F378979

General Info

Members Datasets Scaffolds Average Seq Length
273 188 546 442

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10022911|Ga0099794_100229112
Length 464
Sequence MFIAAIPPTGNTIRSNTMAHRTQLEPSRKTTAAPLAAVSYQSGFGNQFQSEAVPGALPVGRNSPQRGPLGLYAEQISGTAFTAARHENRRTWTYRIWPSVVHKPYRRIDNGKLRTGPFNETEATPSQLRWSPLPIPQAPTDFIDGIVTIGGSGNAADQSGMAVHVYAANASMAERYFYNADGEMLIVPQQGRVRFVTELGILDADNGEIAIIPRGLRFRVELPDGPSRGYICENYGQPFRLPELGPLGANGLANPRDFQAPVAAYEDRQAPCTVVAKFQGNLWAAESPHSPLSVVAWHGNFVPYKYDLARFMVIGTISFDHPDPSIFTVLTAPSDIAGTANVDFVIFPPRWLVGEDTFRPPWYHRNVMCEFMGLLKGVYDAKAEGFLPGGASLHNCMSAHGPDAGTFARASTAELKPHKLDNTLAFMFESRFAMRLTRYAMESSELQHDYFEGWQGLKRHFHEK

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
183 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
184 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
185 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
186 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
188 2932422444 Comamonas sp. 4034 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0
Rhizoplane 3.66
Rhizosphere 87.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10022911 3300007265 Bacteria 2851
2 LJQas_1000082 3300000549 Bacteria 15976
3 Ga0055536_1002057 3300003781 Bacteria 11496
4 Ga0065707_10086466 3300005295 Bacteria 5446
5 Ga0070670_100011376 3300005331 Bacteria 7608
6 Ga0070670_100013535 3300005331 Bacteria 6991
7 Ga0070670_100045867 3300005331 Bacteria 3757
8 Ga0070677_10008365 3300005333 Bacteria 3479
9 Ga0068868_100001683 3300005338 Bacteria 15119
10 Ga0070661_100141550 3300005344 Bacteria 1813
11 Ga0070668_100001054 3300005347 Bacteria 19371
12 Ga0070675_100004947 3300005354 Bacteria 10166
13 Ga0070675_100125102 3300005354 Bacteria 2187
14 Ga0070671_100013781 3300005355 Bacteria 6523
15 Ga0070671_100135141 3300005355 Bacteria 2079
16 Ga0070674_100048383 3300005356 Bacteria 2918
17 Ga0070673_100002209 3300005364 Bacteria 11765
18 Ga0070673_100003664 3300005364 Bacteria 9615
19 Ga0070667_100059435 3300005367 Bacteria 3234
20 Ga0070667_100117244 3300005367 Bacteria 2313
21 Ga0070713_100136425 3300005436 Bacteria 2169
22 Ga0070713_100220897 3300005436 Bacteria 1719
23 Ga0070700_100072243 3300005441 Bacteria 2205
24 Ga0068867_100000020 3300005459 Bacteria 93210
25 Ga0068867_100003537 3300005459 Bacteria 10981
26 Ga0070672_100030547 3300005543 Bacteria 4049
27 Ga0070672_100047580 3300005543 Bacteria 3329
28 Ga0070665_100057766 3300005548 Bacteria 3890
29 Ga0068857_100028307 3300005577 Bacteria 4944
30 Ga0068857_100182201 3300005577 Bacteria 1911
31 Ga0068852_100016589 3300005616 Bacteria 5751
32 Ga0068859_100113673 3300005617 Bacteria 2771
33 Ga0068861_100017423 3300005719 Bacteria 5100
34 Ga0068863_100000082 3300005841 Bacteria 105688
35 Ga0068863_100011210 3300005841 Bacteria 8686
36 Ga0068860_100016031 3300005843 Bacteria 7308
37 Ga0068860_100158634 3300005843 Bacteria 2180
38 Ga0070717_10263062 3300006028 Bacteria 1526
39 Ga0075368_10025615 3300006042 Bacteria 2263
40 Ga0075364_10020560 3300006051 Bacteria 4152
41 Ga0075432_10005503 3300006058 Bacteria 4314
42 Ga0075362_10040705 3300006177 Bacteria 2047
43 Ga0075367_10072330 3300006178 Bacteria 2076
44 Ga0075367_10098998 3300006178 Bacteria 1781
45 Ga0075369_10018935 3300006186 Bacteria 2807
46 Ga0075366_10090428 3300006195 Bacteria 1833
47 Ga0075428_100080627 3300006844 Bacteria 3552
48 Ga0075430_100085435 3300006846 Bacteria 2642
49 Ga0075434_100243145 3300006871 Bacteria 1820
50 Ga0068865_100002798 3300006881 Bacteria 10369
51 Ga0097620_100113662 3300006931 Bacteria 2771
52 Ga0097620_100265117 3300006931 Bacteria 1810
53 Ga0075435_100129597 3300007076 Bacteria 2110
54 Ga0105240_10263383 3300009093 Bacteria 1988
55 Ga0105245_10027373 3300009098 Bacteria 5023
56 Ga0105245_10042945 3300009098 Bacteria 4033
57 Ga0105243_10001054 3300009148 Bacteria 25232
58 Ga0105243_10049219 3300009148 Bacteria 3324
59 Ga0105243_10070669 3300009148 Bacteria 2820
60 Ga0105241_10108714 3300009174 Bacteria 2217
61 Ga0105242_10030607 3300009176 Bacteria 4298
62 Ga0105248_10003366 3300009177 Bacteria 17769
63 Ga0105237_10002643 3300009545 Bacteria 22062
64 Ga0105249_10032533 3300009553 Bacteria 4719
65 Ga0157378_10003514 3300013297 Bacteria 13898
66 Ga0163162_10087839 3300013306 Bacteria 3188
67 Ga0157375_10028678 3300013308 Bacteria 5223
68 Ga0157375_10043774 3300013308 Bacteria 4344
69 Ga0157375_10162311 3300013308 Bacteria 2377
70 Ga0157377_10000032 3300014745 Bacteria 121003
71 Ga0157379_10024806 3300014968 Bacteria 5323
72 Ga0163161_10028609 3300017792 Bacteria 3958
73 Ga0207680_10022479 3300025903 Bacteria 3430
74 Ga0207645_10002437 3300025907 Bacteria 14636
75 Ga0207705_10174587 3300025909 Bacteria 1619
76 Ga0207707_10037473 3300025912 Bacteria 4238
77 Ga0207695_10113386 3300025913 Bacteria 2687
78 Ga0207663_10018888 3300025916 Bacteria 3872
79 Ga0207663_10077078 3300025916 Bacteria 2169
80 Ga0207663_10167013 3300025916 Bacteria 1559
81 Ga0207652_10115860 3300025921 Bacteria 2380
82 Ga0207681_10022024 3300025923 Bacteria 4060
83 Ga0207681_10056524 3300025923 Bacteria 2677
84 Ga0207650_10026669 3300025925 Bacteria 4124
85 Ga0207659_10041567 3300025926 Bacteria 3220
86 Ga0207687_10107687 3300025927 Bacteria 2063
87 Ga0207700_10104576 3300025928 Bacteria 2266
88 Ga0207644_10010377 3300025931 Bacteria 6140
89 Ga0207644_10019908 3300025931 Bacteria 4557
90 Ga0207706_10002562 3300025933 Bacteria 17727
91 Ga0207706_10019742 3300025933 Bacteria 6061
92 Ga0207706_10092617 3300025933 Bacteria 2657
93 Ga0207709_10000641 3300025935 Bacteria 28524
94 Ga0207704_10040564 3300025938 Bacteria 2722
95 Ga0207691_10003343 3300025940 Bacteria 15608
96 Ga0207691_10070435 3300025940 Bacteria 3157
97 Ga0207711_10010556 3300025941 Bacteria 7676
98 Ga0207689_10012940 3300025942 Bacteria 7124
99 Ga0207679_10062211 3300025945 Bacteria 2781
100 Ga0207679_10077385 3300025945 Bacteria 2531
101 Ga0207651_10005768 3300025960 Bacteria 6393
102 Ga0207651_10012610 3300025960 Bacteria 4793
103 Ga0207668_10000647 3300025972 Bacteria 21409
104 Ga0207658_10061206 3300025986 Bacteria 2812
105 Ga0207658_10077884 3300025986 Bacteria 2531
106 Ga0207677_10011830 3300026023 Bacteria 4992
107 Ga0207677_10042550 3300026023 Bacteria 3013
108 Ga0207703_10082951 3300026035 Bacteria 2677
109 Ga0207708_10090187 3300026075 Bacteria 2363
110 Ga0207641_10000139 3300026088 Bacteria 105740
111 Ga0207641_10149937 3300026088 Bacteria 2111
112 Ga0207648_10000172 3300026089 Bacteria 66986
113 Ga0207648_10000190 3300026089 Bacteria 64762
114 Ga0207648_10005305 3300026089 Bacteria 13004
115 Ga0207648_10051367 3300026089 Bacteria 3603
116 Ga0207674_10007302 3300026116 Bacteria 12875
117 Ga0207698_10024402 3300026142 Bacteria 4244
118 Ga0268265_10033977 3300028380 Bacteria 3713
119 Ga0307515_10012210 3300028794 Bacteria 16189
120 Ga0265338_10007564 3300028800 Bacteria 13434
121 Ga0307511_10000040 3300030521 Bacteria 102640
122 Ga0307513_10153875 3300031456 Bacteria 2203
123 Ga0265313_10000843 3300031595 Bacteria 30858
124 Ga0307514_10031982 3300031649 Bacteria 4215
125 Ga0307510_10056998 3300033180 Bacteria 4061
126 Ga0307510_10107694 3300033180 Bacteria 2544
127 Ga0373944_0004673 3300035089 Bacteria 3578
128 Ga0373923_0000351 3300035111 Bacteria 10430
129 Ga0373936_0002365 3300035113 Bacteria 7060
130 Ga0373953_0001059 3300035117 Bacteria 7783
131 Ga0373954_0000998 3300035118 Bacteria 11165
132 Ga0373943_0000679 3300035170 Bacteria 14825
133 Ga0373943_0009001 3300035170 Bacteria 4475
134 Ga0373946_0003500 3300035171 Bacteria 5571
135 Ga0373924_0003100 3300035410 Bacteria 5676
136 Ga0373935_0000223 3300035692 Bacteria 27646
137 Ga0373935_0019041 3300035692 Bacteria 4186
138 Ga0373935_0042948 3300035692 Bacteria 2844
139 Ga0373935_0107939 3300035692 Bacteria 1844
140 Ga0373927_0007278 3300035695 Bacteria 7504
141 Ga0373927_0011681 3300035695 Bacteria 5844
142 Ga0373927_0012259 3300035695 Bacteria 5704
143 Ga0373933_0001275 3300035724 Bacteria 14840
144 Ga0373947_0004180 3300035725 Bacteria 8476
145 Ga0373947_0123066 3300035725 Bacteria 1649
146 Ga0373937_0000006 3300036401 Bacteria 194781
147 Ga0373937_0240601 3300036401 Bacteria 1705
148 Ga0373925_0000002 3300037068 Bacteria 368879
149 Ga0373925_0008589 3300037068 Bacteria 7443
150 Ga0373925_0031097 3300037068 Bacteria 3921
151 Ga0395905_0090557 3300037471 Bacteria 2868
152 Ga0436364_0272848 3300037853 Bacteria 7401
153 Ga0436365_0443650 3300039437 Bacteria 3468
154 Ga0466961_0052466 3300044693 Bacteria 2602
155 Ga0466957_0004783 3300044842 Bacteria 7581
156 Ga0466967_0042728 3300045976 Bacteria 3919
157 Ga0495592_0000086 3300046454 Bacteria 82248
158 Ga0495629_0014981 3300046459 Bacteria 5571
159 Ga0495651_0000562 3300046462 Bacteria 28694
160 Ga0495653_0000006 3300046463 Bacteria 363285
161 Ga0495653_0028585 3300046463 Bacteria 4458
162 Ga0495580_0029788 3300046472 Bacteria 3959
163 Ga0495662_0002449 3300046476 Bacteria 9343
164 Ga0495662_0013853 3300046476 Bacteria 3924
165 Ga0495664_0000002 3300046477 Bacteria 625183
166 Ga0495664_0001371 3300046477 Bacteria 12866
167 Ga0495583_0001160 3300046506 Bacteria 28668
168 Ga0495608_0000009 3300046511 Bacteria 266614
169 Ga0495618_0000005 3300046514 Bacteria 230421
170 Ga0495618_0001061 3300046514 Bacteria 18746
171 Ga0495628_0000002 3300046516 Bacteria 589399
172 Ga0495630_0000240 3300046517 Bacteria 43911
173 Ga0495630_0012506 3300046517 Bacteria 6164
174 Ga0495632_0000773 3300046519 Bacteria 28703
175 Ga0495648_0000295 3300046524 Bacteria 55574
176 Ga0495652_0000004 3300046529 Bacteria 588877
177 Ga0495652_0037669 3300046529 Bacteria 4194
178 Ga0495665_0018551 3300046531 Bacteria 3738
179 Ga0495640_0000005 3300046533 Bacteria 318271
180 Ga0495640_0001271 3300046533 Bacteria 19772
181 Ga0495640_0011271 3300046533 Bacteria 6883
182 Ga0495640_0173468 3300046533 Bacteria 1377
183 Ga0495587_0000007 3300046536 Bacteria 290788
184 Ga0495645_0000003 3300046543 Bacteria 570133
185 Ga0495645_0045362 3300046543 Bacteria 3207
186 Ga0495633_0000437 3300046558 Bacteria 43153
187 Ga0495633_0005525 3300046558 Bacteria 7696
188 Ga0495667_0000002 3300046559 Bacteria 437535
189 Ga0495634_0000370 3300046642 Bacteria 43881
190 Ga0495634_0002766 3300046642 Bacteria 14397
191 Ga0495634_0017632 3300046642 Bacteria 5093
192 Ga0495634_0054221 3300046642 Bacteria 2684
193 Ga0495635_0000020 3300046663 Bacteria 189698
194 Ga0495635_0005240 3300046663 Bacteria 9020
195 Ga0495657_0000240 3300046675 Bacteria 49927
196 Ga0495599_0000001 3300046678 Bacteria 537563
197 Ga0495623_0000001 3300046679 Bacteria 313861
198 Ga0495646_0000013 3300046680 Bacteria 159700
199 Ga0495658_0153398 3300046683 Bacteria 1416
200 Ga0495669_0003184 3300046684 Bacteria 6758
201 Ga0495613_0014737 3300046689 Bacteria 5801
202 Ga0495613_0069661 3300046689 Bacteria 2564
203 Ga0495624_0009601 3300046690 Bacteria 6699
204 Ga0495624_0025950 3300046690 Bacteria 3843
205 Ga0495671_0000111 3300046692 Bacteria 72744
206 Ga0495671_0031834 3300046692 Bacteria 2695
207 Ga0495649_0017184 3300046694 Bacteria 4085
208 Ga0495600_0000041 3300046809 Bacteria 75747
209 Ga0495581_0003295 3300047315 Bacteria 9276
210 Ga0495604_0000005 3300047317 Bacteria 424516
211 Ga0495674_0000003 3300047319 Bacteria 562126
212 Ga0495674_0011123 3300047319 Bacteria 8496
213 Ga0495674_0049397 3300047319 Bacteria 3718
214 Ga0495674_0155815 3300047319 Bacteria 1913
215 Ga0495672_0074934 3300047320 Bacteria 1904
216 Ga0495680_0000002 3300047322 Bacteria 197533
217 Ga0495680_0062485 3300047322 Bacteria 2863
218 Ga0495687_000212 3300047443 Bacteria 83406
219 Ga0495687_004623 3300047443 Bacteria 9195
220 Ga0495687_010520 3300047443 Bacteria 5067
221 Ga0495675_0000726 3300047444 Bacteria 20567
222 Ga0495673_0000013 3300047469 Bacteria 612902
223 Ga0495684_0000020 3300047471 Bacteria 148507
224 Ga0495684_0009181 3300047471 Bacteria 7637
225 Ga0495684_0061196 3300047471 Bacteria 2864
226 Ga0495593_0003445 3300047673 Bacteria 9477
227 Ga0495593_0007110 3300047673 Bacteria 6562
228 Ga0495602_0000027 3300048088 Bacteria 145010
229 Ga0495602_0015159 3300048088 Bacteria 7789
230 Ga0496102_0268379 3300048905 Bacteria 1609
231 Ga0496104_0143342 3300048907 Bacteria 2295
232 Ga0496109_0061148 3300048912 Bacteria 3443
233 Ga0496109_0074096 3300048912 Bacteria 3129
234 Ga0496109_0079459 3300048912 Bacteria 3022
235 Ga0496109_0206879 3300048912 Bacteria 1845
236 Ga0496110_0137221 3300048913 Bacteria 2211
237 Ga0496110_0174816 3300048913 Bacteria 1949
238 Ga0496111_0011629 3300048914 Bacteria 5937
239 Ga0496112_0015506 3300048915 Bacteria 7116
240 Ga0496116_0019132 3300048919 Bacteria 5252
241 Ga0496125_0056871 3300048928 Bacteria 3173
242 Ga0501043_0000072 3300049579 Bacteria 89021
243 Ga0501046_0000112 3300049580 Bacteria 86313
244 Ga0501047_0000138 3300049581 Bacteria 89028
245 Ga0501048_0001221 3300049582 Bacteria 19469
246 Ga0501070_0006950 3300049586 Bacteria 9627
247 Ga0501072_0002508 3300049588 Bacteria 13749
248 Ga0501075_0187857 3300049591 Bacteria 1576
249 Ga0501044_0308467 3300049823 Bacteria 1510
250 nmdc:mga0k408_39237_c1 3300050493 Bacteria 2720
251 nmdc:mga06z11_17897_c1 3300050494 Bacteria 3227
252 nmdc:mga0n895_15990_c1 3300050512 Bacteria 6870
253 nmdc:mga08x19_3340_c1 3300050514 Bacteria 9601
254 nmdc:mga0sz30_14823_c1 3300050516 Bacteria 3075
255 Ga0495601_0000010 3300053077 Bacteria 266222
256 Ga0495601_0005803 3300053077 Bacteria 7198
257 Ga0495601_0022016 3300053077 Bacteria 3910
258 Ga0495601_0023151 3300053077 Bacteria 3816
259 Ga0495612_0000002 3300053078 Bacteria 310466
260 Ga0495612_0005017 3300053078 Bacteria 5482
261 Ga0495612_0024469 3300053078 Bacteria 2424
262 Ga0495595_0000110 3300053084 Bacteria 37533
263 Ga0495595_0028547 3300053084 Bacteria 2492
264 Ga0495619_0000002 3300053085 Bacteria 530226
265 Ga0495619_0001258 3300053085 Bacteria 16610
266 Ga0495619_0016661 3300053085 Bacteria 4650
267 Ga0500643_003533 3300053087 Bacteria 7466
268 Ga0500583_0000900 3300053092 Bacteria 8544
269 Ga0500652_000086 3300053131 Bacteria 38984
270 Ga0500636_0024563 3300053177 Bacteria 3565
271 Ga0590071_000508 3300059421 Bacteria 11379
272 2904480391 2904479285 Bacteria 5073931
273 2932424348 2932422444 Bacteria 4678430
274 Ga0099794_10022911
275 LJQas_1000082
276 Ga0055536_1002057
277 Ga0065707_10086466
278 Ga0070670_100011376
279 Ga0070670_100013535
280 Ga0070670_100045867
281 Ga0070677_10008365
282 Ga0068868_100001683
283 Ga0070661_100141550
284 Ga0070668_100001054
285 Ga0070675_100004947
286 Ga0070675_100125102
287 Ga0070671_100013781
288 Ga0070671_100135141
289 Ga0070674_100048383
290 Ga0070673_100002209
291 Ga0070673_100003664
292 Ga0070667_100059435
293 Ga0070667_100117244
294 Ga0070713_100136425
295 Ga0070713_100220897
296 Ga0070700_100072243
297 Ga0068867_100000020
298 Ga0068867_100003537
299 Ga0070672_100030547
300 Ga0070672_100047580
301 Ga0070665_100057766
302 Ga0068857_100028307
303 Ga0068857_100182201
304 Ga0068852_100016589
305 Ga0068859_100113673
306 Ga0068861_100017423
307 Ga0068863_100000082
308 Ga0068863_100011210
309 Ga0068860_100016031
310 Ga0068860_100158634
311 Ga0070717_10263062
312 Ga0075368_10025615
313 Ga0075364_10020560
314 Ga0075432_10005503
315 Ga0075362_10040705
316 Ga0075367_10072330
317 Ga0075367_10098998
318 Ga0075369_10018935
319 Ga0075366_10090428
320 Ga0075428_100080627
321 Ga0075430_100085435
322 Ga0075434_100243145
323 Ga0068865_100002798
324 Ga0097620_100113662
325 Ga0097620_100265117
326 Ga0075435_100129597
327 Ga0105240_10263383
328 Ga0105245_10027373
329 Ga0105245_10042945
330 Ga0105243_10001054
331 Ga0105243_10049219
332 Ga0105243_10070669
333 Ga0105241_10108714
334 Ga0105242_10030607
335 Ga0105248_10003366
336 Ga0105237_10002643
337 Ga0105249_10032533
338 Ga0157378_10003514
339 Ga0163162_10087839
340 Ga0157375_10028678
341 Ga0157375_10043774
342 Ga0157375_10162311
343 Ga0157377_10000032
344 Ga0157379_10024806
345 Ga0163161_10028609
346 Ga0207680_10022479
347 Ga0207645_10002437
348 Ga0207705_10174587
349 Ga0207707_10037473
350 Ga0207695_10113386
351 Ga0207663_10018888
352 Ga0207663_10077078
353 Ga0207663_10167013
354 Ga0207652_10115860
355 Ga0207681_10022024
356 Ga0207681_10056524
357 Ga0207650_10026669
358 Ga0207659_10041567
359 Ga0207687_10107687
360 Ga0207700_10104576
361 Ga0207644_10010377
362 Ga0207644_10019908
363 Ga0207706_10002562
364 Ga0207706_10019742
365 Ga0207706_10092617
366 Ga0207709_10000641
367 Ga0207704_10040564
368 Ga0207691_10003343
369 Ga0207691_10070435
370 Ga0207711_10010556
371 Ga0207689_10012940
372 Ga0207679_10062211
373 Ga0207679_10077385
374 Ga0207651_10005768
375 Ga0207651_10012610
376 Ga0207668_10000647
377 Ga0207658_10061206
378 Ga0207658_10077884
379 Ga0207677_10011830
380 Ga0207677_10042550
381 Ga0207703_10082951
382 Ga0207708_10090187
383 Ga0207641_10000139
384 Ga0207641_10149937
385 Ga0207648_10000172
386 Ga0207648_10000190
387 Ga0207648_10005305
388 Ga0207648_10051367
389 Ga0207674_10007302
390 Ga0207698_10024402
391 Ga0268265_10033977
392 Ga0307515_10012210
393 Ga0265338_10007564
394 Ga0307511_10000040
395 Ga0307513_10153875
396 Ga0265313_10000843
397 Ga0307514_10031982
398 Ga0307510_10056998
399 Ga0307510_10107694
400 Ga0373944_0004673
401 Ga0373923_0000351
402 Ga0373936_0002365
403 Ga0373953_0001059
404 Ga0373954_0000998
405 Ga0373943_0000679
406 Ga0373943_0009001
407 Ga0373946_0003500
408 Ga0373924_0003100
409 Ga0373935_0000223
410 Ga0373935_0019041
411 Ga0373935_0042948
412 Ga0373935_0107939
413 Ga0373927_0007278
414 Ga0373927_0011681
415 Ga0373927_0012259
416 Ga0373933_0001275
417 Ga0373947_0004180
418 Ga0373947_0123066
419 Ga0373937_0000006
420 Ga0373937_0240601
421 Ga0373925_0000002
422 Ga0373925_0008589
423 Ga0373925_0031097
424 Ga0395905_0090557
425 Ga0436364_0272848
426 Ga0436365_0443650
427 Ga0466961_0052466
428 Ga0466957_0004783
429 Ga0466967_0042728
430 Ga0495592_0000086
431 Ga0495629_0014981
432 Ga0495651_0000562
433 Ga0495653_0000006
434 Ga0495653_0028585
435 Ga0495580_0029788
436 Ga0495662_0002449
437 Ga0495662_0013853
438 Ga0495664_0000002
439 Ga0495664_0001371
440 Ga0495583_0001160
441 Ga0495608_0000009
442 Ga0495618_0000005
443 Ga0495618_0001061
444 Ga0495628_0000002
445 Ga0495630_0000240
446 Ga0495630_0012506
447 Ga0495632_0000773
448 Ga0495648_0000295
449 Ga0495652_0000004
450 Ga0495652_0037669
451 Ga0495665_0018551
452 Ga0495640_0000005
453 Ga0495640_0001271
454 Ga0495640_0011271
455 Ga0495640_0173468
456 Ga0495587_0000007
457 Ga0495645_0000003
458 Ga0495645_0045362
459 Ga0495633_0000437
460 Ga0495633_0005525
461 Ga0495667_0000002
462 Ga0495634_0000370
463 Ga0495634_0002766
464 Ga0495634_0017632
465 Ga0495634_0054221
466 Ga0495635_0000020
467 Ga0495635_0005240
468 Ga0495657_0000240
469 Ga0495599_0000001
470 Ga0495623_0000001
471 Ga0495646_0000013
472 Ga0495658_0153398
473 Ga0495669_0003184
474 Ga0495613_0014737
475 Ga0495613_0069661
476 Ga0495624_0009601
477 Ga0495624_0025950
478 Ga0495671_0000111
479 Ga0495671_0031834
480 Ga0495649_0017184
481 Ga0495600_0000041
482 Ga0495581_0003295
483 Ga0495604_0000005
484 Ga0495674_0000003
485 Ga0495674_0011123
486 Ga0495674_0049397
487 Ga0495674_0155815
488 Ga0495672_0074934
489 Ga0495680_0000002
490 Ga0495680_0062485
491 Ga0495687_000212
492 Ga0495687_004623
493 Ga0495687_010520
494 Ga0495675_0000726
495 Ga0495673_0000013
496 Ga0495684_0000020
497 Ga0495684_0009181
498 Ga0495684_0061196
499 Ga0495593_0003445
500 Ga0495593_0007110
501 Ga0495602_0000027
502 Ga0495602_0015159
503 Ga0496102_0268379
504 Ga0496104_0143342
505 Ga0496109_0061148
506 Ga0496109_0074096
507 Ga0496109_0079459
508 Ga0496109_0206879
509 Ga0496110_0137221
510 Ga0496110_0174816
511 Ga0496111_0011629
512 Ga0496112_0015506
513 Ga0496116_0019132
514 Ga0496125_0056871
515 Ga0501043_0000072
516 Ga0501046_0000112
517 Ga0501047_0000138
518 Ga0501048_0001221
519 Ga0501070_0006950
520 Ga0501072_0002508
521 Ga0501075_0187857
522 Ga0501044_0308467
523 nmdc:mga0k408_39237_c1
524 nmdc:mga06z11_17897_c1
525 nmdc:mga0n895_15990_c1
526 nmdc:mga08x19_3340_c1
527 nmdc:mga0sz30_14823_c1
528 Ga0495601_0000010
529 Ga0495601_0005803
530 Ga0495601_0022016
531 Ga0495601_0023151
532 Ga0495612_0000002
533 Ga0495612_0005017
534 Ga0495612_0024469
535 Ga0495595_0000110
536 Ga0495595_0028547
537 Ga0495619_0000002
538 Ga0495619_0001258
539 Ga0495619_0016661
540 Ga0500643_003533
541 Ga0500583_0000900
542 Ga0500652_000086
543 Ga0500636_0024563
544 Ga0590071_000508
545 2904480391
546 2932424348

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04209

HgmA_C

Homogentisate 1,2-dioxygenase C-terminal

309

461

0.99

PF20510

HgmA_N

Homogentisate 1,2-dioxygenase N-terminal

39

308

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aq6-assembly2.cif.gz_K substrate bound homogentisate 1,2-dioxygenase 0.9498 10 435
4aq2-assembly2.cif.gz_H resting state of homogentisate 1,2-dioxygenase 0.9486 10 435
4aq2-assembly2.cif.gz_G resting state of homogentisate 1,2-dioxygenase 0.9483 10 435
4aq2-assembly2.cif.gz_L resting state of homogentisate 1,2-dioxygenase 0.9467 11 435
4aq6-assembly2.cif.gz_K substrate bound homogentisate 1,2-dioxygenase 0.9389 10 435
ID Description Score Start End Superfamily
af_Q9ZRA2_1_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9631 9 268 2.60.120.10
af_Q9ZRA2_1_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.915 9 268 2.60.120.10
af_A0A1D6NXP1_1_243_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9124 29 268 2.60.120.10
af_A0A1D6NXP1_1_243_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8985 29 268 2.60.120.10
af_G3V6C2_268_404_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8982 270 405 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7K3HLB9-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9949 127 209 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A5S3YVJ4-F1-model_v4 Homogentisate 1,2-dioxygenase (EC 1.13.11.5) 0.9794 103 268 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A528NWM7-F1-model_v4 deleted 0.9782 125 277
AF-A0A659UHZ7-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9778 141 285 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-T1CU30-F1-model_v4 Homogentisate 1,2-dioxygenase (EC 1.13.-.-) 0.9765 11 254 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872

Map