F378744

General Info

Members Datasets Scaffolds Average Seq Length
272 190 544 373

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2995463766|2995470674
Length 425
Sequence LVTESFPPDINGVAHSVLRTAEHLVRRGHDPLVITPAPAGPVGAPDPCPVVRVPAIPLPGYPQVRIALPSRKLEQLIAGHRPDVVHLASPFLLGARGMAAAERLGLPTVAVYQTDIAGYARAYRAGSTLGEAAAWRRLRTVHCAADRTLAPSTPAAQDLTAHGIPRVHLWRRGVDSARFHPRHRDEALRRELAPGGEVLVGYVGRLAPEKRVDLLAQTVALPGVRVVVIGDGPSEPALRQSLPGAVFLGRRTGDELAALYASFDVFAHTGPMETFCQTIQEAMASGIPAVGPAVGGPLDLIAHQRTGFLVPPRDGAAVARAVEQLAADPELRARFGAAGRAEVESRTWQSVGDELIEHYQHVIGGTGTGLPVSRVGAVTAVTAATATATVTDAAAASVSAVPASVAPAPAVPAPASPPSAAPAAA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
5 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
7 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
8 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
9 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
10 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
11 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
13 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
14 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
15 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
16 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
17 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
18 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
19 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
20 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
21 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
22 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
23 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
24 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
25 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
26 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
27 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
28 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
29 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
30 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
31 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
32 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
33 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
34 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
35 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
36 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
37 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
38 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
39 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
40 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
41 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
42 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
43 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
44 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
45 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
46 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
47 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
48 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
49 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
50 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
51 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
52 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
53 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
54 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
55 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
56 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
57 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
58 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
59 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
60 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
61 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
62 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
63 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
64 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
65 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
66 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
67 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
68 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
69 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
70 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
71 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
72 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
73 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
76 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
77 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
81 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
82 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
88 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
91 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
94 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
95 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
98 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
99 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
100 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
120 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
121 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
122 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
123 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
124 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
125 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
128 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
129 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
130 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
131 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
132 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
133 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
134 2643221647 Streptomyces sp. Root369 Isolate Unclassified
135 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
136 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
137 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
138 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
139 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
140 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
141 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
142 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
143 2808606448 Streptomyces sp. 193411 Isolate Unclassified
144 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
145 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
146 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
147 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
148 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
149 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
150 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
151 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
152 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
153 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
154 2862574272 Streptomyces sp. AcE210 Isolate Nodule
155 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
156 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
157 2867475112 Streptomyces sp. TM32 Isolate Unclassified
158 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
159 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
160 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
161 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
162 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
163 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
164 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
165 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
166 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
167 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
168 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
169 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
170 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
171 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
172 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
173 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
174 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
175 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
176 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
177 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
178 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
179 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
180 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
181 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
182 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
183 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
184 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
185 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
186 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
187 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
188 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
189 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
190 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.1
Metatranscriptomes 0.37
Isolates 23.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 1.1
Rhizoplane 0.37
Rhizosphere 76.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10022356 3300003203 Bacteria 2521
2 rootH1_10018128 3300003316 Bacteria 14780
3 JGI25160J50197_1009040 3300003354 Bacteria 3733
4 Ga0068853_100363127 3300005539 Bacteria 1349
5 Ga0081539_10000456 3300005985 Bacteria 86722
6 Ga0075431_100087809 3300006847 Bacteria 3209
7 Ga0182007_10000166 3300015262 Bacteria 45125
8 Ga0183367_1017 3300015688 Bacteria 126691
9 Ga0207426_1002407 3300025302 Bacteria 12039
10 Ga0207426_1005871 3300025302 Bacteria 5473
11 Ga0207426_1018435 3300025302 Bacteria 2458
12 Ga0207639_10150585 3300026041 Bacteria 1948
13 Ga0207678_10000657 3300026067 Bacteria 31782
14 Ga0307517_10021801 3300028786 Bacteria 8065
15 Ga0307515_10001750 3300028794 Bacteria 48343
16 Ga0307515_10050089 3300028794 Bacteria 6263
17 Ga0307511_10001870 3300030521 Bacteria 22126
18 Ga0307512_10029765 3300030522 Bacteria 4763
19 Ga0307512_10085986 3300030522 Bacteria 2224
20 Ga0307513_10010785 3300031456 Bacteria 11419
21 Ga0307513_10030892 3300031456 Bacteria 6076
22 Ga0307508_10013020 3300031616 Bacteria 7607
23 Ga0307516_10002742 3300031730 Bacteria 23227
24 Ga0307516_10121465 3300031730 Bacteria 2402
25 Ga0307518_10000304 3300031838 Bacteria 37119
26 Ga0307518_10030370 3300031838 Bacteria 3913
27 Ga0307518_10080293 3300031838 Bacteria 2355
28 Ga0307406_10103954 3300031901 Bacteria 1941
29 Ga0307507_10037325 3300033179 Bacteria 4946
30 Ga0307507_10075259 3300033179 Bacteria 3021
31 Ga0307507_10148509 3300033179 Bacteria 1772
32 Ga0307510_10010654 3300033180 Bacteria 10926
33 Ga0307510_10038897 3300033180 Bacteria 5250
34 Ga0307510_10223024 3300033180 Bacteria 1394
35 Ga0395900_0042192 3300037418 Bacteria 4700
36 Ga0439436_0000317 3300041404 Bacteria 11815
37 Ga0439439_0000927 3300041406 Bacteria 5445
38 Ga0439449_0007454 3300042007 Bacteria 4160
39 Ga0439457_000025 3300042014 Bacteria 30691
40 Ga0439457_001044 3300042014 Bacteria 8376
41 Ga0450894_000137 3300042131 Bacteria 12853
42 Ga0450906_004740 3300042145 Bacteria 2832
43 Ga0466969_0027411 3300044656 Bacteria 2917
44 Ga0466969_0104119 3300044656 Bacteria 1333
45 Ga0466972_0001516 3300044658 Bacteria 11311
46 Ga0466972_0003178 3300044658 Bacteria 8161
47 Ga0466972_0008766 3300044658 Bacteria 5074
48 Ga0466965_0000492 3300044683 Bacteria 14023
49 Ga0466966_0002754 3300044684 Bacteria 11547
50 Ga0466966_0010223 3300044684 Bacteria 6225
51 Ga0466966_0101062 3300044684 Bacteria 1783
52 Ga0466961_0005326 3300044693 Bacteria 8094
53 Ga0466961_0067227 3300044693 Bacteria 2276
54 Ga0466963_0000319 3300044694 Bacteria 21690
55 Ga0466971_0001166 3300044719 Bacteria 10920
56 Ga0466971_0010400 3300044719 Bacteria 4065
57 Ga0466970_0000625 3300044765 Bacteria 17367
58 Ga0466970_0000983 3300044765 Bacteria 13708
59 Ga0466957_0000837 3300044842 Bacteria 15736
60 Ga0466957_0205733 3300044842 Bacteria 1294
61 Ga0466959_0005765 3300045049 Bacteria 8524
62 Ga0466959_0019238 3300045049 Bacteria 5020
63 Ga0466958_0001544 3300045836 Bacteria 11027
64 Ga0495617_007254 3300046452 Bacteria 3854
65 Ga0495592_0005784 3300046454 Bacteria 9161
66 Ga0495592_0024356 3300046454 Bacteria 4602
67 Ga0495603_0001517 3300046455 Bacteria 13551
68 Ga0495603_0001803 3300046455 Bacteria 12639
69 Ga0495629_0010356 3300046459 Bacteria 6786
70 Ga0495629_0069014 3300046459 Bacteria 2466
71 Ga0495629_0111742 3300046459 Bacteria 1905
72 Ga0495641_0034729 3300046461 Bacteria 2382
73 Ga0495651_0006449 3300046462 Bacteria 8976
74 Ga0495651_0102064 3300046462 Bacteria 2134
75 Ga0495651_0131473 3300046462 Bacteria 1826
76 Ga0495653_0003063 3300046463 Bacteria 13395
77 Ga0495580_0107884 3300046472 Bacteria 1933
78 Ga0495605_0005457 3300046474 Bacteria 7408
79 Ga0495662_0001284 3300046476 Bacteria 12412
80 Ga0495662_0001349 3300046476 Bacteria 12135
81 Ga0495662_0028863 3300046476 Bacteria 2679
82 Ga0495664_0000969 3300046477 Bacteria 14768
83 Ga0495664_0045895 3300046477 Bacteria 2592
84 Ga0495664_0089066 3300046477 Bacteria 1855
85 Ga0495585_0044691 3300046492 Bacteria 2474
86 Ga0495606_0006191 3300046507 Bacteria 11136
87 Ga0495608_0008519 3300046511 Bacteria 7183
88 Ga0495608_0043551 3300046511 Bacteria 2999
89 Ga0495610_0036395 3300046512 Bacteria 2516
90 Ga0495618_0099928 3300046514 Bacteria 1857
91 Ga0495620_0016693 3300046515 Bacteria 3677
92 Ga0495628_0022893 3300046516 Bacteria 5129
93 Ga0495628_0058882 3300046516 Bacteria 3018
94 Ga0495628_0125440 3300046516 Bacteria 1967
95 Ga0495630_0003347 3300046517 Bacteria 11165
96 Ga0495631_0070063 3300046518 Bacteria 1516
97 Ga0495652_0028015 3300046529 Bacteria 4961
98 Ga0495652_0175486 3300046529 Bacteria 1650
99 Ga0495652_0259332 3300046529 Bacteria 1284
100 Ga0495654_0067674 3300046530 Bacteria 1700
101 Ga0495640_0006066 3300046533 Bacteria 9584
102 Ga0495640_0006569 3300046533 Bacteria 9187
103 Ga0495640_0035966 3300046533 Bacteria 3502
104 Ga0495587_0010432 3300046536 Bacteria 5912
105 Ga0495645_0136375 3300046543 Bacteria 1716
106 Ga0495622_0110762 3300046557 Bacteria 1257
107 Ga0495667_0001536 3300046559 Bacteria 15273
108 Ga0495667_0050368 3300046559 Bacteria 2750
109 Ga0495668_0012598 3300046616 Bacteria 5013
110 Ga0495634_0101587 3300046642 Bacteria 1857
111 Ga0495625_0009628 3300046660 Bacteria 8060
112 Ga0495635_0000756 3300046663 Bacteria 20996
113 Ga0495635_0074866 3300046663 Bacteria 2319
114 Ga0495635_0192680 3300046663 Bacteria 1383
115 Ga0495661_0126930 3300046665 Bacteria 1403
116 Ga0495588_0002201 3300046674 Bacteria 8346
117 Ga0495588_0003708 3300046674 Bacteria 6689
118 Ga0495588_0098773 3300046674 Bacteria 1533
119 Ga0495657_0003694 3300046675 Bacteria 12398
120 Ga0495657_0003886 3300046675 Bacteria 12030
121 Ga0495657_0009792 3300046675 Bacteria 7234
122 Ga0495657_0154625 3300046675 Bacteria 1422
123 Ga0495599_0014791 3300046678 Bacteria 4831
124 Ga0495599_0147873 3300046678 Bacteria 1456
125 Ga0495623_0047956 3300046679 Bacteria 2710
126 Ga0495646_0015402 3300046680 Bacteria 4854
127 Ga0495646_0035625 3300046680 Bacteria 3086
128 Ga0495658_0036514 3300046683 Bacteria 2711
129 Ga0495613_0001802 3300046689 Bacteria 16281
130 Ga0495613_0004398 3300046689 Bacteria 10548
131 Ga0495613_0018432 3300046689 Bacteria 5204
132 Ga0495613_0046221 3300046689 Bacteria 3219
133 Ga0495624_0050358 3300046690 Bacteria 2639
134 Ga0495624_0170450 3300046690 Bacteria 1328
135 Ga0495670_0002585 3300046691 Bacteria 8945
136 Ga0495671_0032313 3300046692 Bacteria 2672
137 Ga0495649_0058959 3300046694 Bacteria 2067
138 Ga0495600_0000502 3300046809 Bacteria 20307
139 Ga0495600_0014545 3300046809 Bacteria 4959
140 Ga0495660_0035605 3300046810 Bacteria 2780
141 Ga0495581_0003122 3300047315 Bacteria 9479
142 Ga0495581_0065696 3300047315 Bacteria 2097
143 Ga0495604_0001218 3300047317 Bacteria 21129
144 Ga0495604_0001219 3300047317 Bacteria 21127
145 Ga0495604_0032874 3300047317 Bacteria 4108
146 Ga0495604_0056754 3300047317 Bacteria 3012
147 Ga0495636_0008868 3300047318 Bacteria 3960
148 Ga0495636_0020416 3300047318 Bacteria 2670
149 Ga0495672_0051753 3300047320 Bacteria 2417
150 Ga0495676_0008726 3300047321 Bacteria 9277
151 Ga0495676_0015891 3300047321 Bacteria 6689
152 Ga0495676_0051251 3300047321 Bacteria 3304
153 Ga0495687_001315 3300047443 Bacteria 23233
154 Ga0495687_002633 3300047443 Bacteria 14056
155 Ga0495687_058480 3300047443 Bacteria 1598
156 Ga0495675_0116061 3300047444 Bacteria 1669
157 Ga0495675_0117448 3300047444 Bacteria 1658
158 Ga0495675_0189300 3300047444 Bacteria 1257
159 Ga0495677_0024151 3300047445 Bacteria 2205
160 Ga0495679_037914 3300047446 Bacteria 1513
161 Ga0495681_0016626 3300047470 Bacteria 4113
162 Ga0495684_0065286 3300047471 Bacteria 2767
163 Ga0495593_0002015 3300047673 Bacteria 12114
164 Ga0495593_0007988 3300047673 Bacteria 6160
165 Ga0495593_0081433 3300047673 Bacteria 1674
166 Ga0495602_0007389 3300048088 Bacteria 11502
167 Ga0495614_0005437 3300048089 Bacteria 5743
168 Ga0495614_0005901 3300048089 Bacteria 5516
169 Ga0495614_0012549 3300048089 Bacteria 3716
170 Ga0495626_0020575 3300048091 Bacteria 3286
171 Ga0496109_0049029 3300048912 Bacteria 3843
172 Ga0501310_000067 3300049130 Bacteria 9644
173 Ga0495678_056776 3300049459 Bacteria 1486
174 Ga0501031_0119205 3300049568 Bacteria 1724
175 Ga0501032_0059368 3300049569 Bacteria 2567
176 Ga0501033_0004195 3300049570 Bacteria 11600
177 Ga0501033_0043355 3300049570 Bacteria 3351
178 Ga0501033_0109485 3300049570 Bacteria 2011
179 Ga0501034_0105068 3300049571 Bacteria 2817
180 Ga0501036_0051795 3300049572 Bacteria 3476
181 Ga0501037_0026281 3300049573 Bacteria 4302
182 Ga0501038_0009623 3300049574 Bacteria 8868
183 Ga0501038_0296981 3300049574 Bacteria 1268
184 Ga0501039_0068510 3300049575 Bacteria 2755
185 Ga0501042_0112178 3300049578 Bacteria 1963
186 Ga0501043_0263961 3300049579 Bacteria 1323
187 Ga0501046_0100283 3300049580 Bacteria 2222
188 Ga0501047_0000103 3300049581 Bacteria 104053
189 Ga0501047_0014412 3300049581 Bacteria 7517
190 Ga0501047_0094160 3300049581 Bacteria 2874
191 Ga0501047_0151818 3300049581 Bacteria 2192
192 Ga0501047_0197571 3300049581 Bacteria 1873
193 Ga0501047_0267031 3300049581 Bacteria 1558
194 Ga0501080_0112461 3300049742 Bacteria 2524
195 Ga0501035_0085987 3300049822 Bacteria 2771
196 Ga0501035_0243096 3300049822 Bacteria 1530
197 nmdc:mga06r32_39262_c1 3300050510 Bacteria 4491
198 Ga0500566_0056780 3300053094 Bacteria 2225
199 Ga0500566_0139617 3300053094 Bacteria 1287
200 Ga0500560_014762 3300053107 Bacteria 2090
201 Ga0500621_037270 3300053126 Bacteria 1954
202 Ga0500658_0066823 3300053134 Bacteria 1509
203 Ga0500573_0074603 3300053140 Bacteria 1932
204 Ga0500573_0076484 3300053140 Bacteria 1905
205 Ga0500600_0084089 3300053149 Bacteria 1713
206 Ga0500624_007020 3300053157 Bacteria 1537
207 Ga0466962_0001430 3300061719 Bacteria 11124
208 Ga0466962_0029866 3300061719 Bacteria 2609
209 2995470674 2995463766 Bacteria 8577691
210 2547406441 2547132111 Bacteria 8013147
211 2585300917 2582581312 Bacteria 7308206
212 2585303433 2582581313 Bacteria 10042643
213 2585316907 2582581314 Bacteria 11452267
214 2586064697 2585427649 Bacteria 9053857
215 2616695520 2616644814 Bacteria 11555299
216 2644267927 2643221647 Bacteria 10741251
217 2644443602 2643221678 Bacteria 9540101
218 2776371580 2775506925 Bacteria 7237746
219 2784586663 2784132148 Bacteria 8627943
220 2785345827 2784746763 Bacteria 9783172
221 2785367060 2784746768 Bacteria 10036182
222 2786668099 2786546132 Bacteria 10419719
223 2808847564 2808606359 Bacteria 9866990
224 2808918297 2808606375 Bacteria 9466072
225 2809230193 2808606448 Bacteria 8656184
226 2812360402 2811994879 Bacteria 9313447
227 2812365675 2811994880 Bacteria 4147780
228 2812375677 2811994882 Bacteria 4688362
229 2812482502 2811994917 Bacteria 7761064
230 2819728486 2818991469 Bacteria 4644110
231 2819743049 2818991472 Bacteria 10089953
232 2852637627 2852635781 Bacteria 8251373
233 2862186344 2862178590 Bacteria 8583590
234 2862289754 2862281513 Bacteria 9621493
235 2862391681 2862382967 Bacteria 10317375
236 2862583807 2862574272 Bacteria 10567477
237 2863407060 2863404153 Bacteria 9672205
238 2867346725 2867346516 Bacteria 7608576
239 2867479855 2867475112 Bacteria 6909112
240 2877683486 2877676314 Bacteria 9512378
241 2887444009 2887443736 Bacteria 4426037
242 2899364804 2899359706 Bacteria 10940472
243 2912726279 2912723979 Bacteria 8557534
244 2912758752 2912757875 Bacteria 7940295
245 2917741273 2917736166 Bacteria 9690793
246 2919472280 2919468124 Bacteria 9133025
247 2946065487 2946064051 Bacteria 8957905
248 2947231923 2947224130 Bacteria 9938529
249 2954011165 2954002825 Bacteria 9173742
250 2954674387 2954673503 Bacteria 9685905
251 2954689744 2954682443 Bacteria 9862841
252 2954699527 2954691527 Bacteria 10720516
253 2954702691 2954701450 Bacteria 10834262
254 2954718466 2954711539 Bacteria 10867210
255 2954728436 2954721474 Bacteria 10456478
256 2954733373 2954731030 Bacteria 10243860
257 2954747332 2954740390 Bacteria 10229294
258 2954752256 2954749733 Bacteria 10366972
259 2954766448 2954759201 Bacteria 9358192
260 2990059669 2990059506 Bacteria 9321252
261 2997453781 2997451912 Bacteria 8492419
262 3006327793 3006321560 Bacteria 8247479
263 3006495064 3006493962 Bacteria 8825450
264 8003858821 8003856774 Bacteria 7675274
265 8004021697 8004021418 Bacteria 4313954
266 8004028999 8004025490 Bacteria 4327753
267 8008561221 8008558824 Bacteria 10610750
268 8008580836 8008574985 Bacteria 7815457
269 8025535408 8025530807 Bacteria 8495698
270 8046355699 8046352972 Bacteria 3613806
271 8048408079 8048406513 Bacteria 8936924
272 8056835803 8056829672 Bacteria 9045328
273 JGI25406J46586_10022356
274 rootH1_10018128
275 JGI25160J50197_1009040
276 Ga0068853_100363127
277 Ga0081539_10000456
278 Ga0075431_100087809
279 Ga0182007_10000166
280 Ga0183367_1017
281 Ga0207426_1002407
282 Ga0207426_1005871
283 Ga0207426_1018435
284 Ga0207639_10150585
285 Ga0207678_10000657
286 Ga0307517_10021801
287 Ga0307515_10001750
288 Ga0307515_10050089
289 Ga0307511_10001870
290 Ga0307512_10029765
291 Ga0307512_10085986
292 Ga0307513_10010785
293 Ga0307513_10030892
294 Ga0307508_10013020
295 Ga0307516_10002742
296 Ga0307516_10121465
297 Ga0307518_10000304
298 Ga0307518_10030370
299 Ga0307518_10080293
300 Ga0307406_10103954
301 Ga0307507_10037325
302 Ga0307507_10075259
303 Ga0307507_10148509
304 Ga0307510_10010654
305 Ga0307510_10038897
306 Ga0307510_10223024
307 Ga0395900_0042192
308 Ga0439436_0000317
309 Ga0439439_0000927
310 Ga0439449_0007454
311 Ga0439457_000025
312 Ga0439457_001044
313 Ga0450894_000137
314 Ga0450906_004740
315 Ga0466969_0027411
316 Ga0466969_0104119
317 Ga0466972_0001516
318 Ga0466972_0003178
319 Ga0466972_0008766
320 Ga0466965_0000492
321 Ga0466966_0002754
322 Ga0466966_0010223
323 Ga0466966_0101062
324 Ga0466961_0005326
325 Ga0466961_0067227
326 Ga0466963_0000319
327 Ga0466971_0001166
328 Ga0466971_0010400
329 Ga0466970_0000625
330 Ga0466970_0000983
331 Ga0466957_0000837
332 Ga0466957_0205733
333 Ga0466959_0005765
334 Ga0466959_0019238
335 Ga0466958_0001544
336 Ga0495617_007254
337 Ga0495592_0005784
338 Ga0495592_0024356
339 Ga0495603_0001517
340 Ga0495603_0001803
341 Ga0495629_0010356
342 Ga0495629_0069014
343 Ga0495629_0111742
344 Ga0495641_0034729
345 Ga0495651_0006449
346 Ga0495651_0102064
347 Ga0495651_0131473
348 Ga0495653_0003063
349 Ga0495580_0107884
350 Ga0495605_0005457
351 Ga0495662_0001284
352 Ga0495662_0001349
353 Ga0495662_0028863
354 Ga0495664_0000969
355 Ga0495664_0045895
356 Ga0495664_0089066
357 Ga0495585_0044691
358 Ga0495606_0006191
359 Ga0495608_0008519
360 Ga0495608_0043551
361 Ga0495610_0036395
362 Ga0495618_0099928
363 Ga0495620_0016693
364 Ga0495628_0022893
365 Ga0495628_0058882
366 Ga0495628_0125440
367 Ga0495630_0003347
368 Ga0495631_0070063
369 Ga0495652_0028015
370 Ga0495652_0175486
371 Ga0495652_0259332
372 Ga0495654_0067674
373 Ga0495640_0006066
374 Ga0495640_0006569
375 Ga0495640_0035966
376 Ga0495587_0010432
377 Ga0495645_0136375
378 Ga0495622_0110762
379 Ga0495667_0001536
380 Ga0495667_0050368
381 Ga0495668_0012598
382 Ga0495634_0101587
383 Ga0495625_0009628
384 Ga0495635_0000756
385 Ga0495635_0074866
386 Ga0495635_0192680
387 Ga0495661_0126930
388 Ga0495588_0002201
389 Ga0495588_0003708
390 Ga0495588_0098773
391 Ga0495657_0003694
392 Ga0495657_0003886
393 Ga0495657_0009792
394 Ga0495657_0154625
395 Ga0495599_0014791
396 Ga0495599_0147873
397 Ga0495623_0047956
398 Ga0495646_0015402
399 Ga0495646_0035625
400 Ga0495658_0036514
401 Ga0495613_0001802
402 Ga0495613_0004398
403 Ga0495613_0018432
404 Ga0495613_0046221
405 Ga0495624_0050358
406 Ga0495624_0170450
407 Ga0495670_0002585
408 Ga0495671_0032313
409 Ga0495649_0058959
410 Ga0495600_0000502
411 Ga0495600_0014545
412 Ga0495660_0035605
413 Ga0495581_0003122
414 Ga0495581_0065696
415 Ga0495604_0001218
416 Ga0495604_0001219
417 Ga0495604_0032874
418 Ga0495604_0056754
419 Ga0495636_0008868
420 Ga0495636_0020416
421 Ga0495672_0051753
422 Ga0495676_0008726
423 Ga0495676_0015891
424 Ga0495676_0051251
425 Ga0495687_001315
426 Ga0495687_002633
427 Ga0495687_058480
428 Ga0495675_0116061
429 Ga0495675_0117448
430 Ga0495675_0189300
431 Ga0495677_0024151
432 Ga0495679_037914
433 Ga0495681_0016626
434 Ga0495684_0065286
435 Ga0495593_0002015
436 Ga0495593_0007988
437 Ga0495593_0081433
438 Ga0495602_0007389
439 Ga0495614_0005437
440 Ga0495614_0005901
441 Ga0495614_0012549
442 Ga0495626_0020575
443 Ga0496109_0049029
444 Ga0501310_000067
445 Ga0495678_056776
446 Ga0501031_0119205
447 Ga0501032_0059368
448 Ga0501033_0004195
449 Ga0501033_0043355
450 Ga0501033_0109485
451 Ga0501034_0105068
452 Ga0501036_0051795
453 Ga0501037_0026281
454 Ga0501038_0009623
455 Ga0501038_0296981
456 Ga0501039_0068510
457 Ga0501042_0112178
458 Ga0501043_0263961
459 Ga0501046_0100283
460 Ga0501047_0000103
461 Ga0501047_0014412
462 Ga0501047_0094160
463 Ga0501047_0151818
464 Ga0501047_0197571
465 Ga0501047_0267031
466 Ga0501080_0112461
467 Ga0501035_0085987
468 Ga0501035_0243096
469 nmdc:mga06r32_39262_c1
470 Ga0500566_0056780
471 Ga0500566_0139617
472 Ga0500560_014762
473 Ga0500621_037270
474 Ga0500658_0066823
475 Ga0500573_0074603
476 Ga0500573_0076484
477 Ga0500600_0084089
478 Ga0500624_007020
479 Ga0466962_0001430
480 Ga0466962_0029866
481 2995470674
482 2547406441
483 2585300917
484 2585303433
485 2585316907
486 2586064697
487 2616695520
488 2644267927
489 2644443602
490 2776371580
491 2784586663
492 2785345827
493 2785367060
494 2786668099
495 2808847564
496 2808918297
497 2809230193
498 2812360402
499 2812365675
500 2812375677
501 2812482502
502 2819728486
503 2819743049
504 2852637627
505 2862186344
506 2862289754
507 2862391681
508 2862583807
509 2863407060
510 2867346725
511 2867479855
512 2877683486
513 2887444009
514 2899364804
515 2912726279
516 2912758752
517 2917741273
518 2919472280
519 2946065487
520 2947231923
521 2954011165
522 2954674387
523 2954689744
524 2954699527
525 2954702691
526 2954718466
527 2954728436
528 2954733373
529 2954747332
530 2954752256
531 2954766448
532 2990059669
533 2997453781
534 3006327793
535 3006495064
536 8003858821
537 8004021697
538 8004028999
539 8008561221
540 8008580836
541 8025535408
542 8046355699
543 8048408079
544 8056835803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

10

178

0.96

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

197

328

0.93

PF00534

Glycos_transf_1

Glycosyl transferases group 1

183

342

0.91

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

210

357

0.85

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

11

173

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8858 188 337
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.8788 186 335
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8714 188 335
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.8558 164 336
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8495 188 335
ID Description Score Start End Superfamily
af_P9WMY5_198_350_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9628 179 332 3.40.50.2000
af_Q84QB1_230_385_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9593 187 334 3.40.50.2000
af_P9WMY5_198_350_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9505 179 332 3.40.50.2000
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9392 179 334 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9369 188 335 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A4Q2WSV1-F1-model_v4 deleted 0.9587 215 353
AF-A0A1G2EZV2-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9433 237 355 GO:0016758
AF-A0A6L3A883-F1-model_v4 Glycosyltransferase 0.9266 185 354 GO:0016757
AF-A0A353VF63-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9262 162 353 GO:0016757
AF-A0A661R5I5-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9258 162 355 GO:0016757

Map