga0055534_1005559 Ga0055534_10055592 98
220 3300003784 Ga0055534_1053843 Ga0055534_10538431 98
221 3300003790 Ga0055528_1024484 Ga0055528_10244842 98
222 3300003791 Ga0055530_10001874 Ga0055530_1000187411 98
223 3300003792 Ga0055540_1005442 Ga0055540_10054423 98
224 3300003794 Ga0055531_10003968 Ga0055531_100039687 98
225 3300004625 Ga0055543_1004599 Ga0055543_10045994 98
226 3300005262 Ga0065165_1045652 Ga0065165_10456522 98
227 3300005578 Ga0068854_100059220 Ga0068854_1000592203 98
228 3300005834 Ga0068851_10009910 Ga0068851_100099103 98
229 3300009036 Ga0105244_10443822 Ga0105244_104438222 98
230 3300009093 Ga0105240_10253865 Ga0105240_102538652 98
231 3300012505 Ga0157339_1002583 Ga0157339_10025832 98
232 3300013102 Ga0157371_10409363 Ga0157371_104093631 98
233 3300013104 Ga0157370_11396551 Ga0157370_113965512 98
234 3300013104 Ga0157370_12036684 Ga0157370_120366841 98
235 3300025208 Ga0209436_108055 Ga0209436_1080552 98
236 3300025228 Ga0209672_100522 Ga0209672_1005228 98
237 3300025229 Ga0209147_102197 Ga0209147_1021977 98
238 3300025242 Ga0209258_100091 Ga0209258_10009121 98
239 3300025245 Ga0207425_1018358 Ga0207425_10183582 98
240 3300025254 Ga0209148_1000033 Ga0209148_1000033463 98
241 3300025258 Ga0209129_1004022 Ga0209129_10040227 98
242 3300025263 Ga0209565_1000141 Ga0209565_100014174 98
243 3300025263 Ga0209565_1000690 Ga0209565_100069010 98
244 3300025273 Ga0209673_1001271 Ga0209673_100127111 98
245 3300025284 Ga0209130_1001442 Ga0209130_10014424 98
246 3300025291 Ga0209675_1003753 Ga0209675_10037533 98
247 3300025291 Ga0209675_1065869 Ga0209675_10658691 98
248 3300025292 Ga0209676_1000088 Ga0209676_1000088173 98
249 3300025294 Ga0209025_1007873 Ga0209025_10078732 98
250 3300025295 Ga0209564_1000103 Ga0209564_1000103193 98
251 3300025297 Ga0209758_1008910 Ga0209758_10089107 98
252 3300025298 Ga0209050_1000110 Ga0209050_100011070 98
253 3300025298 Ga0209050_1052190 Ga0209050_10521902 98
254 3300025299 Ga0209256_1000065 Ga0209256_1000065163 98
255 3300025302 Ga0207426_1000124 Ga0207426_1000124136 98
256 3300025303 Ga0209051_1000069 Ga0209051_100006929 98
257 3300025303 Ga0209051_1001134 Ga0209051_100113411 98
258 3300025304 Ga0209257_1000093 Ga0209257_100009371 98
259 3300025321 Ga0207656_10165631 Ga0207656_101656312 98
260 3300025913 Ga0207695_10097169 Ga0207695_100971693 98
261 3300025945 Ga0207679_11991133 Ga0207679_119911332 98
262 3300026067 Ga0207678_11887034 Ga0207678_118870341 98
263 3300048919 Ga0496116_0038634 Ga0496116_0038634_1193_1489 98
264 3300048920 Ga0496117_0018387 Ga0496117_0018387_2382_2678 98
265 3300048920 Ga0496117_0162292 Ga0496117_0162292_138_434 98
266 3300048921 Ga0496118_0014397 Ga0496118_0014397_1629_1925 98
267 3300048924 Ga0496121_0184868 Ga0496121_0184868_17_313 98
268 3300048925 Ga0496122_0079223 Ga0496122_0079223_306_602 98
269 3300048926 Ga0496123_0195111 Ga0496123_0195111_503_799 98
270 3300048927 Ga0496124_0071833 Ga0496124_0071833_662_958 98
271 3300048928 Ga0496125_0031328 Ga0496125_0031328_3170_3466 98
272 3300048928 Ga0496125_0081502 Ga0496125_0081502_2055_2351 98
273 3300050496 nmdc:mga07m45_193108_c1 nmdc:mga07m45_193108_c1_119_415 98

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00708

Acylphosphatase

Acylphosphatase

18

103

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ulr-assembly1.cif.gz_A crystal structure of tt0497 from thermus thermophilus hb8 0.9355 4 95
8jfs-assembly2.cif.gz_B phosphate bound acylphosphatase from deinococcus radiodurans at 1 angstrom resolution 0.9338 4 95
3tnv-assembly1.cif.gz_A acylphosphatase with thermophilic surface and mesophilic core 0.9253 2 95
1ulr-assembly1.cif.gz_A crystal structure of tt0497 from thermus thermophilus hb8 0.925 4 95
2w4d-assembly1.cif.gz_B acylphosphatase variant g91a from pyrococcus horikoshii 0.9245 2 95
ID Description Score Start End Superfamily
af_K7LZQ3_146_256_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.944 2 95 3.30.70.100
af_A4I1P4_95_208_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9321 2 89 3.30.70.100
3tnvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9253 2 95 3.30.70.100
af_A0A1D6NY72_1_96_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9187 2 95 3.30.70.100
2hltA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9156 2 96 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A679JD27-F1-model_v4 acylphosphatase (EC 3.6.1.7) 1.005 1 98 GO:0003998
AF-A0A7C7NVE7-F1-model_v4 acylphosphatase (EC 3.6.1.7) 0.985 2 98 GO:0003998
AF-A0A381PSE8-F1-model_v4 Acylphosphatase-like domain-containing protein 0.9806 3 95 GO:0003998
AF-A0A0C9RL93-F1-model_v4 acylphosphatase (EC 3.6.1.7) 0.9805 2 98 GO:0003998
AF-A0A3M1GHN9-F1-model_v4 Acylphosphatase (EC 3.6.1.7) 0.9788 2 98 GO:0003998

Feature Viewer

pLDDT pTM Quality
97.17 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map