F378637

General Info

Members Datasets Scaffolds Average Seq Length
272 222 544 572

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0005414|Ga0496122_0005414_12359_14359
Length 658
Sequence MNQTATPEVIKPLGSGLDLHFSRDWLSELGQRMDNNGPWDQAELFQLALESEAARLVHSFDELQCLRHLPDLEPLEHQMEAARKVLLTMRGRAILADEVGLGKTIEAGLVLKEYMVRGLVKKVLILVPASLVLQWVRELNQKFGIAASAQRKAYMWEGTDVIVASIDTAKRPPHREIVMDIDYDMLIIDEAHKLKNKKTTNYQFVGGLKRKYCLLLTATPVQNDMDELYNLIHVLKPGQLGGEGSFQDKFVAEKRVPKNEGILQSELAKIMIRNRRSDGRVDFTRRIVKNIPLVLSPEEQALYDGVTRFVKERYDEMGRSSSAFTLVTLQREVCSSRDAVFVTLVHLFKKLAEESPMRPKVWELVELIKGITANSKAEKVLXXXQGINDKVIVFTEYRASQEYLLKFLKDHGISAVPYRGGMNRGKKDWMMDLFRGRAQVLVATEAGGEGINLQFCHNMINFDLPWNPMRLEQRIGRIHRLGQQFDVNIYNLSTIGTIEEHILHLLHEKIHMFELVIGGLDHILEQKAALEADLMKLVLAADNETEMRAGLERLGDNLLTAVETTANPGTVPIAAADKLSKSSRTRSRNSTAPAGSAGSVASKGLASTAFLPQSGIVAAADVGIGAAAIANDSNGVTGDAQTGAYAPDTTTSSASTGE

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
21 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
22 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
35 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
36 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
37 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
38 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
39 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
40 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
41 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
42 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
43 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
44 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
45 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
46 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
47 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
48 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
49 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
50 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
51 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
52 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
53 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
54 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
55 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
56 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
57 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
58 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
59 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
60 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
61 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
62 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
63 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
64 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
65 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
66 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
67 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
68 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
69 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
70 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
71 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
72 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
73 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
74 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
75 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
76 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
77 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
78 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
79 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
80 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
81 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
82 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
83 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
84 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
85 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
86 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
87 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
88 2643221729 Bacillus sp. Root11 Isolate Unclassified
89 2643221730 Bacillus sp. Root131 Isolate Unclassified
90 2643221731 Bacillus sp. Root147 Isolate Unclassified
91 2643221732 Bacillus sp. Root239 Isolate Unclassified
92 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
93 2671180694 Paenibacillus sp. A3 Isolate Unclassified
94 2684622632 Bacillus cereus 905 Isolate Unclassified
95 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
96 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
97 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
98 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
99 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
100 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
101 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
102 2738541295 Bacillus sp. OK085 Isolate Unclassified
103 2738541358 Bacillus sp. OV752 Isolate Unclassified
104 2738543006 Bacillus sp. OK077 Isolate Unclassified
105 2738543010 Bacillus sp. YR335 Isolate Unclassified
106 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
107 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
108 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
109 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
110 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
111 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
112 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
113 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
114 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
115 2818991459 Paenibacillus sp. 597 Isolate Unclassified
116 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
117 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
118 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
119 2842682962 Bacillus sp. R-72492 Isolate Unclassified
120 2842882022 Bacillus sp. R-71893 Isolate Unclassified
121 2849139964 Bacillus sp. R-71875 Isolate Unclassified
122 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
123 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
124 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
125 2857472729 Cohnella sp. R-74144 Isolate Unclassified
126 2857581216 Bacillus sp. R-71922 Isolate Unclassified
127 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
128 2860837431 Bacillus sp. WR11 Isolate Unclassified
129 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
130 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
131 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
132 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
133 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
134 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
135 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
136 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
137 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
138 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
139 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
140 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
141 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
142 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
143 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
144 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
145 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
146 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
147 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
148 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
149 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
150 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
151 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
152 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
153 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
154 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
155 2919720352 Priestia megaterium 4340 Isolate Unclassified
156 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
157 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
158 2929004312 Priestia megaterium 1104 Isolate Unclassified
159 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
160 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
161 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
162 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
163 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
164 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
165 2938917290 Bacillus sp. CR71 Isolate Unclassified
166 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
167 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
168 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
169 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
170 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
171 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
172 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
173 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
174 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
175 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
176 2965761152 Bacillus sp. COPE52 Isolate Unclassified
177 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
178 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
179 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
180 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
181 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
182 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
183 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
184 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
185 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
186 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
187 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
188 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
189 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
190 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
191 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
192 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
193 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
194 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
195 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
196 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
197 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
198 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
199 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
200 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
201 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
202 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
203 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
204 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
205 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
206 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
207 8022653035 Bacillus sp. Rc4 Isolate Unclassified
208 8022792930 Bacillus sp. Xin Isolate Rhizosphere
209 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
210 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
211 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
212 8023438354 Bacillus sp. BH2 Isolate Unclassified
213 8023444577 Bacillus sp. BH32 Isolate Unclassified
214 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
215 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
216 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
217 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
218 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
219 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
220 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
221 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
222 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 43.38
Metatranscriptomes 0
Isolates 56.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.03
Nodule 0.74
Rhizoplane 5.51
Rhizosphere 42.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0005414 3300048925 Bacteria 15226
2 JGI25159J45721_1006098 3300002987 Bacteria 3661
3 JGI25159J45721_1008951 3300002987 Bacteria 2689
4 JGI25151J46595_10011693 3300003187 Bacteria 4023
5 JGI25151J46595_10015506 3300003187 Bacteria 3354
6 JGI25151J46595_10017891 3300003187 Bacteria 3059
7 JGI25151J46595_10019015 3300003187 Bacteria 2931
8 rootH1_10016889 3300003316 Bacteria 8083
9 rootH2_10205771 3300003320 Bacteria 5103
10 rootL2_10054182 3300003322 Bacteria 9434
11 rootH1_10284303 3300003323 Bacteria 2433
12 Ga0055532_1001124 3300003758 Bacteria 8204
13 Ga0055532_1002927 3300003758 Bacteria 3208
14 Ga0055535_1002206 3300003761 Bacteria 7397
15 Ga0055528_1001480 3300003790 Bacteria 14272
16 Ga0055541_1001675 3300003841 Bacteria 4678
17 Ga0070670_100030917 3300005331 Bacteria 4612
18 Ga0105251_10014018 3300009011 Bacteria 4452
19 Ga0105244_10003507 3300009036 Bacteria 11145
20 Ga0105244_10020152 3300009036 Bacteria 3707
21 Ga0105244_10026744 3300009036 Bacteria 3119
22 Ga0105244_10045911 3300009036 Bacteria 2246
23 Ga0105250_10001097 3300009092 Bacteria 15279
24 Ga0105250_10013318 3300009092 Bacteria 3387
25 Ga0105250_10016864 3300009092 Bacteria 2973
26 Ga0105247_10004089 3300009101 Bacteria 9374
27 Ga0105243_10003175 3300009148 Bacteria 13469
28 Ga0105242_10002613 3300009176 Bacteria 14125
29 Ga0105246_10001703 3300011119 Bacteria 13124
30 Ga0105246_10009273 3300011119 Bacteria 6059
31 Ga0105246_10016989 3300011119 Bacteria 4620
32 Ga0157378_10014006 3300013297 Bacteria 7019
33 Ga0157377_10039994 3300014745 Bacteria 2595
34 Ga0209784_100072 3300025224 Bacteria 149587
35 Ga0209566_100022 3300025225 Bacteria 403259
36 Ga0209566_100069 3300025225 Bacteria 177387
37 Ga0209566_101877 3300025225 Bacteria 4705
38 Ga0209147_100139 3300025229 Bacteria 116694
39 Ga0209147_100253 3300025229 Bacteria 50567
40 Ga0209258_101960 3300025242 Bacteria 5999
41 Ga0209673_1004835 3300025273 Bacteria 7054
42 Ga0209130_1000808 3300025284 Bacteria 26511
43 Ga0209130_1003031 3300025284 Bacteria 7589
44 Ga0209130_1013009 3300025284 Bacteria 2149
45 Ga0209025_1000547 3300025294 Bacteria 70326
46 Ga0209025_1000587 3300025294 Bacteria 65826
47 Ga0209025_1002478 3300025294 Bacteria 19407
48 Ga0209025_1002818 3300025294 Bacteria 17497
49 Ga0209025_1007937 3300025294 Bacteria 7770
50 Ga0209025_1009524 3300025294 Bacteria 6749
51 Ga0209025_1011612 3300025294 Bacteria 5776
52 Ga0209025_1033564 3300025294 Bacteria 2368
53 Ga0207696_1000701 3300025711 Bacteria 22922
54 Ga0207696_1006083 3300025711 Bacteria 4915
55 Ga0207696_1016133 3300025711 Bacteria 2508
56 Ga0207655_1005886 3300025728 Bacteria 8225
57 Ga0207655_1025313 3300025728 Bacteria 2883
58 Ga0207713_1001286 3300025735 Bacteria 20686
59 Ga0207650_10072805 3300025925 Bacteria 2587
60 Ga0207709_10025852 3300025935 Bacteria 3365
61 Ga0237817_10022 3300030083 Bacteria 62837
62 Ga0237817_10251 3300030083 Bacteria 13067
63 Ga0307408_100021659 3300031548 Bacteria 4353
64 Ga0307408_100040111 3300031548 Bacteria 3314
65 Ga0307405_10023197 3300031731 Bacteria 3523
66 Ga0307409_100036375 3300031995 Bacteria 3618
67 Ga0395899_0026736 3300037312 Bacteria 4353
68 Ga0237819_00050 3300038705 Bacteria 40889
69 Ga0237819_02795 3300038705 Bacteria 3338
70 Ga0439436_0001172 3300041404 Bacteria 7446
71 Ga0439439_0003996 3300041406 Bacteria 3291
72 Ga0439449_0003350 3300042007 Bacteria 6244
73 Ga0466969_0015824 3300044656 Bacteria 3953
74 Ga0466959_0002603 3300045049 Bacteria 11579
75 Ga0466967_0000025 3300045976 Bacteria 65709
76 Ga0495584_0005227 3300046491 Bacteria 6884
77 Ga0495660_0028054 3300046810 Bacteria 3183
78 Ga0496100_0000422 3300048903 Bacteria 20510
79 Ga0496101_0016765 3300048904 Bacteria 4958
80 Ga0496102_0005272 3300048905 Bacteria 10977
81 Ga0496104_0000268 3300048907 Bacteria 46125
82 Ga0496105_0005472 3300048908 Bacteria 9636
83 Ga0496107_0005001 3300048910 Bacteria 9025
84 Ga0496108_0000637 3300048911 Bacteria 27336
85 Ga0496109_0000538 3300048912 Bacteria 32057
86 Ga0496110_0000661 3300048913 Bacteria 23565
87 Ga0496110_0008402 3300048913 Bacteria 8306
88 Ga0496110_0037093 3300048913 Bacteria 4235
89 Ga0496111_0001449 3300048914 Bacteria 13548
90 Ga0496112_0000457 3300048915 Bacteria 27274
91 Ga0496113_0003092 3300048916 Bacteria 9886
92 Ga0496116_0006639 3300048919 Bacteria 10451
93 Ga0496116_0010003 3300048919 Bacteria 8007
94 Ga0496117_0021025 3300048920 Bacteria 5302
95 Ga0496118_0048346 3300048921 Bacteria 3287
96 Ga0496119_0000742 3300048922 Bacteria 43873
97 Ga0496119_0015064 3300048922 Bacteria 5987
98 Ga0496119_0027245 3300048922 Bacteria 3933
99 Ga0496120_0000638 3300048923 Bacteria 52056
100 Ga0496120_0026426 3300048923 Bacteria 3584
101 Ga0496121_0021271 3300048924 Bacteria 6364
102 Ga0496121_0106045 3300048924 Bacteria 2155
103 Ga0496122_0021621 3300048925 Bacteria 5751
104 Ga0496122_0023673 3300048925 Bacteria 5401
105 Ga0496122_0032030 3300048925 Bacteria 4357
106 Ga0496122_0076161 3300048925 Bacteria 2362
107 Ga0496123_0006905 3300048926 Bacteria 10860
108 Ga0496123_0030513 3300048926 Bacteria 3945
109 Ga0496124_0000233 3300048927 Bacteria 108674
110 Ga0496124_0000432 3300048927 Bacteria 74430
111 Ga0496125_0000968 3300048928 Bacteria 44938
112 Ga0496125_0003603 3300048928 Bacteria 18590
113 Ga0496125_0003693 3300048928 Bacteria 18269
114 Ga0496125_0018517 3300048928 Bacteria 6614
115 Ga0496126_0000633 3300048929 Bacteria 65638
116 Ga0496126_0001632 3300048929 Bacteria 33915
117 Ga0496126_0008097 3300048929 Bacteria 11383
118 Ga0496126_0014852 3300048929 Bacteria 7855
119 2511179847 2510917027 Bacteria 5287437
120 2512639673 2512564013 Bacteria 6286191
121 2512731506 2512564039 Bacteria 8739048
122 2524190752 2524023129 Bacteria 6762600
123 2540607394 2540341094 Bacteria 4061186
124 2550905010 2548877040 Bacteria 7507281
125 2553393411 2551306519 Bacteria 5465154
126 2556065335 2554235469 Bacteria 3590176
127 2563926417 2563366752 Bacteria 4961801
128 2571527294 2571042143 Bacteria 6986194
129 2573037844 2571042588 Bacteria 5045676
130 2578336549 2576861424 Bacteria 5270569
131 2580933079 2579778775 Bacteria 5360914
132 2587738926 2585428059 Bacteria 8696589
133 2595316057 2593339198 Bacteria 7267884
134 2601637427 2600255286 Bacteria 5390125
135 2621274762 2619619294 Bacteria 5575484
136 2644427430 2643221676 Bacteria 8119172
137 2644708197 2643221729 Bacteria 6621700
138 2644712500 2643221730 Bacteria 6523787
139 2644715828 2643221731 Bacteria 5623886
140 2644724301 2643221732 Bacteria 5756404
141 2672336922 2671180330 Bacteria 5521719
142 2673819399 2671180694 Bacteria 7506943
143 2685152203 2684622632 Bacteria 5380049
144 2698320960 2695420987 Bacteria 6152737
145 2705996142 2703719227 Bacteria 5631989
146 2712197722 2711768088 Bacteria 3195027
147 2721507363 2718218445 Bacteria 5113413
148 2723603312 2721755693 Bacteria 6126117
149 2728534121 2728368933 Bacteria 7044283
150 2730139344 2728369359 Bacteria 5621728
151 2738813845 2738541295 Bacteria 5730091
152 2739154594 2738541358 Bacteria 5932299
153 2739208034 2738543006 Bacteria 5904091
154 2739230337 2738543010 Bacteria 5583595
155 2745168124 2744054657 Bacteria 5016802
156 2753808330 2751185905 Bacteria 6142767
157 2802436137 2802428803 Bacteria 5806948
158 2808869391 2808606364 Bacteria 4465927
159 2809055923 2808606399 Bacteria 4021018
160 2816862623 2816332186 Bacteria 5331395
161 2817480739 2816332295 Bacteria 4352468
162 2817617975 2816332336 Bacteria 5207640
163 2819584418 2818991443 Bacteria 6598732
164 2819673260 2818991459 Bacteria 8736032
165 2819709300 2818991465 Bacteria 5388835
166 2821113726 2821111986 Bacteria 6894338
167 2831905619 2831905167 Bacteria 3319172
168 2842684458 2842682962 Bacteria 5589973
169 2842884454 2842882022 Bacteria 6158489
170 2849142480 2849139964 Bacteria 5613304
171 2857458447 2857453340 Bacteria 8090534
172 2857465001 2857460504 Bacteria 5194327
173 2857470216 2857465823 Bacteria 6772595
174 2857475697 2857472729 Bacteria 6568124
175 2857582359 2857581216 Bacteria 5522813
176 2857591596 2857591370 Bacteria 6569758
177 2860840085 2860837431 Bacteria 4202080
178 2864734006 2864733723 Bacteria 6770668
179 2864999386 2864997549 Bacteria 5139696
180 2865003315 2865002811 Bacteria 6333767
181 2881641255 2881636855 Bacteria 5205297
182 2881644366 2881644220 Bacteria 5302661
183 2885527098 2885526491 Bacteria 7164189
184 2888582784 2888578766 Bacteria 6743310
185 2889044651 2889042446 Bacteria 7618936
186 2889055006 2889049205 Bacteria 7524325
187 2889279274 2889276214 Bacteria 5979355
188 2889297612 2889295896 Bacteria 4704906
189 2898909994 2898907183 Bacteria 4067722
190 2904114677 2904113452 Bacteria 7796941
191 2904165621 2904162308 Bacteria 7086713
192 2904491537 2904490793 Bacteria 7046938
193 2904524516 2904524088 Bacteria 5887454
194 2904596614 2904595352 Bacteria 6124848
195 2904757769 2904755435 Bacteria 7986759
196 2907204035 2907202186 Bacteria 6632024
197 2915600927 2915597211 Bacteria 6475886
198 2915607177 2915606848 Bacteria 6032732
199 2919146907 2919143609 Bacteria 6219228
200 2919160795 2919160200 Bacteria 6929020
201 2919415410 2919414237 Bacteria 5429133
202 2919432563 2919425241 Bacteria 8055701
203 2919518811 2919517244 Bacteria 5858162
204 2919723177 2919720352 Bacteria 5986006
205 2925328679 2925326138 Bacteria 9652120
206 2928096295 2928093941 Bacteria 5965005
207 2929006333 2929004312 Bacteria 5678476
208 2929186072 2929183550 Bacteria 6377511
209 2929208475 2929206907 Bacteria 5918291
210 2929237902 2929233124 Bacteria 5948380
211 2931388087 2931384279 Bacteria 7299545
212 2936367344 2936361878 Bacteria 5632809
213 2938654956 2938649242 Bacteria 7118381
214 2938922093 2938917290 Bacteria 5914775
215 2939681544 2939679117 Bacteria 6921672
216 2939705101 2939702853 Bacteria 5139229
217 2945993308 2945991243 Bacteria 7008369
218 2946056061 2946053406 Bacteria 6978655
219 2947430987 2947426588 Bacteria 5357194
220 2956902000 2956897341 Bacteria 5447711
221 2960319917 2960319331 Bacteria 5502575
222 2960380875 2960375949 Bacteria 5361395
223 2962293359 2962290636 Bacteria 4072939
224 2964378338 2964375228 Bacteria 4909004
225 2965765641 2965761152 Bacteria 5806513
226 2968563476 2968558590 Bacteria 6956864
227 2969139370 2969136845 Bacteria 3923176
228 2969767338 2969765954 Bacteria 4216713
229 2969773350 2969770375 Bacteria 4271280
230 2971404572 2971403814 Bacteria 7370929
231 2971416804 2971410472 Bacteria 8311090
232 2971512782 2971511577 Bacteria 5404012
233 2977256626 2977254563 Bacteria 4828420
234 2979087888 2979083700 Bacteria 5894929
235 2980128921 2980125574 Bacteria 5567337
236 2980181632 2980176882 Bacteria 5397533
237 2980183639 2980182181 Bacteria 9454109
238 2980495124 2980492589 Bacteria 4072961
239 2981286089 2981284811 Bacteria 4641497
240 2981291040 2981289755 Bacteria 4641509
241 2981981737 2981980479 Bacteria 4641628
242 2981986634 2981985349 Bacteria 4641497
243 2988231675 2988225383 Bacteria 7221625
244 2990277495 2990275345 Bacteria 4887158
245 2996635386 2996632988 Bacteria 6921523
246 3001268345 3001267043 Bacteria 4823521
247 3001897815 3001892409 Bacteria 6328293
248 3006826909 3006826541 Bacteria 4678913
249 3006861090 3006858327 Bacteria 4317835
250 3006881591 3006879489 Bacteria 4064221
251 3006975830 3006973921 Bacteria 4423788
252 3006981801 3006978542 Bacteria 5328100
253 3006988990 3006988479 Bacteria 4767936
254 648169671 648028048 Bacteria 5394884
255 8022624132 8022621104 Bacteria 5241040
256 8022654249 8022653035 Bacteria 4035078
257 8022796824 8022792930 Bacteria 5693794
258 8022898126 8022893055 Bacteria 5300455
259 8022917307 8022914991 Bacteria 5584517
260 8022949791 8022948649 Bacteria 5366783
261 8023443050 8023438354 Bacteria 5779374
262 8023445095 8023444577 Bacteria 5661597
263 8054281274 8054280661 Bacteria 4232245
264 8054467776 8054465665 Bacteria 7323556
265 8054797597 8054795415 Bacteria 9785225
266 8055637378 8055632911 Bacteria 5283357
267 8056537965 8056533031 Bacteria 8964429
268 8057473643 8057473075 Bacteria 5892720
269 8057476093 8057473075 Bacteria 5892720
270 8057586665 8057582654 Bacteria 5218944
271 8057733988 8057733483 Bacteria 6578323
272 8057980506 8057977335 Bacteria 5694872
273 Ga0496122_0005414
274 JGI25159J45721_1006098
275 JGI25159J45721_1008951
276 JGI25151J46595_10011693
277 JGI25151J46595_10015506
278 JGI25151J46595_10017891
279 JGI25151J46595_10019015
280 rootH1_10016889
281 rootH2_10205771
282 rootL2_10054182
283 rootH1_10284303
284 Ga0055532_1001124
285 Ga0055532_1002927
286 Ga0055535_1002206
287 Ga0055528_1001480
288 Ga0055541_1001675
289 Ga0070670_100030917
290 Ga0105251_10014018
291 Ga0105244_10003507
292 Ga0105244_10020152
293 Ga0105244_10026744
294 Ga0105244_10045911
295 Ga0105250_10001097
296 Ga0105250_10013318
297 Ga0105250_10016864
298 Ga0105247_10004089
299 Ga0105243_10003175
300 Ga0105242_10002613
301 Ga0105246_10001703
302 Ga0105246_10009273
303 Ga0105246_10016989
304 Ga0157378_10014006
305 Ga0157377_10039994
306 Ga0209784_100072
307 Ga0209566_100022
308 Ga0209566_100069
309 Ga0209566_101877
310 Ga0209147_100139
311 Ga0209147_100253
312 Ga0209258_101960
313 Ga0209673_1004835
314 Ga0209130_1000808
315 Ga0209130_1003031
316 Ga0209130_1013009
317 Ga0209025_1000547
318 Ga0209025_1000587
319 Ga0209025_1002478
320 Ga0209025_1002818
321 Ga0209025_1007937
322 Ga0209025_1009524
323 Ga0209025_1011612
324 Ga0209025_1033564
325 Ga0207696_1000701
326 Ga0207696_1006083
327 Ga0207696_1016133
328 Ga0207655_1005886
329 Ga0207655_1025313
330 Ga0207713_1001286
331 Ga0207650_10072805
332 Ga0207709_10025852
333 Ga0237817_10022
334 Ga0237817_10251
335 Ga0307408_100021659
336 Ga0307408_100040111
337 Ga0307405_10023197
338 Ga0307409_100036375
339 Ga0395899_0026736
340 Ga0237819_00050
341 Ga0237819_02795
342 Ga0439436_0001172
343 Ga0439439_0003996
344 Ga0439449_0003350
345 Ga0466969_0015824
346 Ga0466959_0002603
347 Ga0466967_0000025
348 Ga0495584_0005227
349 Ga0495660_0028054
350 Ga0496100_0000422
351 Ga0496101_0016765
352 Ga0496102_0005272
353 Ga0496104_0000268
354 Ga0496105_0005472
355 Ga0496107_0005001
356 Ga0496108_0000637
357 Ga0496109_0000538
358 Ga0496110_0000661
359 Ga0496110_0008402
360 Ga0496110_0037093
361 Ga0496111_0001449
362 Ga0496112_0000457
363 Ga0496113_0003092
364 Ga0496116_0006639
365 Ga0496116_0010003
366 Ga0496117_0021025
367 Ga0496118_0048346
368 Ga0496119_0000742
369 Ga0496119_0015064
370 Ga0496119_0027245
371 Ga0496120_0000638
372 Ga0496120_0026426
373 Ga0496121_0021271
374 Ga0496121_0106045
375 Ga0496122_0021621
376 Ga0496122_0023673
377 Ga0496122_0032030
378 Ga0496122_0076161
379 Ga0496123_0006905
380 Ga0496123_0030513
381 Ga0496124_0000233
382 Ga0496124_0000432
383 Ga0496125_0000968
384 Ga0496125_0003603
385 Ga0496125_0003693
386 Ga0496125_0018517
387 Ga0496126_0000633
388 Ga0496126_0001632
389 Ga0496126_0008097
390 Ga0496126_0014852
391 2511179847
392 2512639673
393 2512731506
394 2524190752
395 2540607394
396 2550905010
397 2553393411
398 2556065335
399 2563926417
400 2571527294
401 2573037844
402 2578336549
403 2580933079
404 2587738926
405 2595316057
406 2601637427
407 2621274762
408 2644427430
409 2644708197
410 2644712500
411 2644715828
412 2644724301
413 2672336922
414 2673819399
415 2685152203
416 2698320960
417 2705996142
418 2712197722
419 2721507363
420 2723603312
421 2728534121
422 2730139344
423 2738813845
424 2739154594
425 2739208034
426 2739230337
427 2745168124
428 2753808330
429 2802436137
430 2808869391
431 2809055923
432 2816862623
433 2817480739
434 2817617975
435 2819584418
436 2819673260
437 2819709300
438 2821113726
439 2831905619
440 2842684458
441 2842884454
442 2849142480
443 2857458447
444 2857465001
445 2857470216
446 2857475697
447 2857582359
448 2857591596
449 2860840085
450 2864734006
451 2864999386
452 2865003315
453 2881641255
454 2881644366
455 2885527098
456 2888582784
457 2889044651
458 2889055006
459 2889279274
460 2889297612
461 2898909994
462 2904114677
463 2904165621
464 2904491537
465 2904524516
466 2904596614
467 2904757769
468 2907204035
469 2915600927
470 2915607177
471 2919146907
472 2919160795
473 2919415410
474 2919432563
475 2919518811
476 2919723177
477 2925328679
478 2928096295
479 2929006333
480 2929186072
481 2929208475
482 2929237902
483 2931388087
484 2936367344
485 2938654956
486 2938922093
487 2939681544
488 2939705101
489 2945993308
490 2946056061
491 2947430987
492 2956902000
493 2960319917
494 2960380875
495 2962293359
496 2964378338
497 2965765641
498 2968563476
499 2969139370
500 2969767338
501 2969773350
502 2971404572
503 2971416804
504 2971512782
505 2977256626
506 2979087888
507 2980128921
508 2980181632
509 2980183639
510 2980495124
511 2981286089
512 2981291040
513 2981981737
514 2981986634
515 2988231675
516 2990277495
517 2996635386
518 3001268345
519 3001897815
520 3006826909
521 3006861090
522 3006881591
523 3006975830
524 3006981801
525 3006988990
526 648169671
527 8022624132
528 8022654249
529 8022796824
530 8022898126
531 8022917307
532 8022949791
533 8023443050
534 8023445095
535 8054281274
536 8054467776
537 8054797597
538 8055637378
539 8056537965
540 8057473643
541 8057476093
542 8057586665
543 8057733988
544 8057980506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00271

Helicase_C

Helicase conserved C-terminal domain

373

482

0.9

PF00176

SNF2-rel_dom

SNF2-related domain

77

339

0.84

PF04851

ResIII

Type III restriction enzyme, res subunit

71

222

0.84

PF00270

DEAD

DEAD/DEAH box helicase

75

228

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fuk-assembly1.cif.gz_A crystal structure of the carboxy terminal domain of yeast eif4a 0.8952 359 492
2yjt-assembly1.cif.gz_D crystal structure of e. coli dead-box protein srmb bound to regulator of ribonuclease activity a (rraa) 0.8862 360 493
7bbb-assembly1.cif.gz_A solution structure of c-terminal reca and rrm domains of the dead box helicase dbpa 0.842 359 495
2hjv-assembly2.cif.gz_B structure of the second domain (residues 207-368) of the bacillus subtilis yxin protein 0.8377 360 503
7dtj-assembly1.cif.gz_A crystal structure of the reca2 domain of rna helicase cgh-1 in c. elegans 0.8294 360 495
ID Description Score Start End Superfamily
af_F1M7H3_1_117_3.40.50.10810 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Tandem AAA-ATPase domain 0.9117 147 261 3.40.50.10810
af_A0A1D8PTJ0_926_1094_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9065 358 502 3.40.50.300
af_P60240_481_633_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8926 357 498 3.40.50.300
af_Q0D6A4_1_203_3.40.50.10810 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Tandem AAA-ATPase domain 0.8925 84 263 3.40.50.10810
af_F1M7H3_1_117_3.40.50.10810 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Tandem AAA-ATPase domain 0.8896 147 261 3.40.50.10810
ID Description Score Start End GO Terms
AF-A0A2N0QGR1-F1-model_v4 P-loop containing nucleoside triphosphate hydrolase protein 0.87 374 510 GO:0005524
GO:0016787
AF-X0VAX7-F1-model_v4 Helicase C-terminal domain-containing protein 0.8557 360 493 GO:0004386
GO:0016787
AF-A0A2N0QGR1-F1-model_v4 P-loop containing nucleoside triphosphate hydrolase protein 0.8523 374 510 GO:0005524
GO:0016787
AF-A0A6G1RCM3-F1-model_v4 Chromodomain helicase DNA binding protein 3 0.8502 63 257 GO:0003677
GO:0003682
GO:0005524
GO:0016581
GO:0016887
GO:0042393
GO:0140658
AF-F6Y9Q7-F1-model_v4 RAD54 homolog B 0.843 60 505 GO:0000724
GO:0004386
GO:0005524
GO:0005634
GO:0007131
GO:0008340
GO:0009410
GO:0010212
GO:0015616
GO:0016787

Map