F378464

General Info

Members Datasets Scaffolds Average Seq Length
272 165 544 326

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10027114|Ga0316578_100271142
Length 351
Sequence MSAVNVVAAEDEGVRMVGTRAAAAPVPAENPKLSVVIPLYNEEESVPHLHAALTEALTEYGTPYEIVIVDDGSSDRSFELLSEIAQSDPHLKLIQLRRNFGQTAAFSAGFDHACGEVVITMDADLQNDPHDIPLLMEKIDEGYDIVSGWRKDRQDRFLDRRLPSMIANRMISNVTDVRLHDYGCSLKAYRADVLQYVHLYGELHRFIPALASQVGGTVTEVPVNHYARQYGKSKYGIGRATRVALDLITVWFLGGYSTRPIHVFGTLGLLSAGLGVLIGLYLTILKFFSHQDIGTRPMLLLAVLLVVIGVQLITMGLLGEMITRTYFESQDKPIYVVRTVVSGTTKTATSS

Samples

Sample ID Description Type Environment
1 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
127 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
136 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
137 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
138 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.15
Nodule 0
Rhizoplane 2.94
Rhizosphere 90.81
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316578_10027114 3300031728 Unclassified 3236
2 Ga0065712_10077788 3300005290 Bacteria 3442
3 Ga0065712_10080040 3300005290 Bacteria 3152
4 Ga0065712_10125152 3300005290 Bacteria 1617
5 Ga0065712_10149446 3300005290 Bacteria 1381
6 Ga0065715_10126652 3300005293 Bacteria 2104
7 Ga0065707_10001966 3300005295 Bacteria 6007
8 Ga0070676_10003918 3300005328 Bacteria 7814
9 Ga0070683_100040465 3300005329 Bacteria 4286
10 Ga0070690_100007596 3300005330 Bacteria 6209
11 Ga0070690_100061663 3300005330 Bacteria 2416
12 Ga0070690_100179602 3300005330 Bacteria 1462
13 Ga0070670_100084448 3300005331 Bacteria 2728
14 Ga0070666_10048997 3300005335 Bacteria 2839
15 Ga0068868_100025392 3300005338 Bacteria 4507
16 Ga0068868_100039018 3300005338 Bacteria 3687
17 Ga0068868_100211888 3300005338 Bacteria 1619
18 Ga0070689_100064998 3300005340 Bacteria 2840
19 Ga0070691_10003970 3300005341 Bacteria 6695
20 Ga0070691_10011966 3300005341 Bacteria 3972
21 Ga0070687_100001490 3300005343 Bacteria 8261
22 Ga0070675_100020927 3300005354 Bacteria 5224
23 Ga0070671_100159708 3300005355 Bacteria 1905
24 Ga0070674_100006278 3300005356 Bacteria 6921
25 Ga0070674_100051622 3300005356 Bacteria 2835
26 Ga0070674_100078088 3300005356 Bacteria 2359
27 Ga0070673_100006728 3300005364 Bacteria 7499
28 Ga0070673_100010452 3300005364 Bacteria 6284
29 Ga0070659_100122805 3300005366 Bacteria 2105
30 Ga0070659_100354614 3300005366 Bacteria 1231
31 Ga0070667_100089306 3300005367 Bacteria 2647
32 Ga0070701_10024890 3300005438 Bacteria 2900
33 Ga0070705_100015153 3300005440 Bacteria 3979
34 Ga0070705_100025002 3300005440 Bacteria 3232
35 Ga0070700_100006659 3300005441 Bacteria 6188
36 Ga0070700_100237468 3300005441 Bacteria 1300
37 Ga0070694_100184606 3300005444 Bacteria 1545
38 Ga0070663_100227206 3300005455 Bacteria 1468
39 Ga0070678_100307264 3300005456 Bacteria 1350
40 Ga0070681_10014416 3300005458 Bacteria 7867
41 Ga0068867_100029366 3300005459 Bacteria 3961
42 Ga0068867_100041992 3300005459 Bacteria 3342
43 Ga0070685_10134396 3300005466 Bacteria 1550
44 Ga0070685_10135975 3300005466 Bacteria 1542
45 Ga0070685_10200411 3300005466 Bacteria 1297
46 Ga0070698_100046810 3300005471 Bacteria 4422
47 Ga0070698_100260655 3300005471 Unclassified 1666
48 Ga0070698_100319938 3300005471 Bacteria 1482
49 Ga0070672_100066624 3300005543 Bacteria 2852
50 Ga0070686_100012290 3300005544 Bacteria 4871
51 Ga0070686_100056445 3300005544 Bacteria 2519
52 Ga0070695_100008606 3300005545 Bacteria 6061
53 Ga0070696_100004859 3300005546 Bacteria 8979
54 Ga0070696_100058360 3300005546 Bacteria 2695
55 Ga0070665_100035826 3300005548 Bacteria 4992
56 Ga0070704_100009157 3300005549 Bacteria 5971
57 Ga0070704_100023111 3300005549 Unclassified 4054
58 Ga0068855_100226733 3300005563 Bacteria 2094
59 Ga0070664_100301463 3300005564 Bacteria 1448
60 Ga0070664_100406178 3300005564 Bacteria 1246
61 Ga0068857_100091246 3300005577 Bacteria 2727
62 Ga0068854_100057538 3300005578 Bacteria 2805
63 Ga0068856_100150566 3300005614 Bacteria 2336
64 Ga0070702_100002361 3300005615 Bacteria 8117
65 Ga0068859_100019777 3300005617 Bacteria 6758
66 Ga0068859_100117249 3300005617 Bacteria 2728
67 Ga0068859_100327035 3300005617 Bacteria 1627
68 Ga0068864_100095538 3300005618 Bacteria 2629
69 Ga0068864_100201426 3300005618 Bacteria 1829
70 Ga0068864_100274487 3300005618 Bacteria 1572
71 Ga0068861_100002201 3300005719 Bacteria 12655
72 Ga0068851_10040780 3300005834 Bacteria 2334
73 Ga0068863_100008031 3300005841 Bacteria 10305
74 Ga0068863_100144722 3300005841 Bacteria 2273
75 Ga0068858_100007495 3300005842 Bacteria 10548
76 Ga0068858_100008555 3300005842 Bacteria 9832
77 Ga0068858_100016504 3300005842 Bacteria 6935
78 Ga0068858_100528041 3300005842 Bacteria 1141
79 Ga0068860_100042253 3300005843 Bacteria 4354
80 Ga0068860_100209930 3300005843 Bacteria 1888
81 Ga0068862_100142419 3300005844 Bacteria 2129
82 Ga0075364_10055793 3300006051 Bacteria 2585
83 Ga0075364_10088708 3300006051 Bacteria 2051
84 Ga0075362_10016914 3300006177 Bacteria 2996
85 Ga0075362_10038699 3300006177 Bacteria 2095
86 Ga0097621_100071636 3300006237 Bacteria 2865
87 Ga0097621_100101371 3300006237 Bacteria 2423
88 Ga0068871_100031628 3300006358 Bacteria 4174
89 Ga0068871_100271431 3300006358 Bacteria 1482
90 Ga0075428_100192471 3300006844 Bacteria 2206
91 Ga0075431_100069145 3300006847 Bacteria 3643
92 Ga0075433_10290141 3300006852 Bacteria 1449
93 Ga0068865_100185348 3300006881 Bacteria 1605
94 Ga0097620_100019777 3300006931 Bacteria 6758
95 Ga0097620_100117248 3300006931 Bacteria 2728
96 Ga0097620_100327031 3300006931 Bacteria 1627
97 Ga0075435_100001939 3300007076 Bacteria 13481
98 Ga0075435_100086691 3300007076 Bacteria 2579
99 Ga0105240_10036927 3300009093 Bacteria 6280
100 Ga0105240_10086470 3300009093 Bacteria 3840
101 Ga0105240_10285027 3300009093 Bacteria 1896
102 Ga0111539_10272132 3300009094 Bacteria 1971
103 Ga0105245_10097301 3300009098 Bacteria 2718
104 Ga0105245_10154556 3300009098 Bacteria 2172
105 Ga0105245_10166111 3300009098 Bacteria 2098
106 Ga0105245_10515907 3300009098 Bacteria 1213
107 Ga0105247_10011252 3300009101 Bacteria 5396
108 Ga0114129_10008461 3300009147 Bacteria 14660
109 Ga0114129_10017894 3300009147 Bacteria 10088
110 Ga0114129_10169555 3300009147 Bacteria 2977
111 Ga0105243_10017527 3300009148 Bacteria 5414
112 Ga0105243_10026698 3300009148 Bacteria 4422
113 Ga0105241_10031235 3300009174 Bacteria 3987
114 Ga0105242_10002607 3300009176 Bacteria 14137
115 Ga0105242_10004014 3300009176 Bacteria 11443
116 Ga0105242_10110385 3300009176 Bacteria 2343
117 Ga0105242_10213605 3300009176 Bacteria 1720
118 Ga0105248_10003933 3300009177 Bacteria 16428
119 Ga0105248_10021444 3300009177 Bacteria 7155
120 Ga0105248_10034544 3300009177 Bacteria 5655
121 Ga0105248_10054894 3300009177 Bacteria 4469
122 Ga0105237_10078195 3300009545 Bacteria 3298
123 Ga0105237_10529782 3300009545 Bacteria 1185
124 Ga0105249_10410041 3300009553 Bacteria 1387
125 Ga0105239_10133758 3300010375 Bacteria 2760
126 Ga0105246_10079745 3300011119 Bacteria 2328
127 Ga0157374_10243288 3300013296 Bacteria 1770
128 Ga0157374_10316367 3300013296 Bacteria 1546
129 Ga0163162_10030719 3300013306 Bacteria 5324
130 Ga0157372_10120719 3300013307 Bacteria 3010
131 Ga0157375_10550981 3300013308 Bacteria 1315
132 Ga0163163_10036478 3300014325 Bacteria 4776
133 Ga0157380_10018646 3300014326 Bacteria 5154
134 Ga0157380_10058370 3300014326 Unclassified 3076
135 Ga0157380_10425933 3300014326 Bacteria 1267
136 Ga0157379_10023526 3300014968 Bacteria 5468
137 Ga0157376_10064038 3300014969 Bacteria 3099
138 Ga0207710_10031021 3300025900 Bacteria 2335
139 Ga0207688_10084997 3300025901 Bacteria 1812
140 Ga0207680_10196992 3300025903 Bacteria 1370
141 Ga0207647_10094957 3300025904 Bacteria 1776
142 Ga0207645_10006435 3300025907 Bacteria 8426
143 Ga0207645_10060527 3300025907 Bacteria 2418
144 Ga0207645_10183981 3300025907 Bacteria 1371
145 Ga0207643_10062790 3300025908 Bacteria 2123
146 Ga0207707_10014697 3300025912 Bacteria 6822
147 Ga0207695_10090955 3300025913 Bacteria 3066
148 Ga0207695_10104071 3300025913 Bacteria 2829
149 Ga0207662_10000550 3300025918 Bacteria 16647
150 Ga0207662_10023701 3300025918 Bacteria 3528
151 Ga0207652_10163761 3300025921 Bacteria 1994
152 Ga0207646_10185976 3300025922 Unclassified 1876
153 Ga0207694_10373336 3300025924 Bacteria 1183
154 Ga0207650_10401263 3300025925 Bacteria 1135
155 Ga0207659_10000994 3300025926 Bacteria 16859
156 Ga0207687_10100983 3300025927 Bacteria 2123
157 Ga0207690_10300590 3300025932 Bacteria 1256
158 Ga0207706_10059179 3300025933 Bacteria 3374
159 Ga0207686_10004556 3300025934 Bacteria 7427
160 Ga0207686_10105320 3300025934 Bacteria 1891
161 Ga0207709_10006116 3300025935 Bacteria 6782
162 Ga0207709_10018192 3300025935 Bacteria 3931
163 Ga0207670_10214444 3300025936 Unclassified 1470
164 Ga0207669_10065981 3300025937 Bacteria 2248
165 Ga0207691_10003505 3300025940 Bacteria 15271
166 Ga0207691_10005426 3300025940 Bacteria 12309
167 Ga0207711_10017406 3300025941 Bacteria 5971
168 Ga0207711_10024637 3300025941 Bacteria 5045
169 Ga0207711_10079978 3300025941 Bacteria 2854
170 Ga0207711_10093401 3300025941 Bacteria 2650
171 Ga0207689_10023083 3300025942 Bacteria 5224
172 Ga0207689_10040920 3300025942 Bacteria 3834
173 Ga0207689_10223834 3300025942 Bacteria 1555
174 Ga0207661_10050052 3300025944 Bacteria 3327
175 Ga0207661_10146985 3300025944 Bacteria 2035
176 Ga0207679_10185875 3300025945 Bacteria 1723
177 Ga0207679_10310573 3300025945 Bacteria 1362
178 Ga0207667_10185168 3300025949 Bacteria 2138
179 Ga0207651_10053054 3300025960 Bacteria 2769
180 Ga0207651_10069155 3300025960 Bacteria 2492
181 Ga0207712_10107959 3300025961 Bacteria 2082
182 Ga0207640_10127116 3300025981 Bacteria 1837
183 Ga0207658_10031005 3300025986 Bacteria 3793
184 Ga0207677_10100027 3300026023 Bacteria 2131
185 Ga0207677_10162769 3300026023 Bacteria 1735
186 Ga0207703_10041623 3300026035 Bacteria 3682
187 Ga0207639_10279492 3300026041 Bacteria 1468
188 Ga0207678_10096704 3300026067 Bacteria 2523
189 Ga0207708_10003808 3300026075 Bacteria 11120
190 Ga0207708_10012508 3300026075 Bacteria 6327
191 Ga0207708_10044933 3300026075 Bacteria 3366
192 Ga0207641_10233608 3300026088 Bacteria 1710
193 Ga0207641_10262700 3300026088 Bacteria 1617
194 Ga0207641_10280107 3300026088 Bacteria 1568
195 Ga0207648_10003588 3300026089 Bacteria 16228
196 Ga0207648_10084249 3300026089 Bacteria 2773
197 Ga0207676_10204407 3300026095 Bacteria 1747
198 Ga0207676_10257211 3300026095 Bacteria 1574
199 Ga0207674_10282762 3300026116 Bacteria 1607
200 Ga0207675_100001331 3300026118 Bacteria 24758
201 Ga0207675_100006416 3300026118 Bacteria 11142
202 Ga0207683_10020579 3300026121 Bacteria 5646
203 Ga0207683_10254689 3300026121 Bacteria 1602
204 Ga0268266_10032418 3300028379 Bacteria 4439
205 Ga0268264_10065835 3300028381 Bacteria 3054
206 Ga0307408_100045308 3300031548 Bacteria 3141
207 Ga0316575_10011760 3300031665 Unclassified 3243
208 Ga0316577_10009989 3300031733 Bacteria 5118
209 Ga0316577_10020767 3300031733 Unclassified 3638
210 Ga0316577_10058140 3300031733 Bacteria 2159
211 Ga0307416_100030146 3300032002 Bacteria 4067
212 Ga0307416_100415987 3300032002 Bacteria 1387
213 Ga0373938_0035544 3300034957 Bacteria 1087
214 Ga0316574_0000516 3300035398 Bacteria 15756
215 Ga0316574_0002250 3300035398 Bacteria 9610
216 Ga0316574_0195257 3300035398 Unclassified 1301
217 Ga0373937_0316296 3300036401 Bacteria 1477
218 Ga0316582_0064101 3300036647 Bacteria 2363
219 Ga0316582_0082734 3300036647 Bacteria 2099
220 Ga0316582_0093980 3300036647 Bacteria 1978
221 Ga0316582_0153759 3300036647 Bacteria 1556
222 Ga0316584_0032538 3300036712 Bacteria 3860
223 Ga0316584_0053599 3300036712 Bacteria 3019
224 Ga0316584_0062519 3300036712 Bacteria 2788
225 Ga0316584_0148885 3300036712 Unclassified 1743
226 Ga0316584_0236551 3300036712 Bacteria 1338
227 Ga0373925_0240296 3300037068 Bacteria 1450
228 Ga0400484_11243 3300038725 Bacteria 2363
229 Ga0400489_06227 3300039093 Bacteria 10745
230 Ga0400489_51617 3300039093 Bacteria 117191
231 Ga0439433_0024764 3300041999 Bacteria 1353
232 Ga0439435_0014703 3300042436 Bacteria 1938
233 Ga0453684_0017920 3300044712 Bacteria 10922
234 Ga0453684_0089781 3300044712 Bacteria 3799
235 Ga0495653_0061376 3300046463 Bacteria 2845
236 Ga0495587_0070033 3300046536 Bacteria 2042
237 Ga0495621_0044175 3300046539 Bacteria 1574
238 Ga0495658_0027114 3300046683 Bacteria 3079
239 Ga0495684_0041370 3300047471 Bacteria 3532
240 Ga0496104_0021930 3300048907 Bacteria 5866
241 Ga0496104_0232184 3300048907 Bacteria 1757
242 Ga0496108_0064196 3300048911 Bacteria 3093
243 Ga0496110_0140862 3300048913 Bacteria 2180
244 Ga0496110_0241486 3300048913 Bacteria 1644
245 Ga0496112_0017293 3300048915 Bacteria 6771
246 Ga0496113_0282555 3300048916 Bacteria 1327
247 Ga0496114_0136422 3300048917 Bacteria 2122
248 Ga0501034_0007959 3300049571 Bacteria 11259
249 Ga0501034_0013100 3300049571 Bacteria 8546
250 Ga0501043_0015998 3300049579 Bacteria 5880
251 Ga0501047_0002121 3300049581 Bacteria 18984
252 Ga0501044_0005089 3300049823 Bacteria 14664
253 nmdc:mga03683_74785_c1 3300050489 Bacteria 1454
254 nmdc:mga00v17_102288_c1 3300050491 Bacteria 1810
255 nmdc:mga00v17_50105_c1 3300050491 Bacteria 1870
256 nmdc:mga00v17_76094_c1 3300050491 Bacteria 2088
257 nmdc:mga0yw44_72993_c1 3300050492 Bacteria 2134
258 nmdc:mga0yw44_78891_c1 3300050492 Bacteria 2059
259 nmdc:mga0k408_18042_c1 3300050493 Bacteria 3934
260 nmdc:mga0k408_435_c2 3300050493 Bacteria 20817
261 nmdc:mga0k408_9175_c2 3300050493 Bacteria 4290
262 nmdc:mga05p37_18125_c1 3300050507 Bacteria 8506
263 nmdc:mga05p37_614727_c1 3300050507 Bacteria 1224
264 nmdc:mga05p37_64121_c1 3300050507 Bacteria 4521
265 nmdc:mga0qj67_256057_c1 3300050509 Bacteria 1420
266 nmdc:mga06r32_154247_c1 3300050510 Bacteria 2277
267 nmdc:mga06r32_72413_c1 3300050510 Bacteria 3336
268 nmdc:mga0n895_223391_c1 3300050512 Bacteria 1912
269 nmdc:mga0rr50_142306_c1 3300050513 Bacteria 1931
270 nmdc:mga0a205_227716_c1 3300050515 Bacteria 1748
271 nmdc:mga0a205_88981_c1 3300050515 Bacteria 2985
272 Ga0500628_015292 3300053129 Bacteria 1465
273 Ga0316578_10027114
274 Ga0065712_10077788
275 Ga0065712_10080040
276 Ga0065712_10125152
277 Ga0065712_10149446
278 Ga0065715_10126652
279 Ga0065707_10001966
280 Ga0070676_10003918
281 Ga0070683_100040465
282 Ga0070690_100007596
283 Ga0070690_100061663
284 Ga0070690_100179602
285 Ga0070670_100084448
286 Ga0070666_10048997
287 Ga0068868_100025392
288 Ga0068868_100039018
289 Ga0068868_100211888
290 Ga0070689_100064998
291 Ga0070691_10003970
292 Ga0070691_10011966
293 Ga0070687_100001490
294 Ga0070675_100020927
295 Ga0070671_100159708
296 Ga0070674_100006278
297 Ga0070674_100051622
298 Ga0070674_100078088
299 Ga0070673_100006728
300 Ga0070673_100010452
301 Ga0070659_100122805
302 Ga0070659_100354614
303 Ga0070667_100089306
304 Ga0070701_10024890
305 Ga0070705_100015153
306 Ga0070705_100025002
307 Ga0070700_100006659
308 Ga0070700_100237468
309 Ga0070694_100184606
310 Ga0070663_100227206
311 Ga0070678_100307264
312 Ga0070681_10014416
313 Ga0068867_100029366
314 Ga0068867_100041992
315 Ga0070685_10134396
316 Ga0070685_10135975
317 Ga0070685_10200411
318 Ga0070698_100046810
319 Ga0070698_100260655
320 Ga0070698_100319938
321 Ga0070672_100066624
322 Ga0070686_100012290
323 Ga0070686_100056445
324 Ga0070695_100008606
325 Ga0070696_100004859
326 Ga0070696_100058360
327 Ga0070665_100035826
328 Ga0070704_100009157
329 Ga0070704_100023111
330 Ga0068855_100226733
331 Ga0070664_100301463
332 Ga0070664_100406178
333 Ga0068857_100091246
334 Ga0068854_100057538
335 Ga0068856_100150566
336 Ga0070702_100002361
337 Ga0068859_100019777
338 Ga0068859_100117249
339 Ga0068859_100327035
340 Ga0068864_100095538
341 Ga0068864_100201426
342 Ga0068864_100274487
343 Ga0068861_100002201
344 Ga0068851_10040780
345 Ga0068863_100008031
346 Ga0068863_100144722
347 Ga0068858_100007495
348 Ga0068858_100008555
349 Ga0068858_100016504
350 Ga0068858_100528041
351 Ga0068860_100042253
352 Ga0068860_100209930
353 Ga0068862_100142419
354 Ga0075364_10055793
355 Ga0075364_10088708
356 Ga0075362_10016914
357 Ga0075362_10038699
358 Ga0097621_100071636
359 Ga0097621_100101371
360 Ga0068871_100031628
361 Ga0068871_100271431
362 Ga0075428_100192471
363 Ga0075431_100069145
364 Ga0075433_10290141
365 Ga0068865_100185348
366 Ga0097620_100019777
367 Ga0097620_100117248
368 Ga0097620_100327031
369 Ga0075435_100001939
370 Ga0075435_100086691
371 Ga0105240_10036927
372 Ga0105240_10086470
373 Ga0105240_10285027
374 Ga0111539_10272132
375 Ga0105245_10097301
376 Ga0105245_10154556
377 Ga0105245_10166111
378 Ga0105245_10515907
379 Ga0105247_10011252
380 Ga0114129_10008461
381 Ga0114129_10017894
382 Ga0114129_10169555
383 Ga0105243_10017527
384 Ga0105243_10026698
385 Ga0105241_10031235
386 Ga0105242_10002607
387 Ga0105242_10004014
388 Ga0105242_10110385
389 Ga0105242_10213605
390 Ga0105248_10003933
391 Ga0105248_10021444
392 Ga0105248_10034544
393 Ga0105248_10054894
394 Ga0105237_10078195
395 Ga0105237_10529782
396 Ga0105249_10410041
397 Ga0105239_10133758
398 Ga0105246_10079745
399 Ga0157374_10243288
400 Ga0157374_10316367
401 Ga0163162_10030719
402 Ga0157372_10120719
403 Ga0157375_10550981
404 Ga0163163_10036478
405 Ga0157380_10018646
406 Ga0157380_10058370
407 Ga0157380_10425933
408 Ga0157379_10023526
409 Ga0157376_10064038
410 Ga0207710_10031021
411 Ga0207688_10084997
412 Ga0207680_10196992
413 Ga0207647_10094957
414 Ga0207645_10006435
415 Ga0207645_10060527
416 Ga0207645_10183981
417 Ga0207643_10062790
418 Ga0207707_10014697
419 Ga0207695_10090955
420 Ga0207695_10104071
421 Ga0207662_10000550
422 Ga0207662_10023701
423 Ga0207652_10163761
424 Ga0207646_10185976
425 Ga0207694_10373336
426 Ga0207650_10401263
427 Ga0207659_10000994
428 Ga0207687_10100983
429 Ga0207690_10300590
430 Ga0207706_10059179
431 Ga0207686_10004556
432 Ga0207686_10105320
433 Ga0207709_10006116
434 Ga0207709_10018192
435 Ga0207670_10214444
436 Ga0207669_10065981
437 Ga0207691_10003505
438 Ga0207691_10005426
439 Ga0207711_10017406
440 Ga0207711_10024637
441 Ga0207711_10079978
442 Ga0207711_10093401
443 Ga0207689_10023083
444 Ga0207689_10040920
445 Ga0207689_10223834
446 Ga0207661_10050052
447 Ga0207661_10146985
448 Ga0207679_10185875
449 Ga0207679_10310573
450 Ga0207667_10185168
451 Ga0207651_10053054
452 Ga0207651_10069155
453 Ga0207712_10107959
454 Ga0207640_10127116
455 Ga0207658_10031005
456 Ga0207677_10100027
457 Ga0207677_10162769
458 Ga0207703_10041623
459 Ga0207639_10279492
460 Ga0207678_10096704
461 Ga0207708_10003808
462 Ga0207708_10012508
463 Ga0207708_10044933
464 Ga0207641_10233608
465 Ga0207641_10262700
466 Ga0207641_10280107
467 Ga0207648_10003588
468 Ga0207648_10084249
469 Ga0207676_10204407
470 Ga0207676_10257211
471 Ga0207674_10282762
472 Ga0207675_100001331
473 Ga0207675_100006416
474 Ga0207683_10020579
475 Ga0207683_10254689
476 Ga0268266_10032418
477 Ga0268264_10065835
478 Ga0307408_100045308
479 Ga0316575_10011760
480 Ga0316577_10009989
481 Ga0316577_10020767
482 Ga0316577_10058140
483 Ga0307416_100030146
484 Ga0307416_100415987
485 Ga0373938_0035544
486 Ga0316574_0000516
487 Ga0316574_0002250
488 Ga0316574_0195257
489 Ga0373937_0316296
490 Ga0316582_0064101
491 Ga0316582_0082734
492 Ga0316582_0093980
493 Ga0316582_0153759
494 Ga0316584_0032538
495 Ga0316584_0053599
496 Ga0316584_0062519
497 Ga0316584_0148885
498 Ga0316584_0236551
499 Ga0373925_0240296
500 Ga0400484_11243
501 Ga0400489_06227
502 Ga0400489_51617
503 Ga0439433_0024764
504 Ga0439435_0014703
505 Ga0453684_0017920
506 Ga0453684_0089781
507 Ga0495653_0061376
508 Ga0495587_0070033
509 Ga0495621_0044175
510 Ga0495658_0027114
511 Ga0495684_0041370
512 Ga0496104_0021930
513 Ga0496104_0232184
514 Ga0496108_0064196
515 Ga0496110_0140862
516 Ga0496110_0241486
517 Ga0496112_0017293
518 Ga0496113_0282555
519 Ga0496114_0136422
520 Ga0501034_0007959
521 Ga0501034_0013100
522 Ga0501043_0015998
523 Ga0501047_0002121
524 Ga0501044_0005089
525 nmdc:mga03683_74785_c1
526 nmdc:mga00v17_102288_c1
527 nmdc:mga00v17_50105_c1
528 nmdc:mga00v17_76094_c1
529 nmdc:mga0yw44_72993_c1
530 nmdc:mga0yw44_78891_c1
531 nmdc:mga0k408_18042_c1
532 nmdc:mga0k408_435_c2
533 nmdc:mga0k408_9175_c2
534 nmdc:mga05p37_18125_c1
535 nmdc:mga05p37_614727_c1
536 nmdc:mga05p37_64121_c1
537 nmdc:mga0qj67_256057_c1
538 nmdc:mga06r32_154247_c1
539 nmdc:mga06r32_72413_c1
540 nmdc:mga0n895_223391_c1
541 nmdc:mga0rr50_142306_c1
542 nmdc:mga0a205_227716_c1
543 nmdc:mga0a205_88981_c1
544 Ga0500628_015292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

34

197

0.97

PF10111

Glyco_tranf_2_2

Glycosyltransferase like family 2

34

135

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7956 3 312
3kia-assembly1.cif.gz_A crystal structure of mannosyl-3-phosphoglycerate synthase from rubrobacter xylanophilus 0.7848 4 222
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7757 3 317
5ekp-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7745 3 313
5jt0-assembly1.cif.gz_A crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and glucosyl-3-phosphoglycerate (gpg) - gpgs*gpg*udp*mn2+ 0.7718 3 224
ID Description Score Start End Superfamily
af_Q8WSL9_63_329_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8846 4 225 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8811 5 220 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8744 2 225 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8629 1 222 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8603 8 226 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3D2J9K3-F1-model_v4 Glycosyltransferase 0.9894 3 106 GO:0005886
GO:0016757
AF-A0A4V1ZS11-F1-model_v4 Glycosyltransferase family 2 protein 0.9889 3 106 GO:0005886
GO:0099621
AF-A0A7Y6CFG3-F1-model_v4 Glycosyltransferase 0.9875 5 104 GO:0005886
GO:0016757
AF-A0A523V6E2-F1-model_v4 Glycosyltransferase 0.9847 1 113 GO:0005886
GO:0016757
AF-W2D0Y6-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9762 5 117 GO:0005886
GO:0016757

Map