F378550

General Info

Members Datasets Scaffolds Average Seq Length
272 103 544 260

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0064290|Ga0466963_0064290_1157_2005
Length 282
Sequence MGFLSLDGGSFRRQKEPVRGVSLFIGAMLVGVSTASAAADEQPICADRPGKATSACTVPVGHWQIEAGLADWTLQKSGGERDTSLVIGETTFKYGVSDSTDVEVDITPWQRETSRFDGVHDSAGGIGDVRVIAKQRLTSADAPVQVIAMPYVKMPTAPHSLGNGKWEGGLLVPIGYSIPKTPLSIGLTPEVDWVADADGSGHHAAMEQVVSLGWAVSEKLNLSAELWGGWDWDPAGTTRQYSADGAVAYLLTKDVQLDAGADFGLNQATPDVELYGGISVRF

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.74
Rhizosphere 98.9
Stem 0
Stem Tuber 0
Unclassified 15.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0064290 3300044694 Bacteria 2457
2 JGI24741J21665_1011443 3300001915 Bacteria 1551
3 JGI24740J21852_10004133 3300001979 Bacteria 6271
4 JGI24740J21852_10019366 3300001979 Bacteria 2398
5 JGI24739J22299_10003250 3300001989 Bacteria 6198
6 JGI24735J21928_10001276 3300002067 Bacteria 8942
7 JGI24735J21928_10010265 3300002067 Bacteria 2990
8 JGI24735J21928_10038021 3300002067 Unclassified 1409
9 JGI24738J21930_10006262 3300002075 Bacteria 2805
10 rootH1_10074934 3300003323 Unclassified 1557
11 Ga0070658_10002369 3300005327 Bacteria 15811
12 Ga0070658_10015748 3300005327 Bacteria 6046
13 Ga0070658_10015973 3300005327 Bacteria 6005
14 Ga0070658_10263388 3300005327 Unclassified 1464
15 Ga0070683_100002495 3300005329 Bacteria 14656
16 Ga0070683_100011147 3300005329 Bacteria 7755
17 Ga0070683_100049283 3300005329 Bacteria 3895
18 Ga0070683_100387517 3300005329 Bacteria 1332
19 Ga0070666_10001518 3300005335 Bacteria 14090
20 Ga0070666_10015850 3300005335 Bacteria 4815
21 Ga0070680_100011466 3300005336 Bacteria 6858
22 Ga0070682_100001968 3300005337 Bacteria 11453
23 Ga0070682_100015666 3300005337 Bacteria 4396
24 Ga0070660_100002006 3300005339 Bacteria 14045
25 Ga0070660_100002074 3300005339 Bacteria 13845
26 Ga0070660_100065792 3300005339 Bacteria 2821
27 Ga0070660_100152707 3300005339 Bacteria 1857
28 Ga0070660_100227000 3300005339 Unclassified 1519
29 Ga0070660_100246651 3300005339 Bacteria 1456
30 Ga0070691_10334120 3300005341 Unclassified 837
31 Ga0070661_100001131 3300005344 Bacteria 18746
32 Ga0070661_100052575 3300005344 Bacteria 2981
33 Ga0070692_10006497 3300005345 Bacteria 5082
34 Ga0070692_10114973 3300005345 Bacteria 1493
35 Ga0070692_10222036 3300005345 Unclassified 1117
36 Ga0070671_100000802 3300005355 Bacteria 22701
37 Ga0070659_100000165 3300005366 Bacteria 51041
38 Ga0070659_100017597 3300005366 Bacteria 5383
39 Ga0070659_100026993 3300005366 Bacteria 4422
40 Ga0070659_100490195 3300005366 Bacteria 1046
41 Ga0070667_100117971 3300005367 Bacteria 2306
42 Ga0070714_100040847 3300005435 Bacteria 3911
43 Ga0070713_100191717 3300005436 Bacteria 1842
44 Ga0070663_100014761 3300005455 Bacteria 5022
45 Ga0070663_100243911 3300005455 Bacteria 1419
46 Ga0070663_100290543 3300005455 Bacteria 1305
47 Ga0070663_100582699 3300005455 Bacteria 939
48 Ga0070662_100000171 3300005457 Bacteria 37981
49 Ga0070662_100064119 3300005457 Bacteria 2689
50 Ga0070662_100077662 3300005457 Bacteria 2464
51 Ga0070662_100091057 3300005457 Unclassified 2290
52 Ga0070662_100108340 3300005457 Unclassified 2113
53 Ga0070681_10131996 3300005458 Unclassified 2430
54 Ga0070681_10334562 3300005458 Bacteria 1424
55 Ga0070679_100048000 3300005530 Unclassified 4255
56 Ga0070679_100108662 3300005530 Unclassified 2760
57 Ga0070679_100149291 3300005530 Bacteria 2315
58 Ga0070679_100251682 3300005530 Bacteria 1723
59 Ga0070684_100027455 3300005535 Bacteria 4805
60 Ga0070684_100166784 3300005535 Bacteria 1999
61 Ga0070684_100290456 3300005535 Bacteria 1499
62 Ga0068853_100002187 3300005539 Bacteria 14574
63 Ga0068853_100025960 3300005539 Bacteria 4916
64 Ga0068853_100065151 3300005539 Unclassified 3161
65 Ga0068853_100074276 3300005539 Plasmid 2966
66 Ga0068853_100105585 3300005539 Bacteria 2495
67 Ga0068853_100282871 3300005539 Bacteria 1529
68 Ga0068853_100563713 3300005539 Unclassified 1080
69 Ga0070693_100000563 3300005547 Bacteria 16421
70 Ga0070665_100008159 3300005548 Bacteria 10602
71 Ga0068855_100000447 3300005563 Bacteria 51000
72 Ga0068855_100008283 3300005563 Bacteria 12566
73 Ga0068855_100073249 3300005563 Bacteria 3980
74 Ga0070664_100000311 3300005564 Bacteria 35468
75 Ga0070664_100007864 3300005564 Bacteria 8612
76 Ga0070664_100007940 3300005564 Bacteria 8571
77 Ga0070664_100146889 3300005564 Bacteria 2080
78 Ga0070664_100384568 3300005564 Bacteria 1281
79 Ga0068857_100051679 3300005577 Bacteria 3647
80 Ga0068857_100063750 3300005577 Bacteria 3276
81 Ga0068857_100115455 3300005577 Bacteria 2415
82 Ga0068857_100279121 3300005577 Bacteria 1536
83 Ga0068857_100368201 3300005577 Bacteria 1333
84 Ga0068854_100033670 3300005578 Bacteria 3573
85 Ga0068856_100000979 3300005614 Bacteria 30480
86 Ga0068856_100064038 3300005614 Bacteria 3632
87 Ga0068856_100286792 3300005614 Bacteria 1663
88 Ga0068852_100000844 3300005616 Bacteria 20329
89 Ga0068852_100002467 3300005616 Bacteria 12733
90 Ga0068852_100023673 3300005616 Bacteria 4948
91 Ga0068852_100064752 3300005616 Bacteria 3187
92 Ga0068852_100172118 3300005616 Bacteria 2031
93 Ga0068852_100316436 3300005616 Archaea 1514
94 Ga0068851_10007838 3300005834 Bacteria 4918
95 Ga0068863_100234382 3300005841 Bacteria 1771
96 Ga0068871_100097216 3300006358 Bacteria 2461
97 Ga0105240_10029537 3300009093 Bacteria 7140
98 Ga0105241_10133529 3300009174 Bacteria 2012
99 Ga0105248_10000117 3300009177 Bacteria 90169
100 Ga0105237_10128753 3300009545 Bacteria 2526
101 Ga0105237_10513488 3300009545 Bacteria 1205
102 Ga0105238_10058937 3300009551 Bacteria 3848
103 Ga0105238_10194898 3300009551 Bacteria 2002
104 Ga0105238_10323397 3300009551 Bacteria 1528
105 Ga0105239_10264305 3300010375 Bacteria 1934
106 Ga0157373_10037448 3300013100 Bacteria 3477
107 Ga0157373_10068099 3300013100 Bacteria 2516
108 Ga0157373_10267156 3300013100 Bacteria 1211
109 Ga0157373_10320840 3300013100 Unclassified 1102
110 Ga0157371_10004240 3300013102 Bacteria 12603
111 Ga0157371_10026113 3300013102 Bacteria 4248
112 Ga0157371_10081655 3300013102 Bacteria 2289
113 Ga0157371_10146178 3300013102 Bacteria 1685
114 Ga0157371_10177868 3300013102 Bacteria 1521
115 Ga0157371_10220368 3300013102 Bacteria 1362
116 Ga0157370_10230559 3300013104 Unclassified 1714
117 Ga0157370_10266559 3300013104 Bacteria 1582
118 Ga0157369_10000741 3300013105 Bacteria 42087
119 Ga0157369_10017363 3300013105 Bacteria 8089
120 Ga0157369_10513594 3300013105 Unclassified 1239
121 Ga0157369_10848942 3300013105 Unclassified 937
122 Ga0157369_10849232 3300013105 Unclassified 937
123 Ga0157378_10375320 3300013297 Bacteria 1395
124 Ga0157372_10032112 3300013307 Bacteria 5754
125 Ga0157372_10155664 3300013307 Bacteria 2640
126 Ga0157372_10341750 3300013307 Bacteria 1743
127 Ga0157372_10613822 3300013307 Unclassified 1267
128 Ga0163163_10000380 3300014325 Bacteria 42243
129 Ga0157379_10076044 3300014968 Bacteria 3007
130 Ga0207656_10048662 3300025321 Bacteria 1826
131 Ga0207680_10011639 3300025903 Bacteria 4452
132 Ga0207647_10002071 3300025904 Bacteria 15330
133 Ga0207647_10018841 3300025904 Bacteria 4654
134 Ga0207647_10030117 3300025904 Bacteria 3505
135 Ga0207705_10000222 3300025909 Bacteria 56707
136 Ga0207705_10016875 3300025909 Bacteria 5230
137 Ga0207705_10020062 3300025909 Bacteria 4779
138 Ga0207705_10052913 3300025909 Unclassified 2924
139 Ga0207705_10125180 3300025909 Bacteria 1910
140 Ga0207705_10254691 3300025909 Bacteria 1339
141 Ga0207654_10009177 3300025911 Bacteria 5013
142 Ga0207707_10034363 3300025912 Bacteria 4436
143 Ga0207707_10066617 3300025912 Bacteria 3136
144 Ga0207707_10125099 3300025912 Unclassified 2249
145 Ga0207707_10166647 3300025912 Unclassified 1925
146 Ga0207695_10234145 3300025913 Unclassified 1740
147 Ga0207671_10156461 3300025914 Unclassified 1763
148 Ga0207671_10213787 3300025914 Bacteria 1509
149 Ga0207660_10001636 3300025917 Bacteria 15026
150 Ga0207660_10013128 3300025917 Bacteria 5425
151 Ga0207660_10024602 3300025917 Bacteria 4078
152 Ga0207657_10000378 3300025919 Bacteria 47118
153 Ga0207657_10002625 3300025919 Bacteria 19419
154 Ga0207657_10003734 3300025919 Bacteria 16181
155 Ga0207657_10004611 3300025919 Bacteria 14559
156 Ga0207657_10044834 3300025919 Unclassified 3885
157 Ga0207657_10062401 3300025919 Bacteria 3191
158 Ga0207657_10073450 3300025919 Bacteria 2890
159 Ga0207649_10000862 3300025920 Bacteria 19306
160 Ga0207649_10032666 3300025920 Bacteria 3104
161 Ga0207649_10064715 3300025920 Bacteria 2313
162 Ga0207652_10104061 3300025921 Bacteria 2510
163 Ga0207694_10348390 3300025924 Unclassified 1226
164 Ga0207650_10287192 3300025925 Unclassified 1341
165 Ga0207664_10022705 3300025929 Bacteria 4690
166 Ga0207644_10005855 3300025931 Bacteria 8011
167 Ga0207690_10000509 3300025932 Bacteria 25193
168 Ga0207690_10038905 3300025932 Bacteria 3099
169 Ga0207690_10060512 3300025932 Bacteria 2570
170 Ga0207690_10151557 3300025932 Bacteria 1719
171 Ga0207690_10413962 3300025932 Bacteria 1077
172 Ga0207706_10000513 3300025933 Bacteria 41181
173 Ga0207706_10001823 3300025933 Bacteria 20928
174 Ga0207706_10009118 3300025933 Bacteria 9123
175 Ga0207706_10082766 3300025933 Bacteria 2821
176 Ga0207706_10205366 3300025933 Unclassified 1728
177 Ga0207711_10000558 3300025941 Bacteria 37953
178 Ga0207661_10001899 3300025944 Bacteria 14341
179 Ga0207661_10017195 3300025944 Bacteria 5347
180 Ga0207661_10021700 3300025944 Bacteria 4816
181 Ga0207661_10097114 3300025944 Bacteria 2466
182 Ga0207661_10188830 3300025944 Bacteria 1805
183 Ga0207661_10560936 3300025944 Bacteria 1047
184 Ga0207679_10000460 3300025945 Bacteria 28726
185 Ga0207679_10008246 3300025945 Bacteria 6634
186 Ga0207679_10011577 3300025945 Bacteria 5722
187 Ga0207679_10096477 3300025945 Bacteria 2300
188 Ga0207667_10003620 3300025949 Bacteria 19067
189 Ga0207667_10086604 3300025949 Bacteria 3242
190 Ga0207667_10089851 3300025949 Bacteria 3174
191 Ga0207667_10325506 3300025949 Bacteria 1569
192 Ga0207667_10352724 3300025949 Bacteria 1500
193 Ga0207651_10247316 3300025960 Bacteria 1457
194 Ga0207640_10027129 3300025981 Bacteria 3487
195 Ga0207640_10119137 3300025981 Bacteria 1887
196 Ga0207658_10033638 3300025986 Bacteria 3658
197 Ga0207639_10000219 3300026041 Bacteria 42731
198 Ga0207639_10001416 3300026041 Bacteria 16213
199 Ga0207639_10009619 3300026041 Bacteria 6677
200 Ga0207639_10163297 3300026041 Unclassified 1879
201 Ga0207639_10210474 3300026041 Unclassified 1673
202 Ga0207639_10237826 3300026041 Bacteria 1582
203 Ga0207678_10001723 3300026067 Bacteria 20030
204 Ga0207678_10003821 3300026067 Bacteria 13548
205 Ga0207678_10038165 3300026067 Bacteria 4175
206 Ga0207678_10167279 3300026067 Bacteria 1877
207 Ga0207678_10353217 3300026067 Unclassified 1268
208 Ga0207702_10001066 3300026078 Bacteria 28071
209 Ga0207702_10217219 3300026078 Unclassified 1780
210 Ga0207702_10269397 3300026078 Bacteria 1606
211 Ga0207674_10002500 3300026116 Bacteria 23190
212 Ga0207674_10009588 3300026116 Bacteria 11045
213 Ga0207674_10011701 3300026116 Bacteria 9849
214 Ga0207674_10013696 3300026116 Bacteria 8981
215 Ga0207674_10063576 3300026116 Bacteria 3725
216 Ga0207674_10391928 3300026116 Unclassified 1342
217 Ga0207698_10000675 3300026142 Bacteria 19796
218 Ga0207698_10006588 3300026142 Bacteria 7261
219 Ga0207698_10038728 3300026142 Bacteria 3525
220 Ga0207698_10048087 3300026142 Unclassified 3236
221 Ga0207698_10049550 3300026142 Bacteria 3198
222 Ga0268266_10003320 3300028379 Bacteria 16145
223 Ga0307415_100353393 3300032126 Bacteria 1238
224 Ga0373956_0035243 3300035119 Bacteria 2206
225 Ga0373955_0003258 3300035172 Bacteria 7116
226 Ga0373931_0143293 3300035691 Bacteria 1386
227 Ga0373935_0011132 3300035692 Bacteria 5400
228 Ga0373933_0033435 3300035724 Bacteria 2992
229 Ga0373937_0001166 3300036401 Bacteria 22077
230 Ga0395899_0059084 3300037312 Bacteria 2826
231 Ga0395899_0117547 3300037312 Bacteria 1907
232 Ga0395899_0218412 3300037312 Bacteria 1321
233 Ga0395900_0008876 3300037418 Bacteria 10323
234 Ga0395900_0019732 3300037418 Bacteria 6871
235 Ga0395900_0352328 3300037418 Unclassified 1445
236 Ga0395900_0542400 3300037418 Unclassified 1109
237 Ga0395898_0015860 3300037466 Bacteria 7720
238 Ga0395898_0043925 3300037466 Bacteria 4402
239 Ga0395905_0002975 3300037471 Bacteria 18407
240 Ga0395905_0009518 3300037471 Bacteria 9491
241 Ga0395905_0070352 3300037471 Bacteria 3278
242 Ga0395905_0078900 3300037471 Bacteria 3085
243 Ga0395905_0395576 3300037471 Bacteria 1276
244 Ga0395905_0495398 3300037471 Bacteria 1122
245 Ga0395905_0501935 3300037471 Unclassified 1113
246 Ga0395905_0574276 3300037471 Bacteria 1029
247 Ga0395901_0000418 3300038443 Bacteria 50129
248 Ga0395901_0011893 3300038443 Bacteria 8827
249 Ga0395901_0018605 3300038443 Bacteria 7095
250 Ga0395901_0137594 3300038443 Bacteria 2567
251 Ga0395901_0159935 3300038443 Unclassified 2365
252 Ga0395901_0197424 3300038443 Bacteria 2109
253 Ga0395901_0640267 3300038443 Bacteria 1068
254 Ga0395901_0748652 3300038443 Unclassified 970
255 Ga0466963_0014289 3300044694 Bacteria 4892
256 Ga0466963_0079178 3300044694 Bacteria 2223
257 Ga0466963_0133949 3300044694 Bacteria 1713
258 Ga0466963_0584555 3300044694 Bacteria 789
259 Ga0466957_0011185 3300044842 Bacteria 5169
260 Ga0466957_0276191 3300044842 Bacteria 1123
261 Ga0466960_0124542 3300044901 Unclassified 1353
262 Ga0466959_0252071 3300045049 Bacteria 1217
263 Ga0466958_0004937 3300045836 Bacteria 7112
264 Ga0466967_0023831 3300045976 Bacteria 5022
265 Ga0466967_0054994 3300045976 Bacteria 3505
266 Ga0466967_0067838 3300045976 Bacteria 3183
267 Ga0466967_0092929 3300045976 Bacteria 2744
268 Ga0466967_0173409 3300045976 Bacteria 2030
269 Ga0496111_0063152 3300048914 Bacteria 2686
270 Ga0496111_0134142 3300048914 Bacteria 1833
271 Ga0501074_0063008 3300049590 Bacteria 2671
272 Ga0466962_0084386 3300061719 Unclassified 1520
273 Ga0466963_0064290
274 JGI24741J21665_1011443
275 JGI24740J21852_10004133
276 JGI24740J21852_10019366
277 JGI24739J22299_10003250
278 JGI24735J21928_10001276
279 JGI24735J21928_10010265
280 JGI24735J21928_10038021
281 JGI24738J21930_10006262
282 rootH1_10074934
283 Ga0070658_10002369
284 Ga0070658_10015748
285 Ga0070658_10015973
286 Ga0070658_10263388
287 Ga0070683_100002495
288 Ga0070683_100011147
289 Ga0070683_100049283
290 Ga0070683_100387517
291 Ga0070666_10001518
292 Ga0070666_10015850
293 Ga0070680_100011466
294 Ga0070682_100001968
295 Ga0070682_100015666
296 Ga0070660_100002006
297 Ga0070660_100002074
298 Ga0070660_100065792
299 Ga0070660_100152707
300 Ga0070660_100227000
301 Ga0070660_100246651
302 Ga0070691_10334120
303 Ga0070661_100001131
304 Ga0070661_100052575
305 Ga0070692_10006497
306 Ga0070692_10114973
307 Ga0070692_10222036
308 Ga0070671_100000802
309 Ga0070659_100000165
310 Ga0070659_100017597
311 Ga0070659_100026993
312 Ga0070659_100490195
313 Ga0070667_100117971
314 Ga0070714_100040847
315 Ga0070713_100191717
316 Ga0070663_100014761
317 Ga0070663_100243911
318 Ga0070663_100290543
319 Ga0070663_100582699
320 Ga0070662_100000171
321 Ga0070662_100064119
322 Ga0070662_100077662
323 Ga0070662_100091057
324 Ga0070662_100108340
325 Ga0070681_10131996
326 Ga0070681_10334562
327 Ga0070679_100048000
328 Ga0070679_100108662
329 Ga0070679_100149291
330 Ga0070679_100251682
331 Ga0070684_100027455
332 Ga0070684_100166784
333 Ga0070684_100290456
334 Ga0068853_100002187
335 Ga0068853_100025960
336 Ga0068853_100065151
337 Ga0068853_100074276
338 Ga0068853_100105585
339 Ga0068853_100282871
340 Ga0068853_100563713
341 Ga0070693_100000563
342 Ga0070665_100008159
343 Ga0068855_100000447
344 Ga0068855_100008283
345 Ga0068855_100073249
346 Ga0070664_100000311
347 Ga0070664_100007864
348 Ga0070664_100007940
349 Ga0070664_100146889
350 Ga0070664_100384568
351 Ga0068857_100051679
352 Ga0068857_100063750
353 Ga0068857_100115455
354 Ga0068857_100279121
355 Ga0068857_100368201
356 Ga0068854_100033670
357 Ga0068856_100000979
358 Ga0068856_100064038
359 Ga0068856_100286792
360 Ga0068852_100000844
361 Ga0068852_100002467
362 Ga0068852_100023673
363 Ga0068852_100064752
364 Ga0068852_100172118
365 Ga0068852_100316436
366 Ga0068851_10007838
367 Ga0068863_100234382
368 Ga0068871_100097216
369 Ga0105240_10029537
370 Ga0105241_10133529
371 Ga0105248_10000117
372 Ga0105237_10128753
373 Ga0105237_10513488
374 Ga0105238_10058937
375 Ga0105238_10194898
376 Ga0105238_10323397
377 Ga0105239_10264305
378 Ga0157373_10037448
379 Ga0157373_10068099
380 Ga0157373_10267156
381 Ga0157373_10320840
382 Ga0157371_10004240
383 Ga0157371_10026113
384 Ga0157371_10081655
385 Ga0157371_10146178
386 Ga0157371_10177868
387 Ga0157371_10220368
388 Ga0157370_10230559
389 Ga0157370_10266559
390 Ga0157369_10000741
391 Ga0157369_10017363
392 Ga0157369_10513594
393 Ga0157369_10848942
394 Ga0157369_10849232
395 Ga0157378_10375320
396 Ga0157372_10032112
397 Ga0157372_10155664
398 Ga0157372_10341750
399 Ga0157372_10613822
400 Ga0163163_10000380
401 Ga0157379_10076044
402 Ga0207656_10048662
403 Ga0207680_10011639
404 Ga0207647_10002071
405 Ga0207647_10018841
406 Ga0207647_10030117
407 Ga0207705_10000222
408 Ga0207705_10016875
409 Ga0207705_10020062
410 Ga0207705_10052913
411 Ga0207705_10125180
412 Ga0207705_10254691
413 Ga0207654_10009177
414 Ga0207707_10034363
415 Ga0207707_10066617
416 Ga0207707_10125099
417 Ga0207707_10166647
418 Ga0207695_10234145
419 Ga0207671_10156461
420 Ga0207671_10213787
421 Ga0207660_10001636
422 Ga0207660_10013128
423 Ga0207660_10024602
424 Ga0207657_10000378
425 Ga0207657_10002625
426 Ga0207657_10003734
427 Ga0207657_10004611
428 Ga0207657_10044834
429 Ga0207657_10062401
430 Ga0207657_10073450
431 Ga0207649_10000862
432 Ga0207649_10032666
433 Ga0207649_10064715
434 Ga0207652_10104061
435 Ga0207694_10348390
436 Ga0207650_10287192
437 Ga0207664_10022705
438 Ga0207644_10005855
439 Ga0207690_10000509
440 Ga0207690_10038905
441 Ga0207690_10060512
442 Ga0207690_10151557
443 Ga0207690_10413962
444 Ga0207706_10000513
445 Ga0207706_10001823
446 Ga0207706_10009118
447 Ga0207706_10082766
448 Ga0207706_10205366
449 Ga0207711_10000558
450 Ga0207661_10001899
451 Ga0207661_10017195
452 Ga0207661_10021700
453 Ga0207661_10097114
454 Ga0207661_10188830
455 Ga0207661_10560936
456 Ga0207679_10000460
457 Ga0207679_10008246
458 Ga0207679_10011577
459 Ga0207679_10096477
460 Ga0207667_10003620
461 Ga0207667_10086604
462 Ga0207667_10089851
463 Ga0207667_10325506
464 Ga0207667_10352724
465 Ga0207651_10247316
466 Ga0207640_10027129
467 Ga0207640_10119137
468 Ga0207658_10033638
469 Ga0207639_10000219
470 Ga0207639_10001416
471 Ga0207639_10009619
472 Ga0207639_10163297
473 Ga0207639_10210474
474 Ga0207639_10237826
475 Ga0207678_10001723
476 Ga0207678_10003821
477 Ga0207678_10038165
478 Ga0207678_10167279
479 Ga0207678_10353217
480 Ga0207702_10001066
481 Ga0207702_10217219
482 Ga0207702_10269397
483 Ga0207674_10002500
484 Ga0207674_10009588
485 Ga0207674_10011701
486 Ga0207674_10013696
487 Ga0207674_10063576
488 Ga0207674_10391928
489 Ga0207698_10000675
490 Ga0207698_10006588
491 Ga0207698_10038728
492 Ga0207698_10048087
493 Ga0207698_10049550
494 Ga0268266_10003320
495 Ga0307415_100353393
496 Ga0373956_0035243
497 Ga0373955_0003258
498 Ga0373931_0143293
499 Ga0373935_0011132
500 Ga0373933_0033435
501 Ga0373937_0001166
502 Ga0395899_0059084
503 Ga0395899_0117547
504 Ga0395899_0218412
505 Ga0395900_0008876
506 Ga0395900_0019732
507 Ga0395900_0352328
508 Ga0395900_0542400
509 Ga0395898_0015860
510 Ga0395898_0043925
511 Ga0395905_0002975
512 Ga0395905_0009518
513 Ga0395905_0070352
514 Ga0395905_0078900
515 Ga0395905_0395576
516 Ga0395905_0495398
517 Ga0395905_0501935
518 Ga0395905_0574276
519 Ga0395901_0000418
520 Ga0395901_0011893
521 Ga0395901_0018605
522 Ga0395901_0137594
523 Ga0395901_0159935
524 Ga0395901_0197424
525 Ga0395901_0640267
526 Ga0395901_0748652
527 Ga0466963_0014289
528 Ga0466963_0079178
529 Ga0466963_0133949
530 Ga0466963_0584555
531 Ga0466957_0011185
532 Ga0466957_0276191
533 Ga0466960_0124542
534 Ga0466959_0252071
535 Ga0466958_0004937
536 Ga0466967_0023831
537 Ga0466967_0054994
538 Ga0466967_0067838
539 Ga0466967_0092929
540 Ga0466967_0173409
541 Ga0496111_0063152
542 Ga0496111_0134142
543 Ga0501074_0063008
544 Ga0466962_0084386

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13557

Phenol_MetA_deg

Putative MetA-pathway of phenol degradation

46

282

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o65-assembly1.cif.gz_A crystal structure of the pseudomonas functional amyloid secretion protein fapf 0.8404 29 248
5o65-assembly1.cif.gz_C crystal structure of the pseudomonas functional amyloid secretion protein fapf 0.8398 29 248
5o68-assembly3.cif.gz_G crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.8255 27 248
5o68-assembly1.cif.gz_B crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.8224 29 248
5o67-assembly1.cif.gz_A crystal structure of the fapf polypeptide transporter - f103a mutant 0.8202 25 248
ID Description Score Start End Superfamily
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.7543 28 248 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.7421 28 248 2.40.160.40
af_Q6H643_136_297_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6808 206 248 3.10.129.10
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6728 30 246 2.40.160.40
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6641 30 246 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A3R9X604-F1-model_v4 Transporter 0.9853 10 248
AF-A0A841L8A4-F1-model_v4 Transporter 0.9836 10 248
AF-A0A7H0GAX2-F1-model_v4 deleted 0.9817 10 248
AF-A0A7V9S910-F1-model_v4 Transporter 0.9799 10 248
AF-A0A2T5KXY1-F1-model_v4 Outer membrane putative beta-barrel porin/alpha-amylase 0.9756 10 248

Map