F378740

General Info

Members Datasets Scaffolds Average Seq Length
272 179 203 276

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2937843397|2937847143
Length 313
Sequence LEGRVANGVSRVGSSMPSTADGTPPGRSPSAFGHPPLEGEGHTSHAYVTLVTNADYAMGATALVRSLKLTGTTADLVVMHTGGASVDELKPLEDLGAKLVEAALLPTSDAFNARHGRGNIHGQNPFTKGRKPHFHTPLDNFAKLRLWQLEEYDACVFIDADAVVLRNIDRLFLYPEFSAAPNVYESLADFHRLNSGVFVARPSQETFARMLDALDAPEAFWKRTDQTFLQSFFPEWHGLPVFFNMLQYVWFNLPELWDWASVSVVHYQYEKPWEENHPKAERLRPLIELWRAYYNGEAIPDIDALPNPTIKAG

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
3 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
4 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
5 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
6 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
7 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
8 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
9 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
10 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
11 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
12 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
13 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
14 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
15 2643221557 Ensifer sp. Root558 Isolate Unclassified
16 2643221610 Ensifer sp. Root74 Isolate Unclassified
17 2643221618 Ensifer sp. Root231 Isolate Unclassified
18 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
19 2643221655 Ensifer sp. Root1252 Isolate Unclassified
20 2643221668 Ensifer sp. Root423 Isolate Unclassified
21 2643221675 Ensifer sp. Root1298 Isolate Unclassified
22 2643221680 Ensifer sp. Root1312 Isolate Unclassified
23 2643221712 Ensifer sp. Root258 Isolate Unclassified
24 2643221726 Ensifer sp. Root954 Isolate Unclassified
25 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
26 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
27 2738541293 Rhizobium sp. GV031 Isolate Unclassified
28 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
29 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
30 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
31 2791355260 Rhizobium sp. L9 Isolate Nodule
32 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
33 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
34 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
35 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
36 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
37 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
38 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
39 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
40 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
41 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
42 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
43 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
44 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
45 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
46 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
47 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
48 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
49 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
50 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
51 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
52 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
53 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
54 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
55 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
56 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
57 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
58 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
59 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
60 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
61 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
62 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
63 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
64 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
65 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
66 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
67 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
68 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
69 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
70 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
71 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
72 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
73 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
74 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
75 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
76 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
77 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
80 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
81 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
91 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
116 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
166 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
167 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
174 8005382845 Rhizobium sp. R634 Isolate Nodule
175 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
176 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
177 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
178 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
179 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.63
Metatranscriptomes 0
Isolates 25.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.88
Nodule 7.72
Rhizoplane 1.47
Rhizosphere 35.29
Stem 0
Stem Tuber 0.37
Unclassified 24.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001615 3300002773 Bacteria 9426
2 JGI25152J39213_1002896 3300002773 Bacteria 6124
3 JGI25152J39213_1002942 3300002773 Bacteria 6065
4 JGI25152J39213_1002949 3300002773 Bacteria 6055
5 JGI25150J39212_1000456 3300002774 Bacteria 17986
6 JGI25159J45721_1003715 3300002987 Bacteria 5292
7 JGI25151J46595_10000031 3300003187 Bacteria 197865
8 JGI25151J46595_10006064 3300003187 Bacteria 6148
9 JGI25151J46595_10006795 3300003187 Bacteria 5695
10 JGI25153J46596_10003264 3300003215 Bacteria 9119
11 JGI25153J46596_10006184 3300003215 Bacteria 6124
12 JGI25153J46596_10006287 3300003215 Bacteria 6055
13 JGI25153J46596_10014604 3300003215 Bacteria 3253
14 rootL2_10292081 3300003322 Bacteria 2570
15 rootH1_10003032 3300003323 Bacteria 1907
16 rootH1_10223117 3300003323 Bacteria 1162
17 JGI25160J50197_1011643 3300003354 Bacteria 3102
18 JGI25161J50226_1000104 3300003374 Bacteria 67942
19 JGI25161J50226_1000396 3300003374 Bacteria 21728
20 Ga0055526_1003218 3300003771 Bacteria 10527
21 Ga0055526_1014051 3300003771 Bacteria 3327
22 Ga0055524_1001018 3300003775 Bacteria 17359
23 Ga0055524_1002189 3300003775 Bacteria 10270
24 Ga0055524_1003691 3300003775 Bacteria 7328
25 Ga0055524_1009980 3300003775 Bacteria 3815
26 Ga0055524_1019819 3300003775 Bacteria 2286
27 Ga0055534_1000347 3300003784 Bacteria 29712
28 Ga0055528_1000176 3300003790 Bacteria 54005
29 Ga0055528_1001761 3300003790 Bacteria 12455
30 Ga0055528_1003686 3300003790 Bacteria 7596
31 Ga0055540_1030732 3300003792 Bacteria 1242
32 Ga0055543_1000280 3300004625 Bacteria 37509
33 Ga0065165_1002557 3300005262 Bacteria 15059
34 Ga0065165_1011641 3300005262 Bacteria 3644
35 Ga0065165_1031675 3300005262 Bacteria 1668
36 Ga0070670_100000108 3300005331 Bacteria 77575
37 Ga0070669_100018808 3300005353 Bacteria 4939
38 Ga0070671_100017297 3300005355 Bacteria 5838
39 Ga0070667_100394286 3300005367 Bacteria 1259
40 Ga0070663_100004996 3300005455 Bacteria 7834
41 Ga0070663_100037471 3300005455 Bacteria 3376
42 Ga0070662_100133398 3300005457 Bacteria 1918
43 Ga0070665_100273104 3300005548 Bacteria 1692
44 Ga0068855_100647694 3300005563 Bacteria 1135
45 Ga0079104_1000015 3300006946 Bacteria 321803
46 Ga0105251_10006623 3300009011 Bacteria 7334
47 Ga0105248_10393073 3300009177 Bacteria 1561
48 Ga0157314_1001023 3300012500 Bacteria 2193
49 Ga0209436_100023 3300025208 Bacteria 96401
50 Ga0209436_100027 3300025208 Bacteria 87534
51 Ga0207425_1000058 3300025245 Bacteria 149214
52 Ga0207425_1002292 3300025245 Bacteria 6876
53 Ga0207425_1008941 3300025245 Bacteria 2523
54 Ga0209129_1000107 3300025258 Bacteria 154705
55 Ga0209129_1000242 3300025258 Bacteria 58534
56 Ga0209129_1000714 3300025258 Bacteria 21436
57 Ga0209129_1001351 3300025258 Bacteria 13854
58 Ga0209129_1002248 3300025258 Bacteria 9644
59 Ga0209129_1003216 3300025258 Bacteria 7288
60 Ga0209673_1000781 3300025273 Bacteria 42606
61 Ga0209673_1001374 3300025273 Bacteria 23942
62 Ga0209673_1004444 3300025273 Bacteria 7508
63 Ga0209130_1000173 3300025284 Bacteria 92248
64 Ga0209130_1003293 3300025284 Bacteria 7007
65 Ga0209675_1000286 3300025291 Bacteria 47873
66 Ga0209676_1000866 3300025292 Bacteria 38931
67 Ga0209025_1000083 3300025294 Bacteria 265556
68 Ga0209025_1004678 3300025294 Bacteria 11692
69 Ga0209025_1006972 3300025294 Bacteria 8579
70 Ga0209025_1007469 3300025294 Bacteria 8128
71 Ga0209025_1010821 3300025294 Bacteria 6120
72 Ga0209025_1036275 3300025294 Bacteria 2211
73 Ga0209564_1001273 3300025295 Bacteria 27736
74 Ga0209564_1015694 3300025295 Bacteria 3064
75 Ga0209564_1020726 3300025295 Bacteria 2396
76 Ga0209758_1000090 3300025297 Bacteria 246564
77 Ga0209758_1000928 3300025297 Bacteria 39646
78 Ga0209758_1001059 3300025297 Bacteria 35937
79 Ga0209758_1001969 3300025297 Bacteria 22184
80 Ga0209758_1039622 3300025297 Bacteria 1790
81 Ga0209758_1071857 3300025297 Bacteria 1085
82 Ga0209256_1000276 3300025299 Bacteria 89888
83 Ga0209256_1001891 3300025299 Bacteria 19189
84 Ga0209256_1002912 3300025299 Bacteria 12900
85 Ga0209256_1010603 3300025299 Bacteria 3830
86 Ga0207426_1000047 3300025302 Bacteria 417011
87 Ga0207426_1007738 3300025302 Bacteria 4457
88 Ga0209051_1000930 3300025303 Bacteria 29014
89 Ga0209051_1002526 3300025303 Bacteria 12962
90 Ga0209051_1011389 3300025303 Bacteria 4394
91 Ga0209257_1005519 3300025304 Bacteria 8819
92 Ga0207681_10025049 3300025923 Bacteria 3834
93 Ga0207650_10000316 3300025925 Bacteria 47420
94 Ga0207690_10137184 3300025932 Bacteria 1797
95 Ga0207658_10327370 3300025986 Bacteria 1328
96 Ga0207678_10035813 3300026067 Bacteria 4321
97 Ga0207678_10202345 3300026067 Bacteria 1698
98 Ga0209281_1000068 3300027111 Bacteria 280238
99 Ga0268266_10116100 3300028379 Bacteria 2377
100 Ga0268265_10205542 3300028380 Bacteria 1712
101 Ga0316576_10005724 3300031727 Bacteria 7646
102 Ga0316576_10372473 3300031727 Bacteria 1061
103 Ga0307412_10001366 3300031911 Bacteria 13566
104 Ga0439465_0027603 3300041413 Bacteria 1798
105 Ga0439465_0032998 3300041413 Bacteria 1654
106 Ga0439465_0046490 3300041413 Bacteria 1413
107 Ga0439435_0014546 3300042436 Bacteria 1945
108 Ga0466965_0082295 3300044683 Bacteria 1628
109 Ga0495592_0077817 3300046454 Bacteria 2403
110 Ga0495662_0011870 3300046476 Bacteria 4259
111 Ga0495607_0031525 3300046501 Bacteria 3245
112 Ga0495606_0134164 3300046507 Bacteria 1468
113 Ga0495610_0004893 3300046512 Bacteria 9734
114 Ga0495610_0098913 3300046512 Bacteria 1310
115 Ga0495643_0032151 3300046522 Bacteria 2915
116 Ga0495640_0195615 3300046533 Bacteria 1284
117 Ga0495587_0033034 3300046536 Bacteria 3125
118 Ga0495588_0033065 3300046674 Bacteria 2610
119 Ga0495658_0005340 3300046683 Bacteria 6319
120 Ga0495604_0075163 3300047317 Bacteria 2544
121 Ga0495673_0057690 3300047469 Bacteria 1676
122 Ga0495686_0007518 3300047472 Bacteria 8160
123 Ga0496106_0108751 3300048909 Bacteria 2156
124 Ga0496110_0192859 3300048913 Bacteria 1850
125 Ga0496111_0076996 3300048914 Bacteria 2432
126 Ga0496116_0018241 3300048919 Bacteria 5417
127 Ga0496116_0019107 3300048919 Bacteria 5257
128 Ga0496116_0023544 3300048919 Bacteria 4584
129 Ga0496116_0024966 3300048919 Bacteria 4404
130 Ga0496117_0037883 3300048920 Bacteria 3585
131 Ga0496117_0051692 3300048920 Bacteria 2902
132 Ga0496118_0012603 3300048921 Bacteria 8092
133 Ga0496118_0020398 3300048921 Bacteria 5877
134 Ga0496118_0033646 3300048921 Bacteria 4201
135 Ga0496119_0080954 3300048922 Bacteria 1872
136 Ga0496121_0014793 3300048924 Bacteria 8243
137 Ga0496121_0063481 3300048924 Bacteria 3017
138 Ga0496121_0095224 3300048924 Bacteria 2314
139 Ga0496121_0152600 3300048924 Bacteria 1698
140 Ga0496121_0213907 3300048924 Bacteria 1363
141 Ga0496121_0313391 3300048924 Bacteria 1059
142 Ga0496122_0000042 3300048925 Bacteria 280482
143 Ga0496122_0022309 3300048925 Bacteria 5633
144 Ga0496122_0023714 3300048925 Bacteria 5394
145 Ga0496122_0054415 3300048925 Bacteria 3006
146 Ga0496122_0055696 3300048925 Bacteria 2955
147 Ga0496123_0000030 3300048926 Bacteria 291764
148 Ga0496123_0009194 3300048926 Bacteria 8930
149 Ga0496123_0033116 3300048926 Bacteria 3725
150 Ga0496124_0010430 3300048927 Bacteria 9405
151 Ga0496124_0025437 3300048927 Bacteria 5361
152 Ga0496124_0025740 3300048927 Bacteria 5321
153 Ga0496124_0048013 3300048927 Bacteria 3650
154 Ga0496124_0067402 3300048927 Bacteria 2978
155 Ga0496124_0216340 3300048927 Bacteria 1445
156 Ga0496125_0019067 3300048928 Bacteria 6489
157 Ga0496125_0051450 3300048928 Bacteria 3397
158 Ga0496125_0181081 3300048928 Bacteria 1404
159 Ga0496126_0288041 3300048929 Bacteria 1359
160 Ga0496126_0438065 3300048929 Bacteria 1054
161 Ga0495678_039497 3300049459 Bacteria 1903
162 Ga0501032_0056130 3300049569 Bacteria 2648
163 Ga0501032_0080463 3300049569 Bacteria 2168
164 Ga0501033_0004437 3300049570 Bacteria 11224
165 Ga0501036_0155341 3300049572 Bacteria 1930
166 Ga0501036_0156315 3300049572 Bacteria 1923
167 Ga0501037_0000274 3300049573 Bacteria 44054
168 Ga0501037_0191435 3300049573 Bacteria 1448
169 Ga0501037_0262386 3300049573 Bacteria 1207
170 Ga0501041_0202112 3300049577 Bacteria 1246
171 Ga0501043_0000008 3300049579 Bacteria 223654
172 Ga0501043_0066871 3300049579 Bacteria 2822
173 Ga0501047_0061606 3300049581 Bacteria 3620
174 Ga0501047_0136677 3300049581 Bacteria 2331
175 Ga0501068_0016003 3300049584 Bacteria 4320
176 Ga0501069_0000028 3300049585 Bacteria 106038
177 Ga0501070_0004350 3300049586 Bacteria 12177
178 Ga0501070_0108421 3300049586 Bacteria 2294
179 Ga0501071_0001459 3300049587 Bacteria 13705
180 Ga0501072_0462870 3300049588 Bacteria 1004
181 Ga0501073_0142405 3300049589 Bacteria 1661
182 Ga0501073_0153046 3300049589 Bacteria 1598
183 Ga0501074_0001156 3300049590 Bacteria 17272
184 Ga0501080_0000065 3300049742 Bacteria 69171
185 Ga0501080_0091728 3300049742 Bacteria 2821
186 Ga0501083_0004054 3300049744 Bacteria 10304
187 Ga0501083_0041325 3300049744 Bacteria 3127
188 Ga0501035_0000335 3300049822 Bacteria 54785
189 Ga0501035_0052759 3300049822 Bacteria 3638
190 Ga0501035_0128927 3300049822 Bacteria 2206
191 Ga0501044_0000011 3300049823 Bacteria 257385
192 Ga0501044_0417913 3300049823 Bacteria 1251
193 nmdc:mga0sz30_64016_c1 3300050516 Bacteria 1574
194 Ga0495619_0351841 3300053085 Bacteria 1019
195 Ga0500651_0142793 3300053093 Bacteria 1442
196 Ga0500618_050074 3300053125 Bacteria 946
197 Ga0500658_0003838 3300053134 Bacteria 5652
198 Ga0500568_0004963 3300053139 Bacteria 6994
199 Ga0500568_0043181 3300053139 Bacteria 1803
200 Ga0500590_034822 3300053148 Bacteria 2606
201 Ga0500622_0008211 3300053156 Bacteria 5862
202 Ga0500633_0001776 3300053160 Bacteria 4216
203 Ga0501082_0493874 3300060353 Bacteria 1070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0134164 Ga0495606_0134164_402_1220 260
2 iso_pu_bacteria 3000405567 3000408689 260
3 3300049822 Ga0501035_0052759 Ga0501035_0052759_935_1729 264
4 3300003784 Ga0055534_1000347 Ga0055534_100034719 265
5 3300025284 Ga0209130_1003293 Ga0209130_10032931 265
6 3300025291 Ga0209675_1000286 Ga0209675_100028637 265
7 3300025292 Ga0209676_1000866 Ga0209676_100086627 265
8 3300025303 Ga0209051_1000930 Ga0209051_100093014 265
9 3300025304 Ga0209257_1005519 Ga0209257_10055193 265
10 3300031727 Ga0316576_10372473 Ga0316576_103724732 265
11 3300003771 Ga0055526_1014051 Ga0055526_10140514 266
12 3300003790 Ga0055528_1003686 Ga0055528_10036869 266
13 iso_pu_bacteria 2585427633 2585997015 266
14 iso_pu_bacteria 2585427634 2586001614 266
15 iso_pu_bacteria 2599185236 2599722484 266
16 iso_pu_bacteria 2821123053 2821126025 266
17 iso_pu_bacteria 2838736955 2838737498 266
18 iso_pu_bacteria 2841840854 2841842133 266
19 iso_pu_bacteria 2842140634 2842141912 266
20 iso_pu_bacteria 2857531043 2857532587 266
21 iso_pu_bacteria 2889790730 2889794599 266
22 iso_pu_bacteria 2889914905 2889919314 266
23 iso_pu_bacteria 2582581299 2585227641 268
24 iso_pu_bacteria 2582581304 2585257655 268
25 iso_pu_bacteria 2585427594 2585845173 268
26 iso_pu_bacteria 2643221634 2644191541 268
27 iso_pu_bacteria 2713897090 2715500412 268
28 iso_pu_bacteria 2738541293 2738800609 268
29 iso_pu_bacteria 2899259804 2899262156 268
30 3300005548 Ga0070665_100273104 Ga0070665_1002731042 269
31 3300044683 Ga0466965_0082295 Ga0466965_0082295_302_1111 269
32 3300048925 Ga0496122_0000042 Ga0496122_0000042_64425_65234 269
33 3300048926 Ga0496123_0000030 Ga0496123_0000030_226526_227335 269
34 3300048927 Ga0496124_0048013 Ga0496124_0048013_834_1643 269
35 3300049577 Ga0501041_0202112 Ga0501041_0202112_396_1229 269
36 iso_pu_bacteria 2855020534 2855020937 269
37 iso_pu_bacteria 8005542996 8005547281 269
38 iso_pu_bacteria 8057132660 8057135307 269
39 3300006946 Ga0079104_1000015 Ga0079104_1000015281 270
40 3300027111 Ga0209281_1000068 Ga0209281_1000068109 270
41 3300048924 Ga0496121_0152600 Ga0496121_0152600_789_1601 270
42 3300049569 Ga0501032_0080463 Ga0501032_0080463_1218_2030 270
43 3300049570 Ga0501033_0004437 Ga0501033_0004437_3225_4037 270
44 3300049572 Ga0501036_0156315 Ga0501036_0156315_586_1398 270
45 3300049573 Ga0501037_0000274 Ga0501037_0000274_42452_43264 270
46 3300049573 Ga0501037_0262386 Ga0501037_0262386_302_1114 270
47 3300049579 Ga0501043_0000008 Ga0501043_0000008_26189_27001 270
48 3300049584 Ga0501068_0016003 Ga0501068_0016003_769_1581 270
49 3300049585 Ga0501069_0000028 Ga0501069_0000028_52748_53560 270
50 3300049586 Ga0501070_0004350 Ga0501070_0004350_5654_6466 270
51 3300049587 Ga0501071_0001459 Ga0501071_0001459_469_1281 270
52 3300049588 Ga0501072_0462870 Ga0501072_0462870_60_899 270
53 3300049590 Ga0501074_0001156 Ga0501074_0001156_9221_10033 270
54 3300049742 Ga0501080_0000065 Ga0501080_0000065_46547_47359 270
55 3300049744 Ga0501083_0004054 Ga0501083_0004054_1194_2006 270
56 3300049822 Ga0501035_0000335 Ga0501035_0000335_44313_45125 270
57 3300049822 Ga0501035_0128927 Ga0501035_0128927_584_1396 270
58 3300049823 Ga0501044_0000011 Ga0501044_0000011_63715_64527 270
59 3300060353 Ga0501082_0493874 Ga0501082_0493874_192_1004 270
60 iso_pu_bacteria 2510917030 2511200449 270
61 iso_pu_bacteria 2582581298 2585224945 270
62 iso_pu_bacteria 2585427529 2585547501 270
63 iso_pu_bacteria 2791355260 2793319864 270
64 iso_pu_bacteria 2919100787 2919104403 270
65 iso_pu_bacteria 3005445848 3005449121 270
66 3300005262 Ga0065165_1002557 Ga0065165_100255717 271
67 3300005563 Ga0068855_100647694 Ga0068855_1006476941 271
68 3300025932 Ga0207690_10137184 Ga0207690_101371842 271
69 3300026067 Ga0207678_10202345 Ga0207678_102023451 271
70 3300031727 Ga0316576_10005724 Ga0316576_100057244 271
71 3300049823 Ga0501044_0417913 Ga0501044_0417913_174_989 271
72 iso_pu_bacteria 2834578030 2834580224 271
73 iso_pu_bacteria 3005452660 3005455401 271
74 iso_pu_bacteria 8054558443 8054558488 271
75 3300002774 JGI25150J39212_1000456 JGI25150J39212_100045610 272
76 3300003187 JGI25151J46595_10000031 JGI25151J46595_100000315 272
77 3300003215 JGI25153J46596_10003264 JGI25153J46596_100032649 272
78 3300025245 Ga0207425_1000058 Ga0207425_100005850 272
79 3300025258 Ga0209129_1000107 Ga0209129_100010750 272
80 3300025294 Ga0209025_1000083 Ga0209025_100008350 272
81 3300025297 Ga0209758_1000090 Ga0209758_1000090213 272
82 3300031911 Ga0307412_10001366 Ga0307412_100013665 272
83 3300042436 Ga0439435_0014546 Ga0439435_0014546_571_1431 272
84 3300046501 Ga0495607_0031525 Ga0495607_0031525_57_875 272
85 3300046512 Ga0495610_0004893 Ga0495610_0004893_2240_3058 272
86 3300047469 Ga0495673_0057690 Ga0495673_0057690_506_1324 272
87 3300047472 Ga0495686_0007518 Ga0495686_0007518_6446_7264 272
88 3300048919 Ga0496116_0018241 Ga0496116_0018241_1574_2392 272
89 3300048919 Ga0496116_0019107 Ga0496116_0019107_2977_3795 272
90 3300048919 Ga0496116_0024966 Ga0496116_0024966_536_1354 272
91 3300048920 Ga0496117_0037883 Ga0496117_0037883_1809_2627 272
92 3300048920 Ga0496117_0051692 Ga0496117_0051692_1480_2298 272
93 3300048921 Ga0496118_0020398 Ga0496118_0020398_4048_4866 272
94 3300048921 Ga0496118_0033646 Ga0496118_0033646_1814_2632 272
95 3300048922 Ga0496119_0080954 Ga0496119_0080954_847_1665 272
96 3300048924 Ga0496121_0063481 Ga0496121_0063481_704_1522 272
97 3300048924 Ga0496121_0095224 Ga0496121_0095224_29_847 272
98 3300048924 Ga0496121_0213907 Ga0496121_0213907_498_1316 272
99 3300048925 Ga0496122_0023714 Ga0496122_0023714_3100_3918 272
100 3300048925 Ga0496122_0054415 Ga0496122_0054415_1588_2406 272
101 3300048925 Ga0496122_0055696 Ga0496122_0055696_642_1460 272
102 3300048926 Ga0496123_0009194 Ga0496123_0009194_2967_3785 272
103 3300048926 Ga0496123_0033116 Ga0496123_0033116_1462_2280 272
104 3300048927 Ga0496124_0010430 Ga0496124_0010430_5196_6014 272
105 3300048927 Ga0496124_0025437 Ga0496124_0025437_3048_3866 272
106 3300048927 Ga0496124_0067402 Ga0496124_0067402_665_1483 272
107 3300048928 Ga0496125_0019067 Ga0496125_0019067_1241_2059 272
108 3300048929 Ga0496126_0288041 Ga0496126_0288041_416_1234 272
109 3300048929 Ga0496126_0438065 Ga0496126_0438065_174_992 272
110 3300049459 Ga0495678_039497 Ga0495678_039497_666_1484 272
111 3300049572 Ga0501036_0155341 Ga0501036_0155341_785_1648 272
112 3300049573 Ga0501037_0191435 Ga0501037_0191435_25_888 272
113 3300049581 Ga0501047_0136677 Ga0501047_0136677_291_1154 272
114 3300049586 Ga0501070_0108421 Ga0501070_0108421_550_1413 272
115 3300049589 Ga0501073_0142405 Ga0501073_0142405_206_1069 272
116 3300049742 Ga0501080_0091728 Ga0501080_0091728_1026_1889 272
117 3300050516 nmdc:mga0sz30_64016_c1 nmdc:mga0sz30_64016_c1_369_1187 272
118 3300053125 Ga0500618_050074 Ga0500618_050074_59_877 272
119 iso_pu_bacteria 2513237138 2513867581 272
120 iso_pu_bacteria 2582581867 2585403386 272
121 iso_pu_bacteria 2585427590 2585823682 272
122 iso_pu_bacteria 2643221618 2644108601 272
123 iso_pu_bacteria 2643221655 2644312276 272
124 iso_pu_bacteria 2643221712 2644617959 272
125 iso_pu_bacteria 2671180139 2671694793 272
126 iso_pu_bacteria 2854681122 2854682698 272
127 iso_pu_bacteria 2923556063 2923558927 272
128 3300002773 JGI25152J39213_1002942 JGI25152J39213_10029426 273
129 3300003187 JGI25151J46595_10006064 JGI25151J46595_100060643 273
130 3300003354 JGI25160J50197_1011643 JGI25160J50197_10116434 273
131 3300003775 Ga0055524_1001018 Ga0055524_10010183 273
132 3300003775 Ga0055524_1002189 Ga0055524_100218911 273
133 3300003775 Ga0055524_1003691 Ga0055524_10036916 273
134 3300003775 Ga0055524_1009980 Ga0055524_10099802 273
135 3300003790 Ga0055528_1000176 Ga0055528_100017646 273
136 3300005262 Ga0065165_1011641 Ga0065165_10116415 273
137 3300005262 Ga0065165_1031675 Ga0065165_10316751 273
138 3300005355 Ga0070671_100017297 Ga0070671_1000172973 273
139 3300005367 Ga0070667_100394286 Ga0070667_1003942861 273
140 3300005455 Ga0070663_100004996 Ga0070663_1000049963 273
141 3300005455 Ga0070663_100037471 Ga0070663_1000374713 273
142 3300005457 Ga0070662_100133398 Ga0070662_1001333982 273
143 3300009011 Ga0105251_10006623 Ga0105251_100066237 273
144 3300009177 Ga0105248_10393073 Ga0105248_103930732 273
145 3300025258 Ga0209129_1000242 Ga0209129_10002426 273
146 3300025258 Ga0209129_1003216 Ga0209129_10032161 273
147 3300025273 Ga0209673_1000781 Ga0209673_100078116 273
148 3300025273 Ga0209673_1004444 Ga0209673_10044448 273
149 3300025294 Ga0209025_1004678 Ga0209025_100467811 273
150 3300025294 Ga0209025_1007469 Ga0209025_10074693 273
151 3300025294 Ga0209025_1036275 Ga0209025_10362752 273
152 3300025295 Ga0209564_1015694 Ga0209564_10156942 273
153 3300025295 Ga0209564_1020726 Ga0209564_10207262 273
154 3300025297 Ga0209758_1071857 Ga0209758_10718572 273
155 3300025299 Ga0209256_1000276 Ga0209256_100027670 273
156 3300025299 Ga0209256_1001891 Ga0209256_10018918 273
157 3300025299 Ga0209256_1010603 Ga0209256_10106033 273
158 3300025302 Ga0207426_1007738 Ga0207426_10077385 273
159 3300025303 Ga0209051_1011389 Ga0209051_10113893 273
160 3300025986 Ga0207658_10327370 Ga0207658_103273702 273
161 3300026067 Ga0207678_10035813 Ga0207678_100358134 273
162 3300041413 Ga0439465_0027603 Ga0439465_0027603_263_1126 273
163 3300048913 Ga0496110_0192859 Ga0496110_0192859_450_1286 273
164 3300048914 Ga0496111_0076996 Ga0496111_0076996_827_1663 273
165 3300048927 Ga0496124_0216340 Ga0496124_0216340_77_913 273
166 iso_pu_bacteria 2513237144 2513908322 273
167 iso_pu_bacteria 2643221557 2643804062 273
168 iso_pu_bacteria 2643221610 2644064862 273
169 iso_pu_bacteria 2643221668 2644376196 273
170 iso_pu_bacteria 2643221675 2644416535 273
171 iso_pu_bacteria 2643221680 2644449575 273
172 iso_pu_bacteria 2643221726 2644688150 273
173 iso_pu_bacteria 2896384573 2896386344 273
174 iso_pu_bacteria 2933016740 2933018161 273
175 iso_pu_bacteria 2941499720 2941501812 273
176 iso_pu_bacteria 3003930520 3003934803 273
177 iso_pu_bacteria 643692032 643826981 273
178 iso_pu_bacteria 8056875544 8056876060 273
179 3300002773 JGI25152J39213_1001615 JGI25152J39213_10016159 274
180 3300002773 JGI25152J39213_1002896 JGI25152J39213_10028966 274
181 3300002773 JGI25152J39213_1002949 JGI25152J39213_10029492 274
182 3300002987 JGI25159J45721_1003715 JGI25159J45721_10037154 274
183 3300003187 JGI25151J46595_10006795 JGI25151J46595_100067957 274
184 3300003215 JGI25153J46596_10006184 JGI25153J46596_100061846 274
185 3300003215 JGI25153J46596_10006287 JGI25153J46596_100062877 274
186 3300003215 JGI25153J46596_10014604 JGI25153J46596_100146042 274
187 3300003322 rootL2_10292081 rootL2_102920813 274
188 3300003323 rootH1_10003032 rootH1_100030322 274
189 3300003323 rootH1_10223117 rootH1_102231171 274
190 3300003374 JGI25161J50226_1000104 JGI25161J50226_100010455 274
191 3300003374 JGI25161J50226_1000396 JGI25161J50226_10003965 274
192 3300003771 Ga0055526_1003218 Ga0055526_10032189 274
193 3300003775 Ga0055524_1019819 Ga0055524_10198193 274
194 3300003790 Ga0055528_1001761 Ga0055528_100176112 274
195 3300003792 Ga0055540_1030732 Ga0055540_10307322 274
196 3300004625 Ga0055543_1000280 Ga0055543_100028021 274
197 3300005331 Ga0070670_100000108 Ga0070670_10000010849 274
198 3300005353 Ga0070669_100018808 Ga0070669_1000188085 274
199 3300012500 Ga0157314_1001023 Ga0157314_10010232 274
200 3300025208 Ga0209436_100023 Ga0209436_10002378 274
201 3300025208 Ga0209436_100027 Ga0209436_10002740 274
202 3300025245 Ga0207425_1002292 Ga0207425_10022923 274
203 3300025245 Ga0207425_1008941 Ga0207425_10089412 274
204 3300025258 Ga0209129_1000714 Ga0209129_10007143 274
205 3300025258 Ga0209129_1001351 Ga0209129_10013513 274
206 3300025258 Ga0209129_1002248 Ga0209129_10022483 274
207 3300025273 Ga0209673_1001374 Ga0209673_100137411 274
208 3300025284 Ga0209130_1000173 Ga0209130_100017374 274
209 3300025294 Ga0209025_1006972 Ga0209025_10069722 274
210 3300025294 Ga0209025_1010821 Ga0209025_10108212 274
211 3300025295 Ga0209564_1001273 Ga0209564_100127311 274
212 3300025297 Ga0209758_1000928 Ga0209758_100092814 274
213 3300025297 Ga0209758_1001059 Ga0209758_100105930 274
214 3300025297 Ga0209758_1001969 Ga0209758_100196921 274
215 3300025297 Ga0209758_1039622 Ga0209758_10396222 274
216 3300025299 Ga0209256_1002912 Ga0209256_100291211 274
217 3300025302 Ga0207426_1000047 Ga0207426_100004774 274
218 3300025303 Ga0209051_1002526 Ga0209051_10025262 274
219 3300025923 Ga0207681_10025049 Ga0207681_100250493 274
220 3300025925 Ga0207650_10000316 Ga0207650_1000031621 274
221 3300028379 Ga0268266_10116100 Ga0268266_101161002 274
222 3300028380 Ga0268265_10205542 Ga0268265_102055422 274
223 3300041413 Ga0439465_0032998 Ga0439465_0032998_735_1559 274
224 3300041413 Ga0439465_0046490 Ga0439465_0046490_554_1378 274
225 3300046454 Ga0495592_0077817 Ga0495592_0077817_973_1839 274
226 3300046476 Ga0495662_0011870 Ga0495662_0011870_2721_3587 274
227 3300046512 Ga0495610_0098913 Ga0495610_0098913_154_978 274
228 3300046522 Ga0495643_0032151 Ga0495643_0032151_748_1572 274
229 3300046533 Ga0495640_0195615 Ga0495640_0195615_362_1228 274
230 3300046536 Ga0495587_0033034 Ga0495587_0033034_1989_2855 274
231 3300046674 Ga0495588_0033065 Ga0495588_0033065_986_1852 274
232 3300046683 Ga0495658_0005340 Ga0495658_0005340_673_1539 274
233 3300047317 Ga0495604_0075163 Ga0495604_0075163_792_1658 274
234 3300048909 Ga0496106_0108751 Ga0496106_0108751_725_1549 274
235 3300048919 Ga0496116_0023544 Ga0496116_0023544_2635_3459 274
236 3300048921 Ga0496118_0012603 Ga0496118_0012603_649_1473 274
237 3300048924 Ga0496121_0014793 Ga0496121_0014793_5005_5829 274
238 3300048924 Ga0496121_0313391 Ga0496121_0313391_60_926 274
239 3300048925 Ga0496122_0022309 Ga0496122_0022309_761_1585 274
240 3300048927 Ga0496124_0025740 Ga0496124_0025740_2030_2854 274
241 3300048928 Ga0496125_0051450 Ga0496125_0051450_661_1485 274
242 3300048928 Ga0496125_0181081 Ga0496125_0181081_398_1225 274
243 3300049569 Ga0501032_0056130 Ga0501032_0056130_927_1751 274
244 3300049579 Ga0501043_0066871 Ga0501043_0066871_1961_2785 274
245 3300049581 Ga0501047_0061606 Ga0501047_0061606_2361_3185 274
246 3300049589 Ga0501073_0153046 Ga0501073_0153046_422_1246 274
247 3300049744 Ga0501083_0041325 Ga0501083_0041325_1113_1937 274
248 3300053085 Ga0495619_0351841 Ga0495619_0351841_80_946 274
249 3300053093 Ga0500651_0142793 Ga0500651_0142793_536_1360 274
250 3300053134 Ga0500658_0003838 Ga0500658_0003838_4275_5099 274
251 3300053139 Ga0500568_0004963 Ga0500568_0004963_2314_3138 274
252 3300053139 Ga0500568_0043181 Ga0500568_0043181_545_1369 274
253 3300053148 Ga0500590_034822 Ga0500590_034822_1090_1956 274
254 3300053156 Ga0500622_0008211 Ga0500622_0008211_4344_5168 274
255 3300053160 Ga0500633_0001776 Ga0500633_0001776_2961_3785 274
256 iso_pu_bacteria 2615840626 2616307255 274
257 iso_pu_bacteria 2738541317 2738944392 274
258 iso_pu_bacteria 2775507049 2776914450 274
259 iso_pu_bacteria 2791355253 2793281726 274
260 iso_pu_bacteria 2837651117 2837654295 274
261 iso_pu_bacteria 2838668709 2838671296 274
262 iso_pu_bacteria 2838701080 2838703523 274
263 iso_pu_bacteria 2842146304 2842149475 274
264 iso_pu_bacteria 2842250916 2842253887 274
265 iso_pu_bacteria 2854916844 2854920203 274
266 iso_pu_bacteria 2891048133 2891050741 274
267 iso_pu_bacteria 2913308742 2913309011 274
268 iso_pu_bacteria 2920760137 2920760882 274
269 iso_pu_bacteria 2937843397 2937847143 274
270 iso_pu_bacteria 2989771324 2989773409 274
271 iso_pu_bacteria 8005382845 8005383987 274
272 iso_pu_bacteria 8024486573 8024487863 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01501

Glyco_transf_8

Glycosyl transferase family 8

47

277

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eql-assembly1.cif.gz_B crystal structure of human glycogenin-1 (gyg1) tyr195piphe mutant complexed with manganese and udp 0.8262 7 257
6eql-assembly1.cif.gz_B crystal structure of human glycogenin-1 (gyg1) tyr195piphe mutant complexed with manganese and udp 0.7984 7 257
4ueg-assembly1.cif.gz_B-2 crystal structure of human glycogenin-2 catalytic domain 0.7964 7 266
3t7n-assembly1.cif.gz_B crystal structure of human glycogenin-1 (gyg1) complexed with manganese and udp, in a monoclinic closed form 0.7942 7 257
3t7n-assembly1.cif.gz_A crystal structure of human glycogenin-1 (gyg1) complexed with manganese and udp, in a monoclinic closed form 0.7922 3 258
ID Description Score Start End Superfamily
af_Q965I8_90_187_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8307 6 65 3.40.50.1100
5ybwB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8283 8 65 3.40.50.1100
6eqlB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8262 7 257 3.90.550.10
af_B7ZZ35_27_272_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8008 7 258 3.90.550.10
6eqlB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7984 7 257 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A418SYD7-F1-model_v4 Glycosyl transferase 0.9851 7 270 GO:0016757
AF-U3AI83-F1-model_v4 Glycogenin-1 0.9813 58 270 GO:0016757
AF-A0A5B8L2P2-F1-model_v4 Glycosyl transferase 0.9803 1 270 GO:0016757
AF-A0A222E6E3-F1-model_v4 Glycosyl transferase family 8 0.9777 11 246 GO:0016757
AF-A0A4R2PQD3-F1-model_v4 Alpha-N-acetylglucosamine transferase 0.9758 5 263 GO:0016757

Feature Viewer

pLDDT pTM Quality
90.21 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map