F378499

General Info

Members Datasets Scaffolds Average Seq Length
272 166 544 118

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0056479|Ga0373925_0056479_1780_2130
Length 116
Sequence MVLAIVDDLMFASKIKTAARQLGITVSFARSSGTAMAAIRDNTPTLVILDLNNPRTDPLGTVAAIKGDPAIRTVGYASHVQTDVIDAARLAGVDEVMARSAFTARLPEILAAARSG

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
164 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.21
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 21.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0056479 3300037068 Bacteria 2941
2 Ga0065704_10248077 3300005289 Bacteria 997
3 Ga0070676_10151284 3300005328 Bacteria 1486
4 Ga0070690_100359827 3300005330 Bacteria 1058
5 Ga0070666_10102690 3300005335 Bacteria 1972
6 Ga0070666_10190935 3300005335 Unclassified 1439
7 Ga0068868_101645012 3300005338 Bacteria 604
8 Ga0070660_101175389 3300005339 Bacteria 650
9 Ga0070689_101363960 3300005340 Bacteria 640
10 Ga0070668_100599063 3300005347 Unclassified 964
11 Ga0070669_100005781 3300005353 Bacteria 8917
12 Ga0070669_100047560 3300005353 Bacteria 3129
13 Ga0070669_100750588 3300005353 Unclassified 827
14 Ga0070675_100001310 3300005354 Bacteria 18174
15 Ga0070675_100014905 3300005354 Bacteria 6138
16 Ga0070671_100231323 3300005355 Bacteria 1569
17 Ga0070671_101419957 3300005355 Bacteria 613
18 Ga0070674_100223122 3300005356 Bacteria 1467
19 Ga0070674_100392137 3300005356 Bacteria 1132
20 Ga0070673_100215487 3300005364 Bacteria 1660
21 Ga0070673_100415251 3300005364 Bacteria 1206
22 Ga0070673_101650603 3300005364 Unclassified 606
23 Ga0070688_100015484 3300005365 Bacteria 4341
24 Ga0070688_100343180 3300005365 Bacteria 1091
25 Ga0070659_100056452 3300005366 Bacteria 3096
26 Ga0070667_100002707 3300005367 Bacteria 15346
27 Ga0070713_100215624 3300005436 Bacteria 1740
28 Ga0070711_101303117 3300005439 Bacteria 630
29 Ga0070700_100073938 3300005441 Bacteria 2182
30 Ga0070700_100287016 3300005441 Bacteria 1195
31 Ga0070700_100602285 3300005441 Bacteria 861
32 Ga0070700_101223153 3300005441 Bacteria 628
33 Ga0070694_101180921 3300005444 Bacteria 641
34 Ga0070708_101092935 3300005445 Unclassified 747
35 Ga0070678_100490881 3300005456 Bacteria 1082
36 Ga0070678_100991921 3300005456 Unclassified 772
37 Ga0070662_100104211 3300005457 Bacteria 2152
38 Ga0070662_100130931 3300005457 Bacteria 1934
39 Ga0070685_10055721 3300005466 Bacteria 2297
40 Ga0070707_100800840 3300005468 Bacteria 906
41 Ga0070698_100656522 3300005471 Bacteria 990
42 Ga0070699_100018361 3300005518 Bacteria 6009
43 Ga0070699_100365024 3300005518 Bacteria 1302
44 Ga0070697_100456831 3300005536 Bacteria 1113
45 Ga0070697_100684818 3300005536 Bacteria 904
46 Ga0068853_102480453 3300005539 Unclassified 502
47 Ga0070672_100090214 3300005543 Bacteria 2471
48 Ga0070672_101380145 3300005543 Bacteria 630
49 Ga0070672_102067714 3300005543 Bacteria 513
50 Ga0070686_100099269 3300005544 Bacteria 1964
51 Ga0070686_100581981 3300005544 Unclassified 880
52 Ga0070695_100303355 3300005545 Bacteria 1181
53 Ga0070695_100366007 3300005545 Bacteria 1084
54 Ga0070695_100591730 3300005545 Bacteria 870
55 Ga0070695_100669275 3300005545 Bacteria 821
56 Ga0070665_100260932 3300005548 Bacteria 1734
57 Ga0070704_100599793 3300005549 Bacteria 968
58 Ga0070704_100736889 3300005549 Unclassified 876
59 Ga0070664_101515538 3300005564 Unclassified 635
60 Ga0068857_100514549 3300005577 Bacteria 1124
61 Ga0068854_101538944 3300005578 Bacteria 605
62 Ga0068852_101968197 3300005616 Bacteria 606
63 Ga0068859_100315365 3300005617 Bacteria 1657
64 Ga0068859_100394828 3300005617 Bacteria 1479
65 Ga0068859_101853827 3300005617 Bacteria 666
66 Ga0068866_10072608 3300005718 Unclassified 1824
67 Ga0068866_10183820 3300005718 Unclassified 1237
68 Ga0068861_100015496 3300005719 Bacteria 5374
69 Ga0068861_100444036 3300005719 Bacteria 1161
70 Ga0068861_100849304 3300005719 Bacteria 861
71 Ga0068851_10102680 3300005834 Bacteria 1519
72 Ga0068863_100075155 3300005841 Bacteria 3197
73 Ga0068858_100319508 3300005842 Bacteria 1483
74 Ga0068858_100587769 3300005842 Unclassified 1079
75 Ga0068860_100069894 3300005843 Bacteria 3338
76 Ga0068862_100084685 3300005844 Bacteria 2755
77 Ga0070716_100277855 3300006173 Bacteria 1154
78 Ga0097621_100487479 3300006237 Unclassified 1115
79 Ga0097621_100687965 3300006237 Bacteria 941
80 Ga0068871_100164992 3300006358 Bacteria 1896
81 Ga0068871_100518847 3300006358 Bacteria 1076
82 Ga0075428_100057088 3300006844 Bacteria 4274
83 Ga0075428_100404490 3300006844 Bacteria 1463
84 Ga0075428_100410724 3300006844 Bacteria 1451
85 Ga0075430_101000855 3300006846 Unclassified 689
86 Ga0075431_102084622 3300006847 Bacteria 522
87 Ga0075433_10004006 3300006852 Bacteria 11400
88 Ga0075433_10195229 3300006852 Bacteria 1800
89 Ga0075434_100008420 3300006871 Bacteria 9592
90 Ga0075434_100084785 3300006871 Bacteria 3167
91 Ga0075434_100257108 3300006871 Bacteria 1765
92 Ga0075434_100384685 3300006871 Bacteria 1424
93 Ga0075434_100918105 3300006871 Unclassified 890
94 Ga0075436_100010391 3300006914 Bacteria 6379
95 Ga0075436_100081807 3300006914 Bacteria 2239
96 Ga0097620_100315344 3300006931 Bacteria 1657
97 Ga0097620_100394840 3300006931 Bacteria 1479
98 Ga0097620_101853804 3300006931 Bacteria 666
99 Ga0075435_100025044 3300007076 Bacteria 4640
100 Ga0075435_100094307 3300007076 Bacteria 2474
101 Ga0075435_100129460 3300007076 Unclassified 2111
102 Ga0111539_10002429 3300009094 Bacteria 24773
103 Ga0111539_10045883 3300009094 Bacteria 5230
104 Ga0111539_10272282 3300009094 Bacteria 1971
105 Ga0111539_10907612 3300009094 Bacteria 1025
106 Ga0111539_11259335 3300009094 Unclassified 858
107 Ga0111539_12511522 3300009094 Unclassified 598
108 Ga0105245_10493001 3300009098 Bacteria 1240
109 Ga0105245_10947212 3300009098 Bacteria 904
110 Ga0105247_11835972 3300009101 Bacteria 505
111 Ga0114129_10000772 3300009147 Bacteria 40849
112 Ga0114129_10019712 3300009147 Bacteria 9601
113 Ga0114129_10025101 3300009147 Bacteria 8447
114 Ga0114129_10196654 3300009147 Unclassified 2734
115 Ga0105243_10155844 3300009148 Bacteria 1964
116 Ga0105243_10845481 3300009148 Bacteria 906
117 Ga0105242_10389581 3300009176 Unclassified 1297
118 Ga0105242_10786991 3300009176 Unclassified 940
119 Ga0105242_11027961 3300009176 Bacteria 834
120 Ga0105248_10009184 3300009177 Bacteria 10875
121 Ga0105248_10272261 3300009177 Bacteria 1907
122 Ga0105237_11423357 3300009545 Unclassified 700
123 Ga0105249_10352405 3300009553 Bacteria 1491
124 Ga0105249_10449526 3300009553 Unclassified 1327
125 Ga0105249_10999369 3300009553 Unclassified 905
126 Ga0157374_10582146 3300013296 Bacteria 1128
127 Ga0157378_11948930 3300013297 Bacteria 637
128 Ga0163162_10029473 3300013306 Bacteria 5431
129 Ga0163162_13294731 3300013306 Bacteria 517
130 Ga0157375_10019187 3300013308 Bacteria 6213
131 Ga0157375_11033285 3300013308 Unclassified 960
132 Ga0157375_13211194 3300013308 Unclassified 545
133 Ga0163163_10135827 3300014325 Bacteria 2501
134 Ga0163163_11322477 3300014325 Unclassified 783
135 Ga0157380_10031155 3300014326 Bacteria 4092
136 Ga0157380_11215286 3300014326 Unclassified 798
137 Ga0157380_11405949 3300014326 Unclassified 748
138 Ga0157377_10252710 3300014745 Bacteria 1143
139 Ga0157379_10083399 3300014968 Bacteria 2865
140 Ga0157379_10295249 3300014968 Bacteria 1476
141 Ga0157376_12290451 3300014969 Unclassified 579
142 Ga0207682_10252566 3300025893 Unclassified 821
143 Ga0207642_10157451 3300025899 Unclassified 1216
144 Ga0207680_10159175 3300025903 Bacteria 1512
145 Ga0207685_10220490 3300025905 Bacteria 902
146 Ga0207645_10087264 3300025907 Bacteria 2005
147 Ga0207681_10030383 3300025923 Bacteria 3522
148 Ga0207681_10473321 3300025923 Bacteria 1022
149 Ga0207659_10003457 3300025926 Bacteria 9469
150 Ga0207659_10291460 3300025926 Bacteria 1337
151 Ga0207687_10538325 3300025927 Bacteria 979
152 Ga0207700_10278766 3300025928 Unclassified 1437
153 Ga0207690_10080953 3300025932 Bacteria 2268
154 Ga0207686_10971267 3300025934 Unclassified 688
155 Ga0207709_11495063 3300025935 Bacteria 560
156 Ga0207669_10617365 3300025937 Bacteria 883
157 Ga0207704_10833089 3300025938 Unclassified 772
158 Ga0207665_10279497 3300025939 Bacteria 1242
159 Ga0207691_10045555 3300025940 Bacteria 4031
160 Ga0207711_11238520 3300025941 Bacteria 688
161 Ga0207651_11021441 3300025960 Unclassified 739
162 Ga0207712_10748941 3300025961 Unclassified 856
163 Ga0207712_10750181 3300025961 Bacteria 855
164 Ga0207668_10120182 3300025972 Bacteria 1988
165 Ga0207640_11337743 3300025981 Bacteria 640
166 Ga0207658_10192006 3300025986 Bacteria 1698
167 Ga0207677_11292194 3300026023 Unclassified 670
168 Ga0207703_10106309 3300026035 Bacteria 2387
169 Ga0207639_10141934 3300026041 Bacteria 2002
170 Ga0207708_10075224 3300026075 Bacteria 2589
171 Ga0207708_10136721 3300026075 Bacteria 1920
172 Ga0207708_10915842 3300026075 Unclassified 759
173 Ga0207675_100113505 3300026118 Bacteria 2558
174 Ga0207675_100183312 3300026118 Unclassified 2006
175 Ga0207683_11193803 3300026121 Bacteria 705
176 Ga0207698_12426192 3300026142 Bacteria 535
177 Ga0207428_10124708 3300027907 Bacteria 1973
178 Ga0207428_10295181 3300027907 Bacteria 1200
179 Ga0268266_12183654 3300028379 Bacteria 526
180 Ga0268265_10044205 3300028380 Bacteria 3316
181 Ga0268264_10776323 3300028381 Bacteria 956
182 Ga0268264_11188095 3300028381 Bacteria 772
183 Ga0265332_10080307 3300031238 Bacteria 1384
184 Ga0265328_10096234 3300031239 Bacteria 1095
185 Ga0265331_10192749 3300031250 Unclassified 919
186 Ga0265316_10061194 3300031344 Bacteria 2925
187 Ga0307408_100441357 3300031548 Bacteria 1127
188 Ga0307409_100193215 3300031995 Bacteria 1814
189 Ga0307411_10835456 3300032005 Bacteria 814
190 Ga0373958_0107511 3300034819 Unclassified 661
191 Ga0373940_0041973 3300035088 Bacteria 1260
192 Ga0373951_0037278 3300035091 Bacteria 1163
193 Ga0373923_0453756 3300035111 Bacteria 622
194 Ga0373941_0020572 3300035115 Bacteria 1852
195 Ga0373941_0039230 3300035115 Bacteria 1454
196 Ga0373960_0033988 3300035121 Bacteria 1440
197 Ga0373955_0098543 3300035172 Bacteria 1675
198 Ga0373931_0221001 3300035691 Bacteria 1140
199 Ga0373931_1181139 3300035691 Bacteria 523
200 Ga0373937_0161995 3300036401 Bacteria 2097
201 Ga0373925_1743026 3300037068 Unclassified 508
202 Ga0395905_0749605 3300037471 Bacteria 879
203 Ga0451577_0020611 3300042876 Bacteria 6046
204 Ga0453684_0132059 3300044712 Bacteria 2995
205 Ga0451576_1530322 3300045051 Unclassified 693
206 Ga0466967_1602993 3300045976 Bacteria 648
207 Ga0495590_0390802 3300046457 Unclassified 533
208 Ga0495628_0144644 3300046516 Bacteria 1813
209 Ga0495635_0577926 3300046663 Bacteria 735
210 Ga0495599_0676809 3300046678 Bacteria 596
211 Ga0495647_0021452 3300046681 Unclassified 2326
212 Ga0495669_0001734 3300046684 Bacteria 8930
213 Ga0495669_0491156 3300046684 Unclassified 597
214 Ga0495670_0381139 3300046691 Unclassified 761
215 Ga0495674_0827341 3300047319 Bacteria 719
216 Ga0495680_0138187 3300047322 Bacteria 1785
217 Ga0495677_0261324 3300047445 Bacteria 678
218 Ga0495684_0071339 3300047471 Bacteria 2640
219 Ga0496105_1307532 3300048908 Bacteria 529
220 Ga0496107_0436953 3300048910 Unclassified 973
221 Ga0496109_0358012 3300048912 Bacteria 1379
222 Ga0496110_0238101 3300048913 Bacteria 1656
223 Ga0496112_0247557 3300048915 Bacteria 1734
224 Ga0496114_1032129 3300048917 Bacteria 706
225 Ga0501034_0156070 3300049571 Bacteria 2256
226 Ga0501072_0411344 3300049588 Bacteria 1073
227 Ga0501075_0400701 3300049591 Bacteria 1046
228 Ga0501076_0227754 3300049592 Bacteria 1524
229 Ga0501080_0486497 3300049742 Bacteria 1104
230 Ga0501081_1258144 3300049743 Unclassified 561
231 Ga0501081_1549837 3300049743 Bacteria 503
232 nmdc:mga05p37_114433_c1 3300050507 Unclassified 3316
233 nmdc:mga05p37_209182_c1 3300050507 Bacteria 2359
234 nmdc:mga05p37_2105_c1 3300050507 Bacteria 23247
235 nmdc:mga05p37_2944_c1 3300050507 Bacteria 19766
236 nmdc:mga05p37_45451_c1 3300050507 Bacteria 5401
237 nmdc:mga05p37_567248_c1 3300050507 Bacteria 1288
238 nmdc:mga05p37_7600_c1 3300050507 Bacteria 12787
239 nmdc:mga09592_353303_c1 3300050508 Bacteria 1272
240 nmdc:mga06r32_1991846_c1 3300050510 Unclassified 514
241 nmdc:mga08y16_1066234_c1 3300050511 Bacteria 785
242 nmdc:mga08y16_1104400_c1 3300050511 Bacteria 768
243 nmdc:mga08y16_155952_c1 3300050511 Bacteria 2373
244 nmdc:mga08y16_35582_c1 3300050511 Bacteria 5229
245 nmdc:mga08y16_454511_c1 3300050511 Bacteria 1306
246 nmdc:mga08y16_58150_c1 3300050511 Bacteria 4040
247 nmdc:mga0n895_161378_c1 3300050512 Bacteria 2273
248 nmdc:mga0n895_2056139_c1 3300050512 Unclassified 528
249 nmdc:mga0n895_211073_c1 3300050512 Bacteria 1972
250 nmdc:mga0n895_289368_c1 3300050512 Bacteria 1661
251 nmdc:mga0n895_631683_c1 3300050512 Bacteria 1071
252 nmdc:mga0n895_74182_c1 3300050512 Bacteria 3379
253 nmdc:mga0n895_832555_c1 3300050512 Bacteria 911
254 nmdc:mga0rr50_82335_c1 3300050513 Bacteria 2486
255 nmdc:mga08x19_1174166_c1 3300050514 Bacteria 544
256 nmdc:mga08x19_1241348_c1 3300050514 Unclassified 528
257 nmdc:mga08x19_14907_c1 3300050514 Bacteria 4722
258 nmdc:mga08x19_259251_c1 3300050514 Bacteria 1202
259 nmdc:mga08x19_326814_c1 3300050514 Bacteria 1068
260 nmdc:mga08x19_6459_c1 3300050514 Bacteria 6940
261 nmdc:mga0a205_144648_c1 3300050515 Bacteria 2277
262 nmdc:mga0a205_212214_c1 3300050515 Bacteria 1824
263 nmdc:mga0a205_585793_c1 3300050515 Bacteria 969
264 nmdc:mga0a205_614949_c1 3300050515 Bacteria 939
265 nmdc:mga0a205_92604_c1 3300050515 Bacteria 2920
266 nmdc:mga0a205_9966_c1 3300050515 Bacteria 8717
267 Ga0495601_0204477 3300053077 Unclassified 1290
268 Ga0495612_0376563 3300053078 Bacteria 643
269 Ga0495655_0286665 3300053083 Unclassified 563
270 Ga0501084_1563241 3300054114 Unclassified 552
271 Ga0501082_0345979 3300060353 Bacteria 1296
272 Ga0501082_1016021 3300060353 Bacteria 725
273 Ga0373925_0056479
274 Ga0065704_10248077
275 Ga0070676_10151284
276 Ga0070690_100359827
277 Ga0070666_10102690
278 Ga0070666_10190935
279 Ga0068868_101645012
280 Ga0070660_101175389
281 Ga0070689_101363960
282 Ga0070668_100599063
283 Ga0070669_100005781
284 Ga0070669_100047560
285 Ga0070669_100750588
286 Ga0070675_100001310
287 Ga0070675_100014905
288 Ga0070671_100231323
289 Ga0070671_101419957
290 Ga0070674_100223122
291 Ga0070674_100392137
292 Ga0070673_100215487
293 Ga0070673_100415251
294 Ga0070673_101650603
295 Ga0070688_100015484
296 Ga0070688_100343180
297 Ga0070659_100056452
298 Ga0070667_100002707
299 Ga0070713_100215624
300 Ga0070711_101303117
301 Ga0070700_100073938
302 Ga0070700_100287016
303 Ga0070700_100602285
304 Ga0070700_101223153
305 Ga0070694_101180921
306 Ga0070708_101092935
307 Ga0070678_100490881
308 Ga0070678_100991921
309 Ga0070662_100104211
310 Ga0070662_100130931
311 Ga0070685_10055721
312 Ga0070707_100800840
313 Ga0070698_100656522
314 Ga0070699_100018361
315 Ga0070699_100365024
316 Ga0070697_100456831
317 Ga0070697_100684818
318 Ga0068853_102480453
319 Ga0070672_100090214
320 Ga0070672_101380145
321 Ga0070672_102067714
322 Ga0070686_100099269
323 Ga0070686_100581981
324 Ga0070695_100303355
325 Ga0070695_100366007
326 Ga0070695_100591730
327 Ga0070695_100669275
328 Ga0070665_100260932
329 Ga0070704_100599793
330 Ga0070704_100736889
331 Ga0070664_101515538
332 Ga0068857_100514549
333 Ga0068854_101538944
334 Ga0068852_101968197
335 Ga0068859_100315365
336 Ga0068859_100394828
337 Ga0068859_101853827
338 Ga0068866_10072608
339 Ga0068866_10183820
340 Ga0068861_100015496
341 Ga0068861_100444036
342 Ga0068861_100849304
343 Ga0068851_10102680
344 Ga0068863_100075155
345 Ga0068858_100319508
346 Ga0068858_100587769
347 Ga0068860_100069894
348 Ga0068862_100084685
349 Ga0070716_100277855
350 Ga0097621_100487479
351 Ga0097621_100687965
352 Ga0068871_100164992
353 Ga0068871_100518847
354 Ga0075428_100057088
355 Ga0075428_100404490
356 Ga0075428_100410724
357 Ga0075430_101000855
358 Ga0075431_102084622
359 Ga0075433_10004006
360 Ga0075433_10195229
361 Ga0075434_100008420
362 Ga0075434_100084785
363 Ga0075434_100257108
364 Ga0075434_100384685
365 Ga0075434_100918105
366 Ga0075436_100010391
367 Ga0075436_100081807
368 Ga0097620_100315344
369 Ga0097620_100394840
370 Ga0097620_101853804
371 Ga0075435_100025044
372 Ga0075435_100094307
373 Ga0075435_100129460
374 Ga0111539_10002429
375 Ga0111539_10045883
376 Ga0111539_10272282
377 Ga0111539_10907612
378 Ga0111539_11259335
379 Ga0111539_12511522
380 Ga0105245_10493001
381 Ga0105245_10947212
382 Ga0105247_11835972
383 Ga0114129_10000772
384 Ga0114129_10019712
385 Ga0114129_10025101
386 Ga0114129_10196654
387 Ga0105243_10155844
388 Ga0105243_10845481
389 Ga0105242_10389581
390 Ga0105242_10786991
391 Ga0105242_11027961
392 Ga0105248_10009184
393 Ga0105248_10272261
394 Ga0105237_11423357
395 Ga0105249_10352405
396 Ga0105249_10449526
397 Ga0105249_10999369
398 Ga0157374_10582146
399 Ga0157378_11948930
400 Ga0163162_10029473
401 Ga0163162_13294731
402 Ga0157375_10019187
403 Ga0157375_11033285
404 Ga0157375_13211194
405 Ga0163163_10135827
406 Ga0163163_11322477
407 Ga0157380_10031155
408 Ga0157380_11215286
409 Ga0157380_11405949
410 Ga0157377_10252710
411 Ga0157379_10083399
412 Ga0157379_10295249
413 Ga0157376_12290451
414 Ga0207682_10252566
415 Ga0207642_10157451
416 Ga0207680_10159175
417 Ga0207685_10220490
418 Ga0207645_10087264
419 Ga0207681_10030383
420 Ga0207681_10473321
421 Ga0207659_10003457
422 Ga0207659_10291460
423 Ga0207687_10538325
424 Ga0207700_10278766
425 Ga0207690_10080953
426 Ga0207686_10971267
427 Ga0207709_11495063
428 Ga0207669_10617365
429 Ga0207704_10833089
430 Ga0207665_10279497
431 Ga0207691_10045555
432 Ga0207711_11238520
433 Ga0207651_11021441
434 Ga0207712_10748941
435 Ga0207712_10750181
436 Ga0207668_10120182
437 Ga0207640_11337743
438 Ga0207658_10192006
439 Ga0207677_11292194
440 Ga0207703_10106309
441 Ga0207639_10141934
442 Ga0207708_10075224
443 Ga0207708_10136721
444 Ga0207708_10915842
445 Ga0207675_100113505
446 Ga0207675_100183312
447 Ga0207683_11193803
448 Ga0207698_12426192
449 Ga0207428_10124708
450 Ga0207428_10295181
451 Ga0268266_12183654
452 Ga0268265_10044205
453 Ga0268264_10776323
454 Ga0268264_11188095
455 Ga0265332_10080307
456 Ga0265328_10096234
457 Ga0265331_10192749
458 Ga0265316_10061194
459 Ga0307408_100441357
460 Ga0307409_100193215
461 Ga0307411_10835456
462 Ga0373958_0107511
463 Ga0373940_0041973
464 Ga0373951_0037278
465 Ga0373923_0453756
466 Ga0373941_0020572
467 Ga0373941_0039230
468 Ga0373960_0033988
469 Ga0373955_0098543
470 Ga0373931_0221001
471 Ga0373931_1181139
472 Ga0373937_0161995
473 Ga0373925_1743026
474 Ga0395905_0749605
475 Ga0451577_0020611
476 Ga0453684_0132059
477 Ga0451576_1530322
478 Ga0466967_1602993
479 Ga0495590_0390802
480 Ga0495628_0144644
481 Ga0495635_0577926
482 Ga0495599_0676809
483 Ga0495647_0021452
484 Ga0495669_0001734
485 Ga0495669_0491156
486 Ga0495670_0381139
487 Ga0495674_0827341
488 Ga0495680_0138187
489 Ga0495677_0261324
490 Ga0495684_0071339
491 Ga0496105_1307532
492 Ga0496107_0436953
493 Ga0496109_0358012
494 Ga0496110_0238101
495 Ga0496112_0247557
496 Ga0496114_1032129
497 Ga0501034_0156070
498 Ga0501072_0411344
499 Ga0501075_0400701
500 Ga0501076_0227754
501 Ga0501080_0486497
502 Ga0501081_1258144
503 Ga0501081_1549837
504 nmdc:mga05p37_114433_c1
505 nmdc:mga05p37_209182_c1
506 nmdc:mga05p37_2105_c1
507 nmdc:mga05p37_2944_c1
508 nmdc:mga05p37_45451_c1
509 nmdc:mga05p37_567248_c1
510 nmdc:mga05p37_7600_c1
511 nmdc:mga09592_353303_c1
512 nmdc:mga06r32_1991846_c1
513 nmdc:mga08y16_1066234_c1
514 nmdc:mga08y16_1104400_c1
515 nmdc:mga08y16_155952_c1
516 nmdc:mga08y16_35582_c1
517 nmdc:mga08y16_454511_c1
518 nmdc:mga08y16_58150_c1
519 nmdc:mga0n895_161378_c1
520 nmdc:mga0n895_2056139_c1
521 nmdc:mga0n895_211073_c1
522 nmdc:mga0n895_289368_c1
523 nmdc:mga0n895_631683_c1
524 nmdc:mga0n895_74182_c1
525 nmdc:mga0n895_832555_c1
526 nmdc:mga0rr50_82335_c1
527 nmdc:mga08x19_1174166_c1
528 nmdc:mga08x19_1241348_c1
529 nmdc:mga08x19_14907_c1
530 nmdc:mga08x19_259251_c1
531 nmdc:mga08x19_326814_c1
532 nmdc:mga08x19_6459_c1
533 nmdc:mga0a205_144648_c1
534 nmdc:mga0a205_212214_c1
535 nmdc:mga0a205_585793_c1
536 nmdc:mga0a205_614949_c1
537 nmdc:mga0a205_92604_c1
538 nmdc:mga0a205_9966_c1
539 Ga0495601_0204477
540 Ga0495612_0376563
541 Ga0495655_0286665
542 Ga0501084_1563241
543 Ga0501082_0345979
544 Ga0501082_1016021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxo-assembly1.cif.gz_A-2 micarec ph7.0 0.9065 2 112
4kfc-assembly1.cif.gz_B crystal structure of a hyperactive mutant of response regulator kdpe complexed to its promoter dna 0.8889 2 113
4h60-assembly1.cif.gz_A high resolution structure of vibrio cholerae chemotaxis protein chey4 crystallized in low ph (4.0) condition 0.8887 2 115
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.8851 2 112
4lx8-assembly1.cif.gz_A crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae 0.8804 2 111
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9121 2 80 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9065 2 112 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9048 2 80 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9028 2 78 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9016 2 78 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V8D721-F1-model_v4 Response regulator 0.9936 1 115 GO:0000160
AF-A0A1F2R4V8-F1-model_v4 Response regulatory domain-containing protein 0.9916 1 115 GO:0000160
AF-A0A7Y4SIS0-F1-model_v4 Response regulator 0.9832 1 118 GO:0000160
AF-A0A7W0G4R1-F1-model_v4 Response regulator 0.9819 2 113 GO:0000160
AF-A0A7V9AUB6-F1-model_v4 Response regulatory domain-containing protein 0.9818 1 115 GO:0000160

Map