F378955
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 273 | 166 | 272 | 451 |
Family's Representative Sequence
| Representative Sequence | 3300006358|Ga0068871_100100352|Ga0068871_1001003523 |
| Length | 483 |
| Sequence | VHSLFSAFKYPFGHKTQHMKKTLIIAISFLFVTHGFSQNEDSVMIKKISDEILTNGKAYDNLHYLTKQIGGRLSGSPQMVKAEKWGVELMKASGADKAWLQECMVPHWVRGGKDKAQATYNSAVKGARNLLLHDKELDVLALGNSQGTKNKALTAKVVLVNSFDELEKKKDSLKGMIVFYNYKFNSTYVQTFRSYGEASQYRGAGPSRAAKYGAAAVIVRSMSHSADNNPHTGATRYDTTYAKIPALAVGLRDADWLSDQIQQNKIISLTIKTNAHFLPDTIGHNVIGELTGSEFPDEIITIGGHLDSWDPAEGAHDDGAGVVHTIEILRAFKALGIKPKHTIRFVLFMNEENGLRGGAKYAEEAKAKNEKHIFALESDAGGFTPRSFSFGGSPEQLKKLQSWVSLLYPYGVYEITNGGGGADIGPLNRTFKTPVAELGPDSQRYFDYHHARNDVFENVNKRELELGAVNMAALIYLIDKYGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 106 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 107 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 108 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 109 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 110 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 113 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 114 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 115 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 117 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 118 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 119 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 120 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 125 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 126 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 138 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 139 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 140 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 141 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 142 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 143 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 144 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 145 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 146 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 147 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 148 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 149 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 150 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 152 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 161 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 162 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 163 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 164 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 165 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 166 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.56 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 94.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10003826 | 3300002459 | Bacteria | 3037 |
| 2 | rootH1_10052076 | 3300003316 | Bacteria | 2793 |
| 3 | rootL2_10001282 | 3300003322 | Bacteria | 10645 |
| 4 | rootL2_10285495 | 3300003322 | Bacteria | 4116 |
| 5 | Ga0065704_10105663 | 3300005289 | Bacteria | 2104 |
| 6 | Ga0065712_10109776 | 3300005290 | Bacteria | 1837 |
| 7 | Ga0065715_10116463 | 3300005293 | Bacteria | 2380 |
| 8 | Ga0070658_10000176 | 3300005327 | Bacteria | 56043 |
| 9 | Ga0070676_10000034 | 3300005328 | Bacteria | 41415 |
| 10 | Ga0070676_10005918 | 3300005328 | Bacteria | 6528 |
| 11 | Ga0070683_100002536 | 3300005329 | Bacteria | 14576 |
| 12 | Ga0070690_100033819 | 3300005330 | Unclassified | 3202 |
| 13 | Ga0070670_100015951 | 3300005331 | Bacteria | 6446 |
| 14 | Ga0070670_100024086 | 3300005331 | Bacteria | 5236 |
| 15 | Ga0070670_100051725 | 3300005331 | Bacteria | 3527 |
| 16 | Ga0068869_100021715 | 3300005334 | Bacteria | 4418 |
| 17 | Ga0068869_100026132 | 3300005334 | Bacteria | 4061 |
| 18 | Ga0070666_10000431 | 3300005335 | Bacteria | 25787 |
| 19 | Ga0068868_100008188 | 3300005338 | Bacteria | 7478 |
| 20 | Ga0070689_100028266 | 3300005340 | Bacteria | 4237 |
| 21 | Ga0070687_100006118 | 3300005343 | Bacteria | 4915 |
| 22 | Ga0070668_100000087 | 3300005347 | Bacteria | 57426 |
| 23 | Ga0070668_100004850 | 3300005347 | Bacteria | 9964 |
| 24 | Ga0070668_100056628 | 3300005347 | Bacteria | 3028 |
| 25 | Ga0070669_100023291 | 3300005353 | Bacteria | 4434 |
| 26 | Ga0070675_100128555 | 3300005354 | Bacteria | 2157 |
| 27 | Ga0070674_100009316 | 3300005356 | Bacteria | 5878 |
| 28 | Ga0070674_100054106 | 3300005356 | Unclassified | 2774 |
| 29 | Ga0070674_100065255 | 3300005356 | Bacteria | 2555 |
| 30 | Ga0070674_100155944 | 3300005356 | Bacteria | 1728 |
| 31 | Ga0070673_100000074 | 3300005364 | Bacteria | 42660 |
| 32 | Ga0070673_100006246 | 3300005364 | Bacteria | 7725 |
| 33 | Ga0070673_100052433 | 3300005364 | Bacteria | 3200 |
| 34 | Ga0070673_100052559 | 3300005364 | Bacteria | 3197 |
| 35 | Ga0070673_100138324 | 3300005364 | Bacteria | 2052 |
| 36 | Ga0070688_100010924 | 3300005365 | Bacteria | 5028 |
| 37 | Ga0070667_100000031 | 3300005367 | Bacteria | 177447 |
| 38 | Ga0070667_100025990 | 3300005367 | Bacteria | 4870 |
| 39 | Ga0070701_10057465 | 3300005438 | Bacteria | 2039 |
| 40 | Ga0070678_100002885 | 3300005456 | Bacteria | 9515 |
| 41 | Ga0068867_100007209 | 3300005459 | Bacteria | 7860 |
| 42 | Ga0068867_100113720 | 3300005459 | Bacteria | 2083 |
| 43 | Ga0068867_100157724 | 3300005459 | Bacteria | 1788 |
| 44 | Ga0068867_100187738 | 3300005459 | Unclassified | 1647 |
| 45 | Ga0070685_10028792 | 3300005466 | Bacteria | 3081 |
| 46 | Ga0070698_100008254 | 3300005471 | Bacteria | 11260 |
| 47 | Ga0070698_100031236 | 3300005471 | Bacteria | 5521 |
| 48 | Ga0068853_100011672 | 3300005539 | Bacteria | 7140 |
| 49 | Ga0068853_100018897 | 3300005539 | Bacteria | 5709 |
| 50 | Ga0068853_100033787 | 3300005539 | Bacteria | 4338 |
| 51 | Ga0070672_100000002 | 3300005543 | Bacteria | 159809 |
| 52 | Ga0070672_100002698 | 3300005543 | Bacteria | 11352 |
| 53 | Ga0070672_100135956 | 3300005543 | Bacteria | 2024 |
| 54 | Ga0070665_100000222 | 3300005548 | Bacteria | 94961 |
| 55 | Ga0070665_100010164 | 3300005548 | Bacteria | 9518 |
| 56 | Ga0068855_100026121 | 3300005563 | Bacteria | 6986 |
| 57 | Ga0068859_100005979 | 3300005617 | Bacteria | 12358 |
| 58 | Ga0068859_100017266 | 3300005617 | Bacteria | 7246 |
| 59 | Ga0068866_10005336 | 3300005718 | Bacteria | 5299 |
| 60 | Ga0068861_100010883 | 3300005719 | Bacteria | 6320 |
| 61 | Ga0068861_100042941 | 3300005719 | Bacteria | 3390 |
| 62 | Ga0068851_10000266 | 3300005834 | Bacteria | 24602 |
| 63 | Ga0068870_10006683 | 3300005840 | Bacteria | 5100 |
| 64 | Ga0068863_100004520 | 3300005841 | Bacteria | 13723 |
| 65 | Ga0068863_100008926 | 3300005841 | Bacteria | 9789 |
| 66 | Ga0068863_100026031 | 3300005841 | Bacteria | 5582 |
| 67 | Ga0068863_100153838 | 3300005841 | Bacteria | 2201 |
| 68 | Ga0068858_100001512 | 3300005842 | Bacteria | 23886 |
| 69 | Ga0068860_100072596 | 3300005843 | Unclassified | 3271 |
| 70 | Ga0081539_10025864 | 3300005985 | Bacteria | 3762 |
| 71 | Ga0097621_100000691 | 3300006237 | Bacteria | 23650 |
| 72 | Ga0097621_100008450 | 3300006237 | Bacteria | 7417 |
| 73 | Ga0097621_100009845 | 3300006237 | Bacteria | 6959 |
| 74 | Ga0068871_100002873 | 3300006358 | Bacteria | 11809 |
| 75 | Ga0068871_100009260 | 3300006358 | Bacteria | 7124 |
| 76 | Ga0068871_100055708 | 3300006358 | Bacteria | 3211 |
| 77 | Ga0068871_100073610 | 3300006358 | Bacteria | 2817 |
| 78 | Ga0068871_100100352 | 3300006358 | Bacteria | 2424 |
| 79 | Ga0075428_100002129 | 3300006844 | Bacteria | 21365 |
| 80 | Ga0075428_100004442 | 3300006844 | Bacteria | 15481 |
| 81 | Ga0075430_100012472 | 3300006846 | Bacteria | 7233 |
| 82 | Ga0075430_100016854 | 3300006846 | Bacteria | 6223 |
| 83 | Ga0075431_100011013 | 3300006847 | Bacteria | 9103 |
| 84 | Ga0075431_100050638 | 3300006847 | Bacteria | 4282 |
| 85 | Ga0075434_100136723 | 3300006871 | Bacteria | 2470 |
| 86 | Ga0075429_100004992 | 3300006880 | Bacteria | 11424 |
| 87 | Ga0068865_100033163 | 3300006881 | Bacteria | 3455 |
| 88 | Ga0097620_100017266 | 3300006931 | Bacteria | 7246 |
| 89 | Ga0105240_10001361 | 3300009093 | Bacteria | 41976 |
| 90 | Ga0105240_10078802 | 3300009093 | Bacteria | 4056 |
| 91 | Ga0111539_10002597 | 3300009094 | Bacteria | 23925 |
| 92 | Ga0111539_10087356 | 3300009094 | Unclassified | 3663 |
| 93 | Ga0111539_10087915 | 3300009094 | Bacteria | 3651 |
| 94 | Ga0111539_10132676 | 3300009094 | Bacteria | 2917 |
| 95 | Ga0105247_10109100 | 3300009101 | Bacteria | 1779 |
| 96 | Ga0114129_10076733 | 3300009147 | Bacteria | 4651 |
| 97 | Ga0105241_10063931 | 3300009174 | Bacteria | 2840 |
| 98 | Ga0105242_10005938 | 3300009176 | Bacteria | 9420 |
| 99 | Ga0105242_10008165 | 3300009176 | Bacteria | 8050 |
| 100 | Ga0105242_10039978 | 3300009176 | Bacteria | 3778 |
| 101 | Ga0105242_10059437 | 3300009176 | Bacteria | 3136 |
| 102 | Ga0105249_10002226 | 3300009553 | Bacteria | 16804 |
| 103 | Ga0105249_10003042 | 3300009553 | Bacteria | 14469 |
| 104 | Ga0105249_10006302 | 3300009553 | Bacteria | 10308 |
| 105 | Ga0157371_10269889 | 3300013102 | Bacteria | 1228 |
| 106 | Ga0157371_10315264 | 3300013102 | Unclassified | 1134 |
| 107 | Ga0157374_10000074 | 3300013296 | Bacteria | 99947 |
| 108 | Ga0157374_10008894 | 3300013296 | Bacteria | 8601 |
| 109 | Ga0157378_10005674 | 3300013297 | Bacteria | 10920 |
| 110 | Ga0157378_10064919 | 3300013297 | Bacteria | 3266 |
| 111 | Ga0157378_10097950 | 3300013297 | Bacteria | 2673 |
| 112 | Ga0163162_10000029 | 3300013306 | Bacteria | 168510 |
| 113 | Ga0163162_10005911 | 3300013306 | Bacteria | 11839 |
| 114 | Ga0163162_10039038 | 3300013306 | Bacteria | 4741 |
| 115 | Ga0163162_10127199 | 3300013306 | Bacteria | 2655 |
| 116 | Ga0157372_10060027 | 3300013307 | Bacteria | 4255 |
| 117 | Ga0157372_10067019 | 3300013307 | Unclassified | 4033 |
| 118 | Ga0157372_10155359 | 3300013307 | Unclassified | 2642 |
| 119 | Ga0157372_10247188 | 3300013307 | Bacteria | 2070 |
| 120 | Ga0157375_10000042 | 3300013308 | Bacteria | 160008 |
| 121 | Ga0157375_10023948 | 3300013308 | Bacteria | 5642 |
| 122 | Ga0157375_10085763 | 3300013308 | Bacteria | 3199 |
| 123 | Ga0157375_10202039 | 3300013308 | Bacteria | 2143 |
| 124 | Ga0163163_10000174 | 3300014325 | Bacteria | 67568 |
| 125 | Ga0163163_10030768 | 3300014325 | Bacteria | 5176 |
| 126 | Ga0157377_10123306 | 3300014745 | Bacteria | 1573 |
| 127 | Ga0157379_10000080 | 3300014968 | Bacteria | 63139 |
| 128 | Ga0157379_10155403 | 3300014968 | Unclassified | 2063 |
| 129 | Ga0157376_10000521 | 3300014969 | Bacteria | 24829 |
| 130 | Ga0157376_10079031 | 3300014969 | Bacteria | 2819 |
| 131 | Ga0163161_10016307 | 3300017792 | Bacteria | 5186 |
| 132 | Ga0207697_10011915 | 3300025315 | Bacteria | 3662 |
| 133 | Ga0207656_10001176 | 3300025321 | Bacteria | 8616 |
| 134 | Ga0207645_10002278 | 3300025907 | Bacteria | 15224 |
| 135 | Ga0207645_10005443 | 3300025907 | Bacteria | 9224 |
| 136 | Ga0207643_10003128 | 3300025908 | Bacteria | 8906 |
| 137 | Ga0207705_10001116 | 3300025909 | Bacteria | 21828 |
| 138 | Ga0207695_10000431 | 3300025913 | Bacteria | 91965 |
| 139 | Ga0207662_10011253 | 3300025918 | Bacteria | 4954 |
| 140 | Ga0207662_10012705 | 3300025918 | Bacteria | 4693 |
| 141 | Ga0207662_10023866 | 3300025918 | Unclassified | 3516 |
| 142 | Ga0207650_10121909 | 3300025925 | Bacteria | 2031 |
| 143 | Ga0207659_10002122 | 3300025926 | Bacteria | 11750 |
| 144 | Ga0207659_10141424 | 3300025926 | Bacteria | 1868 |
| 145 | Ga0207686_10002663 | 3300025934 | Bacteria | 9686 |
| 146 | Ga0207686_10028947 | 3300025934 | Bacteria | 3262 |
| 147 | Ga0207669_10003839 | 3300025937 | Bacteria | 6548 |
| 148 | Ga0207704_10017822 | 3300025938 | Bacteria | 3693 |
| 149 | Ga0207691_10000004 | 3300025940 | Bacteria | 168729 |
| 150 | Ga0207691_10005078 | 3300025940 | Bacteria | 12705 |
| 151 | Ga0207691_10014368 | 3300025940 | Bacteria | 7548 |
| 152 | Ga0207691_10022119 | 3300025940 | Bacteria | 5999 |
| 153 | Ga0207691_10040789 | 3300025940 | Bacteria | 4289 |
| 154 | Ga0207691_10224311 | 3300025940 | Bacteria | 1629 |
| 155 | Ga0207689_10001010 | 3300025942 | Bacteria | 27038 |
| 156 | Ga0207689_10003497 | 3300025942 | Bacteria | 14356 |
| 157 | Ga0207689_10020206 | 3300025942 | Bacteria | 5609 |
| 158 | Ga0207689_10033109 | 3300025942 | Bacteria | 4294 |
| 159 | Ga0207689_10065050 | 3300025942 | Bacteria | 3000 |
| 160 | Ga0207689_10081788 | 3300025942 | Bacteria | 2655 |
| 161 | Ga0207689_10130226 | 3300025942 | Bacteria | 2070 |
| 162 | Ga0207679_10093679 | 3300025945 | Unclassified | 2330 |
| 163 | Ga0207651_10169298 | 3300025960 | Unclassified | 1721 |
| 164 | Ga0207712_10001318 | 3300025961 | Bacteria | 17023 |
| 165 | Ga0207712_10014943 | 3300025961 | Bacteria | 5001 |
| 166 | Ga0207712_10059096 | 3300025961 | Bacteria | 2712 |
| 167 | Ga0207668_10001201 | 3300025972 | Bacteria | 15384 |
| 168 | Ga0207640_10078344 | 3300025981 | Bacteria | 2249 |
| 169 | Ga0207658_10000059 | 3300025986 | Bacteria | 121530 |
| 170 | Ga0207677_10004077 | 3300026023 | Bacteria | 7808 |
| 171 | Ga0207677_10008024 | 3300026023 | Bacteria | 5875 |
| 172 | Ga0207677_10079629 | 3300026023 | Bacteria | 2344 |
| 173 | Ga0207677_10136443 | 3300026023 | Unclassified | 1871 |
| 174 | Ga0207703_10003800 | 3300026035 | Bacteria | 12542 |
| 175 | Ga0207639_10074881 | 3300026041 | Bacteria | 2660 |
| 176 | Ga0207678_10203735 | 3300026067 | Bacteria | 1692 |
| 177 | Ga0207708_10040621 | 3300026075 | Bacteria | 3546 |
| 178 | Ga0207641_10002750 | 3300026088 | Bacteria | 16046 |
| 179 | Ga0207641_10003172 | 3300026088 | Bacteria | 14709 |
| 180 | Ga0207648_10001709 | 3300026089 | Bacteria | 24030 |
| 181 | Ga0207648_10014174 | 3300026089 | Bacteria | 7371 |
| 182 | Ga0207648_10018228 | 3300026089 | Bacteria | 6359 |
| 183 | Ga0207648_10021501 | 3300026089 | Bacteria | 5799 |
| 184 | Ga0207648_10097919 | 3300026089 | Bacteria | 2567 |
| 185 | Ga0207676_10002009 | 3300026095 | Bacteria | 14820 |
| 186 | Ga0207676_10033102 | 3300026095 | Bacteria | 3903 |
| 187 | Ga0207674_10019675 | 3300026116 | Bacteria | 7311 |
| 188 | Ga0207675_100002556 | 3300026118 | Bacteria | 18017 |
| 189 | Ga0207675_100019313 | 3300026118 | Bacteria | 6359 |
| 190 | Ga0207675_100049618 | 3300026118 | Bacteria | 3916 |
| 191 | Ga0207683_10000974 | 3300026121 | Bacteria | 26229 |
| 192 | Ga0207428_10004445 | 3300027907 | Bacteria | 13324 |
| 193 | Ga0268266_10006335 | 3300028379 | Bacteria | 10848 |
| 194 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 195 | Ga0265327_10002077 | 3300031251 | Bacteria | 22378 |
| 196 | Ga0265327_10012349 | 3300031251 | Bacteria | 5773 |
| 197 | Ga0307509_10023546 | 3300031507 | Bacteria | 6909 |
| 198 | Ga0307408_100018888 | 3300031548 | Bacteria | 4635 |
| 199 | Ga0265313_10040731 | 3300031595 | Bacteria | 2293 |
| 200 | Ga0307508_10001710 | 3300031616 | Bacteria | 24355 |
| 201 | Ga0307516_10000665 | 3300031730 | Bacteria | 46476 |
| 202 | Ga0307406_10017223 | 3300031901 | Unclassified | 4207 |
| 203 | Ga0307412_10013164 | 3300031911 | Bacteria | 4842 |
| 204 | Ga0307415_100025429 | 3300032126 | Unclassified | 3715 |
| 205 | Ga0307507_10063139 | 3300033179 | Bacteria | 3432 |
| 206 | Ga0373924_0004695 | 3300035410 | Bacteria | 4794 |
| 207 | Ga0373937_0009340 | 3300036401 | Bacteria | 8516 |
| 208 | Ga0373937_0072969 | 3300036401 | Bacteria | 3166 |
| 209 | Ga0439457_000276 | 3300042014 | Bacteria | 14138 |
| 210 | Ga0451577_0000103 | 3300042876 | Bacteria | 186594 |
| 211 | Ga0466972_0000104 | 3300044658 | Bacteria | 73886 |
| 212 | Ga0466957_0007502 | 3300044842 | Bacteria | 6163 |
| 213 | Ga0495592_0056455 | 3300046454 | Bacteria | 2902 |
| 214 | Ga0495638_0075579 | 3300046460 | Bacteria | 2053 |
| 215 | Ga0495653_0015741 | 3300046463 | Bacteria | 6166 |
| 216 | Ga0495672_0020338 | 3300047320 | Bacteria | 4354 |
| 217 | Ga0495672_0084804 | 3300047320 | Bacteria | 1757 |
| 218 | Ga0501292_000303 | 3300049515 | Bacteria | 6872 |
| 219 | Ga0501297_001774 | 3300049520 | Unclassified | 2022 |
| 220 | Ga0501031_0006578 | 3300049568 | Bacteria | 7583 |
| 221 | Ga0501032_0006571 | 3300049569 | Bacteria | 8539 |
| 222 | Ga0501034_0120790 | 3300049571 | Bacteria | 2606 |
| 223 | Ga0501036_0044598 | 3300049572 | Bacteria | 3756 |
| 224 | Ga0501037_0013337 | 3300049573 | Bacteria | 6057 |
| 225 | Ga0501037_0029050 | 3300049573 | Unclassified | 4084 |
| 226 | Ga0501038_0027154 | 3300049574 | Bacteria | 5095 |
| 227 | Ga0501043_0036498 | 3300049579 | Bacteria | 3867 |
| 228 | Ga0501046_0106613 | 3300049580 | Unclassified | 2144 |
| 229 | Ga0501047_0042863 | 3300049581 | Bacteria | 4372 |
| 230 | Ga0501048_0012526 | 3300049582 | Bacteria | 6311 |
| 231 | Ga0501073_0132160 | 3300049589 | Unclassified | 1730 |
| 232 | Ga0501201_001678 | 3300049651 | Unclassified | 2061 |
| 233 | Ga0501202_000293 | 3300049652 | Bacteria | 6851 |
| 234 | Ga0501207_000913 | 3300049654 | Bacteria | 3551 |
| 235 | Ga0501222_001303 | 3300049662 | Bacteria | 3500 |
| 236 | Ga0501223_002463 | 3300049663 | Bacteria | 4108 |
| 237 | Ga0501224_000729 | 3300049664 | Bacteria | 4129 |
| 238 | Ga0501228_004439 | 3300049666 | Bacteria | 1202 |
| 239 | Ga0501243_006256 | 3300049675 | Bacteria | 1802 |
| 240 | Ga0501243_007207 | 3300049675 | Unclassified | 1697 |
| 241 | Ga0501259_000503 | 3300049688 | Bacteria | 6275 |
| 242 | Ga0501259_001492 | 3300049688 | Bacteria | 3888 |
| 243 | Ga0501221_000588 | 3300049704 | Bacteria | 5798 |
| 244 | Ga0501225_0001961 | 3300049705 | Bacteria | 6434 |
| 245 | Ga0501234_001095 | 3300049707 | Unclassified | 4284 |
| 246 | Ga0501245_002893 | 3300049708 | Bacteria | 2308 |
| 247 | Ga0501083_0018627 | 3300049744 | Bacteria | 4837 |
| 248 | Ga0501266_001338 | 3300049763 | Bacteria | 3143 |
| 249 | Ga0501035_0006054 | 3300049822 | Bacteria | 11393 |
| 250 | Ga0501035_0197530 | 3300049822 | Bacteria | 1727 |
| 251 | Ga0501044_0069414 | 3300049823 | Bacteria | 3587 |
| 252 | Ga0501044_0134030 | 3300049823 | Bacteria | 2469 |
| 253 | Ga0501045_0149785 | 3300049824 | Bacteria | 1736 |
| 254 | nmdc:mga09592_185754_c1 | 3300050508 | Bacteria | 1799 |
| 255 | nmdc:mga09592_9012_c1 | 3300050508 | Bacteria | 8112 |
| 256 | nmdc:mga0qj67_11771_c1 | 3300050509 | Bacteria | 6566 |
| 257 | nmdc:mga0qj67_42508_c1 | 3300050509 | Bacteria | 3578 |
| 258 | nmdc:mga06r32_229957_c1 | 3300050510 | Bacteria | 1842 |
| 259 | nmdc:mga06r32_66489_c1 | 3300050510 | Bacteria | 3478 |
| 260 | nmdc:mga08y16_11798_c1 | 3300050511 | Bacteria | 9180 |
| 261 | nmdc:mga08y16_134096_c1 | 3300050511 | Bacteria | 2574 |
| 262 | nmdc:mga08y16_193182_c1 | 3300050511 | Bacteria | 2111 |
| 263 | nmdc:mga08y16_212564_c1 | 3300050511 | Bacteria | 2003 |
| 264 | nmdc:mga0n895_295892_c1 | 3300050512 | Bacteria | 1641 |
| 265 | Ga0500578_0017770 | 3300053086 | Bacteria | 4570 |
| 266 | Ga0500583_0000009 | 3300053092 | Bacteria | 160749 |
| 267 | Ga0500583_0000607 | 3300053092 | Bacteria | 10683 |
| 268 | Ga0500568_0000274 | 3300053139 | Bacteria | 43327 |
| 269 | Ga0500604_0003299 | 3300053151 | Bacteria | 4344 |
| 270 | Ga0500639_061500 | 3300053163 | Bacteria | 1934 |
| 271 | Ga0500645_021114 | 3300053730 | Bacteria | 2012 |
| 272 | Ga0501082_0058791 | 3300060353 | Bacteria | 3313 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026067 | Ga0207678_10203735 | Ga0207678_102037352 | 362 |
| 2 | 3300049675 | Ga0501243_007207 | Ga0501243_007207_562_1671 | 367 |
| 3 | 3300049666 | Ga0501228_004439 | Ga0501228_004439_15_1139 | 368 |
| 4 | 3300013102 | Ga0157371_10315264 | Ga0157371_103152641 | 369 |
| 5 | 3300013102 | Ga0157371_10269889 | Ga0157371_102698891 | 371 |
| 6 | 3300003316 | rootH1_10052076 | rootH1_100520763 | 377 |
| 7 | 3300013306 | Ga0163162_10005911 | Ga0163162_1000591114 | 384 |
| 8 | 3300025925 | Ga0207650_10121909 | Ga0207650_101219092 | 385 |
| 9 | 3300025926 | Ga0207659_10141424 | Ga0207659_101414242 | 393 |
| 10 | 3300049520 | Ga0501297_001774 | Ga0501297_001774_20_1219 | 393 |
| 11 | 3300049651 | Ga0501201_001678 | Ga0501201_001678_71_1270 | 393 |
| 12 | 3300049823 | Ga0501044_0134030 | Ga0501044_0134030_1222_2406 | 394 |
| 13 | 3300026075 | Ga0207708_10040621 | Ga0207708_100406212 | 421 |
| 14 | 3300006847 | Ga0075431_100011013 | Ga0075431_1000110137 | 426 |
| 15 | 3300049571 | Ga0501034_0120790 | Ga0501034_0120790_1278_2567 | 429 |
| 16 | 3300005327 | Ga0070658_10000176 | Ga0070658_1000017650 | 430 |
| 17 | 3300005328 | Ga0070676_10000034 | Ga0070676_1000003434 | 430 |
| 18 | 3300005335 | Ga0070666_10000431 | Ga0070666_1000043110 | 430 |
| 19 | 3300005338 | Ga0068868_100008188 | Ga0068868_1000081885 | 430 |
| 20 | 3300005347 | Ga0070668_100000087 | Ga0070668_1000000878 | 430 |
| 21 | 3300005364 | Ga0070673_100000074 | Ga0070673_10000007426 | 430 |
| 22 | 3300005367 | Ga0070667_100000031 | Ga0070667_10000003167 | 430 |
| 23 | 3300005459 | Ga0068867_100007209 | Ga0068867_1000072097 | 430 |
| 24 | 3300005539 | Ga0068853_100011672 | Ga0068853_1000116726 | 430 |
| 25 | 3300005543 | Ga0070672_100000002 | Ga0070672_10000000249 | 430 |
| 26 | 3300005548 | Ga0070665_100000222 | Ga0070665_10000022267 | 430 |
| 27 | 3300005563 | Ga0068855_100026121 | Ga0068855_1000261218 | 430 |
| 28 | 3300005719 | Ga0068861_100010883 | Ga0068861_1000108837 | 430 |
| 29 | 3300005834 | Ga0068851_10000266 | Ga0068851_100002665 | 430 |
| 30 | 3300005841 | Ga0068863_100004520 | Ga0068863_10000452014 | 430 |
| 31 | 3300005842 | Ga0068858_100001512 | Ga0068858_10000151214 | 430 |
| 32 | 3300006237 | Ga0097621_100008450 | Ga0097621_1000084502 | 430 |
| 33 | 3300006358 | Ga0068871_100009260 | Ga0068871_1000092604 | 430 |
| 34 | 3300013296 | Ga0157374_10000074 | Ga0157374_1000007484 | 430 |
| 35 | 3300013297 | Ga0157378_10005674 | Ga0157378_1000567413 | 430 |
| 36 | 3300013306 | Ga0163162_10000029 | Ga0163162_1000002959 | 430 |
| 37 | 3300013307 | Ga0157372_10060027 | Ga0157372_100600273 | 430 |
| 38 | 3300013308 | Ga0157375_10000042 | Ga0157375_10000042102 | 430 |
| 39 | 3300014325 | Ga0163163_10000174 | Ga0163163_1000017467 | 430 |
| 40 | 3300014968 | Ga0157379_10000080 | Ga0157379_100000807 | 430 |
| 41 | 3300014969 | Ga0157376_10000521 | Ga0157376_100005213 | 430 |
| 42 | 3300025321 | Ga0207656_10001176 | Ga0207656_100011767 | 430 |
| 43 | 3300025907 | Ga0207645_10005443 | Ga0207645_100054437 | 430 |
| 44 | 3300025909 | Ga0207705_10001116 | Ga0207705_100011168 | 430 |
| 45 | 3300025940 | Ga0207691_10000004 | Ga0207691_1000000459 | 430 |
| 46 | 3300025972 | Ga0207668_10001201 | Ga0207668_1000120112 | 430 |
| 47 | 3300025986 | Ga0207658_10000059 | Ga0207658_1000005982 | 430 |
| 48 | 3300026023 | Ga0207677_10004077 | Ga0207677_100040776 | 430 |
| 49 | 3300026035 | Ga0207703_10003800 | Ga0207703_1000380010 | 430 |
| 50 | 3300026088 | Ga0207641_10002750 | Ga0207641_100027504 | 430 |
| 51 | 3300026089 | Ga0207648_10021501 | Ga0207648_100215012 | 430 |
| 52 | 3300026095 | Ga0207676_10002009 | Ga0207676_100020096 | 430 |
| 53 | 3300026118 | Ga0207675_100019313 | Ga0207675_1000193132 | 430 |
| 54 | 3300028379 | Ga0268266_10006335 | Ga0268266_100063359 | 430 |
| 55 | 3300005356 | Ga0070674_100054106 | Ga0070674_1000541062 | 435 |
| 56 | 3300025926 | Ga0207659_10002122 | Ga0207659_100021225 | 435 |
| 57 | 3300025937 | Ga0207669_10003839 | Ga0207669_100038394 | 435 |
| 58 | 3300009147 | Ga0114129_10076733 | Ga0114129_100767333 | 438 |
| 59 | 3300005330 | Ga0070690_100033819 | Ga0070690_1000338191 | 440 |
| 60 | 3300005331 | Ga0070670_100024086 | Ga0070670_1000240861 | 440 |
| 61 | 3300005364 | Ga0070673_100052433 | Ga0070673_1000524333 | 440 |
| 62 | 3300005438 | Ga0070701_10057465 | Ga0070701_100574652 | 440 |
| 63 | 3300005471 | Ga0070698_100008254 | Ga0070698_1000082542 | 440 |
| 64 | 3300005543 | Ga0070672_100135956 | Ga0070672_1001359562 | 440 |
| 65 | 3300009094 | Ga0111539_10002597 | Ga0111539_100025979 | 440 |
| 66 | 3300009094 | Ga0111539_10087356 | Ga0111539_100873562 | 440 |
| 67 | 3300013306 | Ga0163162_10039038 | Ga0163162_100390386 | 440 |
| 68 | 3300013308 | Ga0157375_10202039 | Ga0157375_102020392 | 440 |
| 69 | 3300014325 | Ga0163163_10030768 | Ga0163163_100307682 | 440 |
| 70 | 3300025918 | Ga0207662_10023866 | Ga0207662_100238663 | 440 |
| 71 | 3300025940 | Ga0207691_10040789 | Ga0207691_100407892 | 440 |
| 72 | 3300025945 | Ga0207679_10093679 | Ga0207679_100936792 | 440 |
| 73 | 3300025960 | Ga0207651_10169298 | Ga0207651_101692981 | 440 |
| 74 | 3300026095 | Ga0207676_10033102 | Ga0207676_100331022 | 440 |
| 75 | 3300027907 | Ga0207428_10004445 | Ga0207428_100044452 | 440 |
| 76 | 3300031548 | Ga0307408_100018888 | Ga0307408_1000188882 | 440 |
| 77 | 3300031901 | Ga0307406_10017223 | Ga0307406_100172232 | 440 |
| 78 | 3300031911 | Ga0307412_10013164 | Ga0307412_100131643 | 440 |
| 79 | 3300032126 | Ga0307415_100025429 | Ga0307415_1000254292 | 440 |
| 80 | 3300050511 | nmdc:mga08y16_11798_c1 | nmdc:mga08y16_11798_c1_735_2114 | 440 |
| 81 | 3300050511 | nmdc:mga08y16_193182_c1 | nmdc:mga08y16_193182_c1_511_1890 | 440 |
| 82 | 3300006844 | Ga0075428_100002129 | Ga0075428_1000021298 | 442 |
| 83 | 3300044658 | Ga0466972_0000104 | Ga0466972_0000104_26103_27446 | 445 |
| 84 | 3300005539 | Ga0068853_100018897 | Ga0068853_1000188975 | 446 |
| 85 | 3300053151 | Ga0500604_0003299 | Ga0500604_0003299_2381_3736 | 449 |
| 86 | 3300053730 | Ga0500645_021114 | Ga0500645_021114_232_1587 | 449 |
| 87 | iso_pu_bacteria | 2738541278 | 2738726032 | 449 |
| 88 | 3300006846 | Ga0075430_100016854 | Ga0075430_1000168542 | 451 |
| 89 | 3300026118 | Ga0207675_100002556 | Ga0207675_1000025563 | 451 |
| 90 | 3300050508 | nmdc:mga09592_185754_c1 | nmdc:mga09592_185754_c1_192_1550 | 451 |
| 91 | 3300050509 | nmdc:mga0qj67_42508_c1 | nmdc:mga0qj67_42508_c1_514_1872 | 451 |
| 92 | 3300050510 | nmdc:mga06r32_66489_c1 | nmdc:mga06r32_66489_c1_129_1487 | 451 |
| 93 | 3300003322 | rootL2_10001282 | rootL2_100012824 | 452 |
| 94 | 3300031616 | Ga0307508_10001710 | Ga0307508_1000171019 | 452 |
| 95 | 3300031730 | Ga0307516_10000665 | Ga0307516_100006658 | 452 |
| 96 | 3300053092 | Ga0500583_0000009 | Ga0500583_0000009_147111_148475 | 452 |
| 97 | 3300005328 | Ga0070676_10005918 | Ga0070676_100059184 | 453 |
| 98 | 3300005331 | Ga0070670_100015951 | Ga0070670_1000159513 | 453 |
| 99 | 3300005347 | Ga0070668_100004850 | Ga0070668_1000048504 | 453 |
| 100 | 3300005347 | Ga0070668_100056628 | Ga0070668_1000566282 | 453 |
| 101 | 3300005353 | Ga0070669_100023291 | Ga0070669_1000232912 | 453 |
| 102 | 3300005356 | Ga0070674_100009316 | Ga0070674_1000093165 | 453 |
| 103 | 3300005364 | Ga0070673_100006246 | Ga0070673_1000062462 | 453 |
| 104 | 3300005367 | Ga0070667_100025990 | Ga0070667_1000259902 | 453 |
| 105 | 3300005456 | Ga0070678_100002885 | Ga0070678_1000028857 | 453 |
| 106 | 3300005459 | Ga0068867_100113720 | Ga0068867_1001137202 | 453 |
| 107 | 3300005459 | Ga0068867_100157724 | Ga0068867_1001577241 | 453 |
| 108 | 3300005543 | Ga0070672_100002698 | Ga0070672_1000026984 | 453 |
| 109 | 3300005548 | Ga0070665_100010164 | Ga0070665_1000101643 | 453 |
| 110 | 3300005617 | Ga0068859_100017266 | Ga0068859_1000172665 | 453 |
| 111 | 3300005719 | Ga0068861_100042941 | Ga0068861_1000429412 | 453 |
| 112 | 3300005840 | Ga0068870_10006683 | Ga0068870_100066832 | 453 |
| 113 | 3300005843 | Ga0068860_100072596 | Ga0068860_1000725962 | 453 |
| 114 | 3300006237 | Ga0097621_100009845 | Ga0097621_1000098452 | 453 |
| 115 | 3300006881 | Ga0068865_100033163 | Ga0068865_1000331632 | 453 |
| 116 | 3300006931 | Ga0097620_100017266 | Ga0097620_1000172663 | 453 |
| 117 | 3300009101 | Ga0105247_10109100 | Ga0105247_101091002 | 453 |
| 118 | 3300009176 | Ga0105242_10008165 | Ga0105242_100081656 | 453 |
| 119 | 3300009176 | Ga0105242_10059437 | Ga0105242_100594372 | 453 |
| 120 | 3300009553 | Ga0105249_10006302 | Ga0105249_100063026 | 453 |
| 121 | 3300013297 | Ga0157378_10097950 | Ga0157378_100979502 | 453 |
| 122 | 3300013308 | Ga0157375_10085763 | Ga0157375_100857632 | 453 |
| 123 | 3300025315 | Ga0207697_10011915 | Ga0207697_100119152 | 453 |
| 124 | 3300025907 | Ga0207645_10002278 | Ga0207645_1000227812 | 453 |
| 125 | 3300025908 | Ga0207643_10003128 | Ga0207643_100031285 | 453 |
| 126 | 3300025934 | Ga0207686_10028947 | Ga0207686_100289472 | 453 |
| 127 | 3300025938 | Ga0207704_10017822 | Ga0207704_100178222 | 453 |
| 128 | 3300025940 | Ga0207691_10005078 | Ga0207691_100050782 | 453 |
| 129 | 3300025940 | Ga0207691_10224311 | Ga0207691_102243111 | 453 |
| 130 | 3300025942 | Ga0207689_10001010 | Ga0207689_1000101023 | 453 |
| 131 | 3300025942 | Ga0207689_10020206 | Ga0207689_100202062 | 453 |
| 132 | 3300025942 | Ga0207689_10065050 | Ga0207689_100650502 | 453 |
| 133 | 3300025961 | Ga0207712_10059096 | Ga0207712_100590962 | 453 |
| 134 | 3300025981 | Ga0207640_10078344 | Ga0207640_100783442 | 453 |
| 135 | 3300026023 | Ga0207677_10008024 | Ga0207677_100080245 | 453 |
| 136 | 3300026089 | Ga0207648_10001709 | Ga0207648_100017097 | 453 |
| 137 | 3300026089 | Ga0207648_10018228 | Ga0207648_100182287 | 453 |
| 138 | 3300026089 | Ga0207648_10097919 | Ga0207648_100979192 | 453 |
| 139 | 3300026118 | Ga0207675_100049618 | Ga0207675_1000496183 | 453 |
| 140 | 3300026121 | Ga0207683_10000974 | Ga0207683_100009746 | 453 |
| 141 | 3300042014 | Ga0439457_000276 | Ga0439457_000276_9415_10782 | 453 |
| 142 | 3300044842 | Ga0466957_0007502 | Ga0466957_0007502_362_1729 | 453 |
| 143 | 3300049515 | Ga0501292_000303 | Ga0501292_000303_2612_3991 | 453 |
| 144 | 3300049652 | Ga0501202_000293 | Ga0501202_000293_3975_5354 | 453 |
| 145 | 3300049654 | Ga0501207_000913 | Ga0501207_000913_269_1648 | 453 |
| 146 | 3300049662 | Ga0501222_001303 | Ga0501222_001303_1866_3245 | 453 |
| 147 | 3300049663 | Ga0501223_002463 | Ga0501223_002463_247_1626 | 453 |
| 148 | 3300049664 | Ga0501224_000729 | Ga0501224_000729_1616_2995 | 453 |
| 149 | 3300049675 | Ga0501243_006256 | Ga0501243_006256_290_1669 | 453 |
| 150 | 3300049688 | Ga0501259_000503 | Ga0501259_000503_1736_3115 | 453 |
| 151 | 3300049688 | Ga0501259_001492 | Ga0501259_001492_1106_2473 | 453 |
| 152 | 3300049704 | Ga0501221_000588 | Ga0501221_000588_3878_5257 | 453 |
| 153 | 3300049705 | Ga0501225_0001961 | Ga0501225_0001961_2206_3585 | 453 |
| 154 | 3300049707 | Ga0501234_001095 | Ga0501234_001095_108_1487 | 453 |
| 155 | 3300049708 | Ga0501245_002893 | Ga0501245_002893_549_1928 | 453 |
| 156 | 3300049763 | Ga0501266_001338 | Ga0501266_001338_904_2271 | 453 |
| 157 | 3300049822 | Ga0501035_0197530 | Ga0501035_0197530_48_1415 | 453 |
| 158 | 3300049823 | Ga0501044_0069414 | Ga0501044_0069414_1898_3265 | 453 |
| 159 | 3300053086 | Ga0500578_0017770 | Ga0500578_0017770_2451_3818 | 453 |
| 160 | 3300053092 | Ga0500583_0000607 | Ga0500583_0000607_7215_8582 | 453 |
| 161 | 3300053163 | Ga0500639_061500 | Ga0500639_061500_49_1416 | 453 |
| 162 | 3300005329 | Ga0070683_100002536 | Ga0070683_1000025361 | 454 |
| 163 | 3300005334 | Ga0068869_100026132 | Ga0068869_1000261323 | 454 |
| 164 | 3300005539 | Ga0068853_100033787 | Ga0068853_1000337873 | 454 |
| 165 | 3300006237 | Ga0097621_100000691 | Ga0097621_10000069125 | 454 |
| 166 | 3300006358 | Ga0068871_100002873 | Ga0068871_10000287312 | 454 |
| 167 | 3300009093 | Ga0105240_10001361 | Ga0105240_100013617 | 454 |
| 168 | 3300013296 | Ga0157374_10008894 | Ga0157374_100088943 | 454 |
| 169 | 3300013306 | Ga0163162_10127199 | Ga0163162_101271992 | 454 |
| 170 | 3300013307 | Ga0157372_10067019 | Ga0157372_100670194 | 454 |
| 171 | 3300013307 | Ga0157372_10247188 | Ga0157372_102471882 | 454 |
| 172 | 3300013308 | Ga0157375_10023948 | Ga0157375_100239484 | 454 |
| 173 | 3300014969 | Ga0157376_10079031 | Ga0157376_100790312 | 454 |
| 174 | 3300017792 | Ga0163161_10016307 | Ga0163161_100163074 | 454 |
| 175 | 3300025913 | Ga0207695_10000431 | Ga0207695_1000043175 | 454 |
| 176 | 3300025942 | Ga0207689_10003497 | Ga0207689_100034972 | 454 |
| 177 | 3300026041 | Ga0207639_10074881 | Ga0207639_100748812 | 454 |
| 178 | 3300035410 | Ga0373924_0004695 | Ga0373924_0004695_1404_2768 | 454 |
| 179 | 3300036401 | Ga0373937_0009340 | Ga0373937_0009340_6687_8051 | 454 |
| 180 | 3300046454 | Ga0495592_0056455 | Ga0495592_0056455_81_1445 | 454 |
| 181 | 3300046463 | Ga0495653_0015741 | Ga0495653_0015741_2512_3876 | 454 |
| 182 | 3300049568 | Ga0501031_0006578 | Ga0501031_0006578_4660_6027 | 454 |
| 183 | 3300049572 | Ga0501036_0044598 | Ga0501036_0044598_580_1947 | 454 |
| 184 | 3300049573 | Ga0501037_0029050 | Ga0501037_0029050_199_1566 | 454 |
| 185 | 3300049574 | Ga0501038_0027154 | Ga0501038_0027154_2172_3539 | 454 |
| 186 | 3300049579 | Ga0501043_0036498 | Ga0501043_0036498_297_1661 | 454 |
| 187 | 3300049580 | Ga0501046_0106613 | Ga0501046_0106613_251_1618 | 454 |
| 188 | 3300049581 | Ga0501047_0042863 | Ga0501047_0042863_669_2036 | 454 |
| 189 | 3300049589 | Ga0501073_0132160 | Ga0501073_0132160_347_1714 | 454 |
| 190 | 3300005334 | Ga0068869_100021715 | Ga0068869_1000217154 | 455 |
| 191 | 3300005617 | Ga0068859_100005979 | Ga0068859_1000059796 | 455 |
| 192 | 3300025942 | Ga0207689_10081788 | Ga0207689_100817881 | 455 |
| 193 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011866 | 455 |
| 194 | 3300031251 | Ga0265327_10012349 | Ga0265327_100123494 | 455 |
| 195 | 3300031595 | Ga0265313_10040731 | Ga0265313_100407313 | 455 |
| 196 | 3300049569 | Ga0501032_0006571 | Ga0501032_0006571_4434_5849 | 455 |
| 197 | 3300049573 | Ga0501037_0013337 | Ga0501037_0013337_4412_5827 | 455 |
| 198 | 3300049582 | Ga0501048_0012526 | Ga0501048_0012526_2433_3848 | 455 |
| 199 | 3300049744 | Ga0501083_0018627 | Ga0501083_0018627_746_2161 | 455 |
| 200 | 3300049822 | Ga0501035_0006054 | Ga0501035_0006054_5581_6996 | 455 |
| 201 | 3300049824 | Ga0501045_0149785 | Ga0501045_0149785_245_1660 | 455 |
| 202 | 3300060353 | Ga0501082_0058791 | Ga0501082_0058791_117_1532 | 455 |
| 203 | 3300005343 | Ga0070687_100006118 | Ga0070687_1000061184 | 456 |
| 204 | 3300005354 | Ga0070675_100128555 | Ga0070675_1001285552 | 456 |
| 205 | 3300005356 | Ga0070674_100065255 | Ga0070674_1000652552 | 456 |
| 206 | 3300009174 | Ga0105241_10063931 | Ga0105241_100639313 | 456 |
| 207 | 3300013297 | Ga0157378_10064919 | Ga0157378_100649192 | 456 |
| 208 | 3300014745 | Ga0157377_10123306 | Ga0157377_101233062 | 456 |
| 209 | 3300025918 | Ga0207662_10012705 | Ga0207662_100127055 | 456 |
| 210 | 3300025940 | Ga0207691_10022119 | Ga0207691_100221192 | 456 |
| 211 | 3300025942 | Ga0207689_10130226 | Ga0207689_101302262 | 456 |
| 212 | 3300026023 | Ga0207677_10136443 | Ga0207677_101364432 | 456 |
| 213 | 3300031251 | Ga0265327_10002077 | Ga0265327_100020777 | 456 |
| 214 | 3300031507 | Ga0307509_10023546 | Ga0307509_100235467 | 456 |
| 215 | 3300033179 | Ga0307507_10063139 | Ga0307507_100631393 | 456 |
| 216 | 3300042876 | Ga0451577_0000103 | Ga0451577_0000103_57972_59363 | 456 |
| 217 | 3300046460 | Ga0495638_0075579 | Ga0495638_0075579_218_1600 | 456 |
| 218 | 3300006358 | Ga0068871_100073610 | Ga0068871_1000736104 | 457 |
| 219 | 3300009093 | Ga0105240_10078802 | Ga0105240_100788024 | 457 |
| 220 | 3300047320 | Ga0495672_0020338 | Ga0495672_0020338_2246_3619 | 457 |
| 221 | 3300005289 | Ga0065704_10105663 | Ga0065704_101056631 | 458 |
| 222 | 3300009094 | Ga0111539_10132676 | Ga0111539_101326762 | 458 |
| 223 | 3300009553 | Ga0105249_10003042 | Ga0105249_100030425 | 458 |
| 224 | 3300025961 | Ga0207712_10001318 | Ga0207712_100013182 | 458 |
| 225 | 3300026116 | Ga0207674_10019675 | Ga0207674_100196751 | 458 |
| 226 | 3300050511 | nmdc:mga08y16_212564_c1 | nmdc:mga08y16_212564_c1_125_1507 | 458 |
| 227 | 3300005364 | Ga0070673_100052559 | Ga0070673_1000525593 | 459 |
| 228 | 3300013307 | Ga0157372_10155359 | Ga0157372_101553591 | 460 |
| 229 | 3300047320 | Ga0495672_0084804 | Ga0495672_0084804_281_1663 | 460 |
| 230 | 3300006871 | Ga0075434_100136723 | Ga0075434_1001367232 | 462 |
| 231 | 3300050512 | nmdc:mga0n895_295892_c1 | nmdc:mga0n895_295892_c1_220_1608 | 462 |
| 232 | 3300003322 | rootL2_10285495 | rootL2_102854951 | 464 |
| 233 | 3300005459 | Ga0068867_100187738 | Ga0068867_1001877381 | 464 |
| 234 | 3300005718 | Ga0068866_10005336 | Ga0068866_100053362 | 464 |
| 235 | 3300005841 | Ga0068863_100008926 | Ga0068863_1000089267 | 464 |
| 236 | 3300005985 | Ga0081539_10025864 | Ga0081539_100258642 | 464 |
| 237 | 3300009176 | Ga0105242_10039978 | Ga0105242_100399784 | 464 |
| 238 | 3300026089 | Ga0207648_10014174 | Ga0207648_100141748 | 464 |
| 239 | 3300053139 | Ga0500568_0000274 | Ga0500568_0000274_5875_7320 | 464 |
| 240 | 3300002459 | JGI24751J29686_10003826 | JGI24751J29686_100038262 | 465 |
| 241 | 3300005290 | Ga0065712_10109776 | Ga0065712_101097762 | 465 |
| 242 | 3300005293 | Ga0065715_10116463 | Ga0065715_101164633 | 465 |
| 243 | 3300005331 | Ga0070670_100051725 | Ga0070670_1000517252 | 465 |
| 244 | 3300005340 | Ga0070689_100028266 | Ga0070689_1000282661 | 465 |
| 245 | 3300005356 | Ga0070674_100155944 | Ga0070674_1001559442 | 465 |
| 246 | 3300005364 | Ga0070673_100138324 | Ga0070673_1001383241 | 465 |
| 247 | 3300005365 | Ga0070688_100010924 | Ga0070688_1000109243 | 465 |
| 248 | 3300005466 | Ga0070685_10028792 | Ga0070685_100287922 | 465 |
| 249 | 3300005471 | Ga0070698_100031236 | Ga0070698_1000312363 | 465 |
| 250 | 3300005841 | Ga0068863_100026031 | Ga0068863_1000260313 | 465 |
| 251 | 3300005841 | Ga0068863_100153838 | Ga0068863_1001538383 | 465 |
| 252 | 3300006358 | Ga0068871_100055708 | Ga0068871_1000557082 | 465 |
| 253 | 3300006358 | Ga0068871_100100352 | Ga0068871_1001003523 | 465 |
| 254 | 3300006844 | Ga0075428_100004442 | Ga0075428_1000044423 | 465 |
| 255 | 3300006846 | Ga0075430_100012472 | Ga0075430_1000124722 | 465 |
| 256 | 3300006847 | Ga0075431_100050638 | Ga0075431_1000506383 | 465 |
| 257 | 3300006880 | Ga0075429_100004992 | Ga0075429_1000049924 | 465 |
| 258 | 3300009094 | Ga0111539_10087915 | Ga0111539_100879153 | 465 |
| 259 | 3300009176 | Ga0105242_10005938 | Ga0105242_100059383 | 465 |
| 260 | 3300009553 | Ga0105249_10002226 | Ga0105249_1000222615 | 465 |
| 261 | 3300014968 | Ga0157379_10155403 | Ga0157379_101554033 | 465 |
| 262 | 3300025918 | Ga0207662_10011253 | Ga0207662_100112533 | 465 |
| 263 | 3300025934 | Ga0207686_10002663 | Ga0207686_100026638 | 465 |
| 264 | 3300025940 | Ga0207691_10014368 | Ga0207691_100143683 | 465 |
| 265 | 3300025942 | Ga0207689_10033109 | Ga0207689_100331094 | 465 |
| 266 | 3300025961 | Ga0207712_10014943 | Ga0207712_100149433 | 465 |
| 267 | 3300026023 | Ga0207677_10079629 | Ga0207677_100796293 | 465 |
| 268 | 3300026088 | Ga0207641_10003172 | Ga0207641_1000317212 | 465 |
| 269 | 3300036401 | Ga0373937_0072969 | Ga0373937_0072969_1553_2950 | 465 |
| 270 | 3300050508 | nmdc:mga09592_9012_c1 | nmdc:mga09592_9012_c1_6299_7699 | 465 |
| 271 | 3300050509 | nmdc:mga0qj67_11771_c1 | nmdc:mga0qj67_11771_c1_4769_6169 | 465 |
| 272 | 3300050510 | nmdc:mga06r32_229957_c1 | nmdc:mga06r32_229957_c1_425_1825 | 465 |
| 273 | 3300050511 | nmdc:mga08y16_134096_c1 | nmdc:mga08y16_134096_c1_436_1833 | 465 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iib-assembly1.cif.gz_A-2 | crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution | 0.9383 | 20 | 461 |
| 3iib-assembly1.cif.gz_A-2 | crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution | 0.9097 | 20 | 461 |
| 3b3t-assembly1.cif.gz_A | crystal structure of the d118n mutant of the aminopeptidase from vibrio proteolyticus | 0.8182 | 265 | 459 |
| 3b3s-assembly1.cif.gz_A | crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine | 0.8171 | 265 | 462 |
| 1tkh-assembly1.cif.gz_A | streptomyces griseus aminopeptidase complexed with d-phenylalanine | 0.8138 | 263 | 461 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54MN6_157_296_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9425 | 95 | 254 | 3.40.630.10 |
| af_Q9Y646_117_259_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9295 | 95 | 254 | 3.40.630.10 |
| 3iibA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9243 | 20 | 459 | 3.40.630.10 |
| af_Q54MN6_157_296_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.923 | 95 | 254 | 3.40.630.10 |
| af_Q9Y646_117_259_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9107 | 95 | 254 | 3.40.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U3KQ47-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.987 | 23 | 465 |
GO:0004180
GO:0005576 GO:0005764 GO:0070573 |
| AF-A0A1G6MW97-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9866 | 23 | 465 |
GO:0004180
GO:0005615 GO:0005764 GO:0006508 GO:0043171 GO:0070573 |
| AF-A0A819QDL7-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9796 | 21 | 465 |
GO:0004180
GO:0005615 GO:0005764 GO:0005783 GO:0005794 GO:0006508 GO:0043171 GO:0070573 |
| AF-A0A821KRC5-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9796 | 31 | 465 |
GO:0004180
GO:0005576 GO:0005764 GO:0005783 GO:0005794 GO:0070573 |
| AF-A0A381FFA3-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9779 | 285 | 463 |
GO:0004177
GO:0004180 GO:0005576 GO:0005764 GO:0070573 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar