F378412

General Info

Members Datasets Scaffolds Average Seq Length
272 56 544 92

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10272815|Ga0207664_102728152
Length 106
Sequence LASSKTGWPPPLAKYQVMYWKHIPSQVKAWDDAGPEAKAMLPDYFQAAIDAYAMKDGSTDMDAYLDGWRWGDVDERGGSAREVVSALVEELTAANPRARLLNPESA

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
47 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
48 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
49 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
50 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
51 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
52 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
53 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
54 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
55 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
56 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.63
Stem 0
Stem Tuber 0
Unclassified 21.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10272815 3300025929 Bacteria 1482
2 Ga0070703_10000773 3300005406 Bacteria 10561
3 Ga0070703_10002167 3300005406 Bacteria 5709
4 Ga0070709_10078297 3300005434 Unclassified 2150
5 Ga0070714_100004791 3300005435 Bacteria 10253
6 Ga0070714_100244358 3300005435 Bacteria 1657
7 Ga0070714_100250805 3300005435 Bacteria 1636
8 Ga0070714_100506648 3300005435 Bacteria 1151
9 Ga0070714_100936089 3300005435 Bacteria 842
10 Ga0070714_101638388 3300005435 Bacteria 628
11 Ga0070714_101893998 3300005435 Bacteria 582
12 Ga0070713_100064467 3300005436 Bacteria 3075
13 Ga0070713_101785623 3300005436 Unclassified 597
14 Ga0070710_10412953 3300005437 Bacteria 907
15 Ga0070711_100494991 3300005439 Bacteria 1007
16 Ga0070711_101521456 3300005439 Bacteria 584
17 Ga0070705_100039981 3300005440 Unclassified 2664
18 Ga0070705_100239927 3300005440 Bacteria 1266
19 Ga0070705_101146299 3300005440 Bacteria 638
20 Ga0070694_100111531 3300005444 Bacteria 1949
21 Ga0070694_100303468 3300005444 Unclassified 1224
22 Ga0070694_101186938 3300005444 Unclassified 639
23 Ga0070708_100000028 3300005445 Bacteria 96912
24 Ga0070708_100010428 3300005445 Bacteria 7533
25 Ga0070708_100018998 3300005445 Bacteria 5763
26 Ga0070708_100019919 3300005445 Bacteria 5646
27 Ga0070708_100064353 3300005445 Bacteria 3285
28 Ga0070708_100103146 3300005445 Bacteria 2614
29 Ga0070708_100115848 3300005445 Unclassified 2467
30 Ga0070708_100140481 3300005445 Bacteria 2239
31 Ga0070708_100165056 3300005445 Bacteria 2065
32 Ga0070708_100174095 3300005445 Bacteria 2010
33 Ga0070708_100310512 3300005445 Bacteria 1485
34 Ga0070708_100464795 3300005445 Unclassified 1194
35 Ga0070708_100657464 3300005445 Bacteria 987
36 Ga0070708_100976447 3300005445 Unclassified 794
37 Ga0070708_101881447 3300005445 Unclassified 555
38 Ga0070681_10167343 3300005458 Bacteria 2121
39 Ga0070706_100000027 3300005467 Bacteria 156057
40 Ga0070706_100000047 3300005467 Bacteria 143702
41 Ga0070706_100000077 3300005467 Bacteria 113837
42 Ga0070706_100000161 3300005467 Bacteria 85173
43 Ga0070706_100000705 3300005467 Bacteria 37590
44 Ga0070706_100042287 3300005467 Bacteria 4209
45 Ga0070706_100069814 3300005467 Bacteria 3250
46 Ga0070706_100074253 3300005467 Bacteria 3148
47 Ga0070706_100267118 3300005467 Bacteria 1597
48 Ga0070706_100534635 3300005467 Bacteria 1090
49 Ga0070706_100630960 3300005467 Unclassified 995
50 Ga0070706_100696277 3300005467 Bacteria 942
51 Ga0070706_100805154 3300005467 Bacteria 870
52 Ga0070706_101088841 3300005467 Bacteria 736
53 Ga0070706_101594565 3300005467 Unclassified 595
54 Ga0070706_101695205 3300005467 Bacteria 576
55 Ga0070707_100000062 3300005468 Bacteria 96912
56 Ga0070707_100001473 3300005468 Bacteria 23055
57 Ga0070707_100002736 3300005468 Bacteria 16773
58 Ga0070707_100006846 3300005468 Bacteria 10557
59 Ga0070707_100010509 3300005468 Bacteria 8624
60 Ga0070707_100012516 3300005468 Bacteria 7924
61 Ga0070707_100016059 3300005468 Bacteria 7023
62 Ga0070707_100021401 3300005468 Bacteria 6112
63 Ga0070707_100057267 3300005468 Bacteria 3738
64 Ga0070707_100101426 3300005468 Bacteria 2789
65 Ga0070707_100112001 3300005468 Bacteria 2647
66 Ga0070707_100136726 3300005468 Unclassified 2384
67 Ga0070707_100215413 3300005468 Unclassified 1871
68 Ga0070707_100246542 3300005468 Bacteria 1738
69 Ga0070707_100411147 3300005468 Bacteria 1313
70 Ga0070707_100432002 3300005468 Bacteria 1277
71 Ga0070707_100556193 3300005468 Bacteria 1109
72 Ga0070707_100776799 3300005468 Bacteria 921
73 Ga0070707_100776800 3300005468 Bacteria 921
74 Ga0070707_101185509 3300005468 Bacteria 730
75 Ga0070707_101307414 3300005468 Unclassified 691
76 Ga0070707_102023588 3300005468 Unclassified 543
77 Ga0070698_100000925 3300005471 Bacteria 32068
78 Ga0070698_100012759 3300005471 Bacteria 8899
79 Ga0070698_100023618 3300005471 Bacteria 6425
80 Ga0070698_100026018 3300005471 Bacteria 6094
81 Ga0070698_100036611 3300005471 Bacteria 5067
82 Ga0070698_100042611 3300005471 Bacteria 4656
83 Ga0070698_100048716 3300005471 Bacteria 4329
84 Ga0070698_100065904 3300005471 Bacteria 3646
85 Ga0070698_100083298 3300005471 Bacteria 3188
86 Ga0070698_100165907 3300005471 Bacteria 2152
87 Ga0070698_100191860 3300005471 Unclassified 1980
88 Ga0070698_100291592 3300005471 Unclassified 1563
89 Ga0070698_100424323 3300005471 Bacteria 1264
90 Ga0070698_100552994 3300005471 Bacteria 1090
91 Ga0070698_100575841 3300005471 Bacteria 1066
92 Ga0070698_100669036 3300005471 Bacteria 980
93 Ga0070698_100745356 3300005471 Bacteria 922
94 Ga0070698_100946908 3300005471 Unclassified 807
95 Ga0070698_101535469 3300005471 Unclassified 617
96 Ga0070698_102077695 3300005471 Bacteria 521
97 Ga0070699_100000070 3300005518 Bacteria 96912
98 Ga0070699_100000203 3300005518 Bacteria 58650
99 Ga0070699_100000238 3300005518 Bacteria 53787
100 Ga0070699_100000851 3300005518 Bacteria 28316
101 Ga0070699_100000964 3300005518 Bacteria 26807
102 Ga0070699_100004918 3300005518 Bacteria 11786
103 Ga0070699_100048239 3300005518 Bacteria 3685
104 Ga0070699_100109757 3300005518 Bacteria 2421
105 Ga0070699_100110204 3300005518 Bacteria 2416
106 Ga0070699_100148675 3300005518 Bacteria 2071
107 Ga0070699_100176518 3300005518 Bacteria 1894
108 Ga0070699_100232601 3300005518 Bacteria 1644
109 Ga0070699_100800671 3300005518 Bacteria 862
110 Ga0070699_100877073 3300005518 Bacteria 821
111 Ga0070699_101620698 3300005518 Bacteria 593
112 Ga0070699_102058541 3300005518 Unclassified 522
113 Ga0070697_100000005 3300005536 Bacteria 259746
114 Ga0070697_100000009 3300005536 Bacteria 181121
115 Ga0070697_100002011 3300005536 Bacteria 15598
116 Ga0070697_100003505 3300005536 Bacteria 12056
117 Ga0070697_100003892 3300005536 Bacteria 11465
118 Ga0070697_100007000 3300005536 Bacteria 8767
119 Ga0070697_100051776 3300005536 Bacteria 3336
120 Ga0070697_100055626 3300005536 Bacteria 3217
121 Ga0070697_100056299 3300005536 Unclassified 3199
122 Ga0070697_100062159 3300005536 Bacteria 3047
123 Ga0070697_100071724 3300005536 Bacteria 2841
124 Ga0070697_100098153 3300005536 Bacteria 2431
125 Ga0070697_100136820 3300005536 Bacteria 2058
126 Ga0070697_100149657 3300005536 Bacteria 1967
127 Ga0070697_100151074 3300005536 Bacteria 1957
128 Ga0070697_100638744 3300005536 Unclassified 937
129 Ga0070695_100002917 3300005545 Bacteria 9949
130 Ga0070695_100293328 3300005545 Unclassified 1200
131 Ga0070695_100597892 3300005545 Unclassified 866
132 Ga0070695_100947517 3300005545 Bacteria 698
133 Ga0070696_100338893 3300005546 Unclassified 1162
134 Ga0070696_100965406 3300005546 Bacteria 710
135 Ga0070704_100007413 3300005549 Bacteria 6532
136 Ga0070704_100022535 3300005549 Bacteria 4100
137 Ga0068855_100594307 3300005563 Unclassified 1194
138 Ga0068856_100865156 3300005614 Bacteria 923
139 Ga0070717_10000045 3300006028 Bacteria 108775
140 Ga0070717_10010188 3300006028 Bacteria 7079
141 Ga0070717_10065229 3300006028 Bacteria 3027
142 Ga0070717_10133824 3300006028 Unclassified 2134
143 Ga0070717_10306689 3300006028 Bacteria 1412
144 Ga0070717_10871421 3300006028 Unclassified 820
145 Ga0075432_10492091 3300006058 Unclassified 545
146 Ga0070716_100033352 3300006173 Bacteria 2815
147 Ga0070716_100290872 3300006173 Bacteria 1132
148 Ga0070716_100738762 3300006173 Unclassified 756
149 Ga0070716_100858957 3300006173 Unclassified 707
150 Ga0070712_100250558 3300006175 Archaea 1415
151 Ga0070712_100516218 3300006175 Bacteria 1003
152 Ga0070712_100772747 3300006175 Unclassified 823
153 Ga0075433_10026859 3300006852 Bacteria 4878
154 Ga0075433_10327519 3300006852 Unclassified 1355
155 Ga0075433_10374587 3300006852 Bacteria 1257
156 Ga0075434_100029835 3300006871 Bacteria 5368
157 Ga0075434_100160820 3300006871 Bacteria 2265
158 Ga0075436_100043566 3300006914 Bacteria 3094
159 Ga0075436_100045878 3300006914 Bacteria 3014
160 Ga0075436_100097124 3300006914 Unclassified 2049
161 Ga0075436_100364896 3300006914 Bacteria 1042
162 Ga0075436_100567001 3300006914 Bacteria 834
163 Ga0075436_100618888 3300006914 Bacteria 798
164 Ga0075436_100881885 3300006914 Bacteria 668
165 Ga0075436_101113223 3300006914 Bacteria 595
166 Ga0075435_100036987 3300007076 Bacteria 3884
167 Ga0075435_100188843 3300007076 Bacteria 1743
168 Ga0075435_100303212 3300007076 Bacteria 1366
169 Ga0075435_100954109 3300007076 Unclassified 748
170 Ga0075435_101106420 3300007076 Bacteria 693
171 Ga0075435_102063786 3300007076 Unclassified 501
172 Ga0099794_10156193 3300007265 Bacteria 1159
173 Ga0099794_10271619 3300007265 Bacteria 876
174 Ga0099794_10434931 3300007265 Bacteria 687
175 Ga0099794_10458659 3300007265 Bacteria 669
176 Ga0099794_10585705 3300007265 Unclassified 590
177 Ga0099795_10135075 3300007788 Bacteria 999
178 Ga0105240_10799115 3300009093 Bacteria 1022
179 Ga0114129_12234311 3300009147 Unclassified 658
180 Ga0105241_10734473 3300009174 Bacteria 904
181 Ga0105241_12248328 3300009174 Bacteria 542
182 Ga0105239_11405189 3300010375 Bacteria 806
183 Ga0207653_10001343 3300025885 Bacteria 7996
184 Ga0207653_10003640 3300025885 Bacteria 4855
185 Ga0207699_10224683 3300025906 Bacteria 1283
186 Ga0207699_10435001 3300025906 Unclassified 939
187 Ga0207684_10000001 3300025910 Bacteria 1115726
188 Ga0207684_10000003 3300025910 Bacteria 766933
189 Ga0207684_10000007 3300025910 Bacteria 612969
190 Ga0207684_10000015 3300025910 Bacteria 427232
191 Ga0207684_10000099 3300025910 Bacteria 163128
192 Ga0207684_10000192 3300025910 Bacteria 96931
193 Ga0207684_10000562 3300025910 Bacteria 45293
194 Ga0207684_10001211 3300025910 Bacteria 28714
195 Ga0207684_10002254 3300025910 Bacteria 19646
196 Ga0207684_10007881 3300025910 Bacteria 9525
197 Ga0207684_10079975 3300025910 Bacteria 2781
198 Ga0207684_10156924 3300025910 Bacteria 1958
199 Ga0207684_10178389 3300025910 Unclassified 1831
200 Ga0207684_10240857 3300025910 Bacteria 1560
201 Ga0207684_10323486 3300025910 Bacteria 1329
202 Ga0207684_10533479 3300025910 Bacteria 1005
203 Ga0207684_10622754 3300025910 Unclassified 921
204 Ga0207684_10687954 3300025910 Bacteria 870
205 Ga0207684_10694153 3300025910 Bacteria 865
206 Ga0207684_10880965 3300025910 Unclassified 753
207 Ga0207707_10226452 3300025912 Bacteria 1627
208 Ga0207693_10201655 3300025915 Bacteria 1564
209 Ga0207693_11390407 3300025915 Unclassified 521
210 Ga0207663_10410884 3300025916 Bacteria 1037
211 Ga0207646_10000069 3300025922 Bacteria 143056
212 Ga0207646_10000144 3300025922 Bacteria 96931
213 Ga0207646_10000159 3300025922 Bacteria 91906
214 Ga0207646_10000285 3300025922 Bacteria 69639
215 Ga0207646_10001303 3300025922 Bacteria 31046
216 Ga0207646_10001430 3300025922 Bacteria 29665
217 Ga0207646_10002493 3300025922 Bacteria 21743
218 Ga0207646_10003003 3300025922 Bacteria 19467
219 Ga0207646_10003935 3300025922 Bacteria 16487
220 Ga0207646_10006584 3300025922 Bacteria 11985
221 Ga0207646_10010403 3300025922 Bacteria 9098
222 Ga0207646_10011148 3300025922 Bacteria 8726
223 Ga0207646_10016822 3300025922 Bacteria 6858
224 Ga0207646_10027104 3300025922 Bacteria 5225
225 Ga0207646_10040450 3300025922 Bacteria 4191
226 Ga0207646_10040714 3300025922 Bacteria 4178
227 Ga0207646_10096625 3300025922 Bacteria 2647
228 Ga0207646_10242147 3300025922 Unclassified 1629
229 Ga0207646_10273027 3300025922 Unclassified 1528
230 Ga0207646_10289454 3300025922 Bacteria 1480
231 Ga0207646_10342277 3300025922 Bacteria 1351
232 Ga0207646_11282397 3300025922 Bacteria 640
233 Ga0207700_10059455 3300025928 Bacteria 2891
234 Ga0207700_12023940 3300025928 Unclassified 503
235 Ga0207664_10017297 3300025929 Bacteria 5282
236 Ga0207664_10082315 3300025929 Bacteria 2621
237 Ga0207664_10278753 3300025929 Bacteria 1466
238 Ga0207664_10383849 3300025929 Unclassified 1247
239 Ga0207664_10642751 3300025929 Unclassified 953
240 Ga0207664_10898778 3300025929 Unclassified 795
241 Ga0207665_10036389 3300025939 Bacteria 3274
242 Ga0207665_10111655 3300025939 Unclassified 1921
243 Ga0207665_10123259 3300025939 Bacteria 1833
244 Ga0207665_10586499 3300025939 Unclassified 869
245 Ga0207665_10911195 3300025939 Unclassified 697
246 Ga0209588_1011496 3300027671 Bacteria 2676
247 Ga0373925_1702570 3300037068 Bacteria 515
248 Ga0242420_039637 3300038996 Bacteria 897
249 Ga0451839_0573478 3300041496 Unclassified 903
250 Ga0453683_0145738 3300044673 Bacteria 1495
251 Ga0466968_0105154 3300044735 Bacteria 1264
252 Ga0495657_0477422 3300046675 Unclassified 728
253 Ga0501067_0093975 3300049583 Unclassified 1665
254 nmdc:mga0n895_377531_c1 3300050512 Bacteria 1435
255 nmdc:mga0n895_481409_c1 3300050512 Bacteria 1251
256 nmdc:mga0n895_819630_c1 3300050512 Bacteria 920
257 nmdc:mga0rr50_155559_c1 3300050513 Unclassified 1852
258 nmdc:mga0rr50_28007_c1 3300050513 Bacteria 3955
259 nmdc:mga0rr50_508475_c1 3300050513 Unclassified 1025
260 nmdc:mga0rr50_574561_c1 3300050513 Bacteria 960
261 nmdc:mga08x19_148770_c1 3300050514 Bacteria 1585
262 nmdc:mga08x19_177834_c1 3300050514 Bacteria 1452
263 nmdc:mga08x19_187365_c1 3300050514 Bacteria 1415
264 nmdc:mga08x19_26453_c1 3300050514 Bacteria 3621
265 nmdc:mga08x19_290231_c1 3300050514 Unclassified 1134
266 nmdc:mga08x19_409307_c1 3300050514 Bacteria 952
267 nmdc:mga08x19_57893_c1 3300050514 Bacteria 2506
268 nmdc:mga08x19_620015_c1 3300050514 Bacteria 767
269 nmdc:mga08x19_690124_c1 3300050514 Bacteria 725
270 nmdc:mga0a205_1424992_c1 3300050515 Unclassified 541
271 nmdc:mga0a205_21290_c1 3300050515 Bacteria 6133
272 nmdc:mga0a205_256164_c1 3300050515 Bacteria 1628
273 Ga0207664_10272815
274 Ga0070703_10000773
275 Ga0070703_10002167
276 Ga0070709_10078297
277 Ga0070714_100004791
278 Ga0070714_100244358
279 Ga0070714_100250805
280 Ga0070714_100506648
281 Ga0070714_100936089
282 Ga0070714_101638388
283 Ga0070714_101893998
284 Ga0070713_100064467
285 Ga0070713_101785623
286 Ga0070710_10412953
287 Ga0070711_100494991
288 Ga0070711_101521456
289 Ga0070705_100039981
290 Ga0070705_100239927
291 Ga0070705_101146299
292 Ga0070694_100111531
293 Ga0070694_100303468
294 Ga0070694_101186938
295 Ga0070708_100000028
296 Ga0070708_100010428
297 Ga0070708_100018998
298 Ga0070708_100019919
299 Ga0070708_100064353
300 Ga0070708_100103146
301 Ga0070708_100115848
302 Ga0070708_100140481
303 Ga0070708_100165056
304 Ga0070708_100174095
305 Ga0070708_100310512
306 Ga0070708_100464795
307 Ga0070708_100657464
308 Ga0070708_100976447
309 Ga0070708_101881447
310 Ga0070681_10167343
311 Ga0070706_100000027
312 Ga0070706_100000047
313 Ga0070706_100000077
314 Ga0070706_100000161
315 Ga0070706_100000705
316 Ga0070706_100042287
317 Ga0070706_100069814
318 Ga0070706_100074253
319 Ga0070706_100267118
320 Ga0070706_100534635
321 Ga0070706_100630960
322 Ga0070706_100696277
323 Ga0070706_100805154
324 Ga0070706_101088841
325 Ga0070706_101594565
326 Ga0070706_101695205
327 Ga0070707_100000062
328 Ga0070707_100001473
329 Ga0070707_100002736
330 Ga0070707_100006846
331 Ga0070707_100010509
332 Ga0070707_100012516
333 Ga0070707_100016059
334 Ga0070707_100021401
335 Ga0070707_100057267
336 Ga0070707_100101426
337 Ga0070707_100112001
338 Ga0070707_100136726
339 Ga0070707_100215413
340 Ga0070707_100246542
341 Ga0070707_100411147
342 Ga0070707_100432002
343 Ga0070707_100556193
344 Ga0070707_100776799
345 Ga0070707_100776800
346 Ga0070707_101185509
347 Ga0070707_101307414
348 Ga0070707_102023588
349 Ga0070698_100000925
350 Ga0070698_100012759
351 Ga0070698_100023618
352 Ga0070698_100026018
353 Ga0070698_100036611
354 Ga0070698_100042611
355 Ga0070698_100048716
356 Ga0070698_100065904
357 Ga0070698_100083298
358 Ga0070698_100165907
359 Ga0070698_100191860
360 Ga0070698_100291592
361 Ga0070698_100424323
362 Ga0070698_100552994
363 Ga0070698_100575841
364 Ga0070698_100669036
365 Ga0070698_100745356
366 Ga0070698_100946908
367 Ga0070698_101535469
368 Ga0070698_102077695
369 Ga0070699_100000070
370 Ga0070699_100000203
371 Ga0070699_100000238
372 Ga0070699_100000851
373 Ga0070699_100000964
374 Ga0070699_100004918
375 Ga0070699_100048239
376 Ga0070699_100109757
377 Ga0070699_100110204
378 Ga0070699_100148675
379 Ga0070699_100176518
380 Ga0070699_100232601
381 Ga0070699_100800671
382 Ga0070699_100877073
383 Ga0070699_101620698
384 Ga0070699_102058541
385 Ga0070697_100000005
386 Ga0070697_100000009
387 Ga0070697_100002011
388 Ga0070697_100003505
389 Ga0070697_100003892
390 Ga0070697_100007000
391 Ga0070697_100051776
392 Ga0070697_100055626
393 Ga0070697_100056299
394 Ga0070697_100062159
395 Ga0070697_100071724
396 Ga0070697_100098153
397 Ga0070697_100136820
398 Ga0070697_100149657
399 Ga0070697_100151074
400 Ga0070697_100638744
401 Ga0070695_100002917
402 Ga0070695_100293328
403 Ga0070695_100597892
404 Ga0070695_100947517
405 Ga0070696_100338893
406 Ga0070696_100965406
407 Ga0070704_100007413
408 Ga0070704_100022535
409 Ga0068855_100594307
410 Ga0068856_100865156
411 Ga0070717_10000045
412 Ga0070717_10010188
413 Ga0070717_10065229
414 Ga0070717_10133824
415 Ga0070717_10306689
416 Ga0070717_10871421
417 Ga0075432_10492091
418 Ga0070716_100033352
419 Ga0070716_100290872
420 Ga0070716_100738762
421 Ga0070716_100858957
422 Ga0070712_100250558
423 Ga0070712_100516218
424 Ga0070712_100772747
425 Ga0075433_10026859
426 Ga0075433_10327519
427 Ga0075433_10374587
428 Ga0075434_100029835
429 Ga0075434_100160820
430 Ga0075436_100043566
431 Ga0075436_100045878
432 Ga0075436_100097124
433 Ga0075436_100364896
434 Ga0075436_100567001
435 Ga0075436_100618888
436 Ga0075436_100881885
437 Ga0075436_101113223
438 Ga0075435_100036987
439 Ga0075435_100188843
440 Ga0075435_100303212
441 Ga0075435_100954109
442 Ga0075435_101106420
443 Ga0075435_102063786
444 Ga0099794_10156193
445 Ga0099794_10271619
446 Ga0099794_10434931
447 Ga0099794_10458659
448 Ga0099794_10585705
449 Ga0099795_10135075
450 Ga0105240_10799115
451 Ga0114129_12234311
452 Ga0105241_10734473
453 Ga0105241_12248328
454 Ga0105239_11405189
455 Ga0207653_10001343
456 Ga0207653_10003640
457 Ga0207699_10224683
458 Ga0207699_10435001
459 Ga0207684_10000001
460 Ga0207684_10000003
461 Ga0207684_10000007
462 Ga0207684_10000015
463 Ga0207684_10000099
464 Ga0207684_10000192
465 Ga0207684_10000562
466 Ga0207684_10001211
467 Ga0207684_10002254
468 Ga0207684_10007881
469 Ga0207684_10079975
470 Ga0207684_10156924
471 Ga0207684_10178389
472 Ga0207684_10240857
473 Ga0207684_10323486
474 Ga0207684_10533479
475 Ga0207684_10622754
476 Ga0207684_10687954
477 Ga0207684_10694153
478 Ga0207684_10880965
479 Ga0207707_10226452
480 Ga0207693_10201655
481 Ga0207693_11390407
482 Ga0207663_10410884
483 Ga0207646_10000069
484 Ga0207646_10000144
485 Ga0207646_10000159
486 Ga0207646_10000285
487 Ga0207646_10001303
488 Ga0207646_10001430
489 Ga0207646_10002493
490 Ga0207646_10003003
491 Ga0207646_10003935
492 Ga0207646_10006584
493 Ga0207646_10010403
494 Ga0207646_10011148
495 Ga0207646_10016822
496 Ga0207646_10027104
497 Ga0207646_10040450
498 Ga0207646_10040714
499 Ga0207646_10096625
500 Ga0207646_10242147
501 Ga0207646_10273027
502 Ga0207646_10289454
503 Ga0207646_10342277
504 Ga0207646_11282397
505 Ga0207700_10059455
506 Ga0207700_12023940
507 Ga0207664_10017297
508 Ga0207664_10082315
509 Ga0207664_10278753
510 Ga0207664_10383849
511 Ga0207664_10642751
512 Ga0207664_10898778
513 Ga0207665_10036389
514 Ga0207665_10111655
515 Ga0207665_10123259
516 Ga0207665_10586499
517 Ga0207665_10911195
518 Ga0209588_1011496
519 Ga0373925_1702570
520 Ga0242420_039637
521 Ga0451839_0573478
522 Ga0453683_0145738
523 Ga0466968_0105154
524 Ga0495657_0477422
525 Ga0501067_0093975
526 nmdc:mga0n895_377531_c1
527 nmdc:mga0n895_481409_c1
528 nmdc:mga0n895_819630_c1
529 nmdc:mga0rr50_155559_c1
530 nmdc:mga0rr50_28007_c1
531 nmdc:mga0rr50_508475_c1
532 nmdc:mga0rr50_574561_c1
533 nmdc:mga08x19_148770_c1
534 nmdc:mga08x19_177834_c1
535 nmdc:mga08x19_187365_c1
536 nmdc:mga08x19_26453_c1
537 nmdc:mga08x19_290231_c1
538 nmdc:mga08x19_409307_c1
539 nmdc:mga08x19_57893_c1
540 nmdc:mga08x19_620015_c1
541 nmdc:mga08x19_690124_c1
542 nmdc:mga0a205_1424992_c1
543 nmdc:mga0a205_21290_c1
544 nmdc:mga0a205_256164_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13769

Virulence_fact

Virulence factor

18

102

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gqz-assembly1.cif.gz_A crystal structure of s.cuep 0.7209 2 25
6xk9-assembly1.cif.gz_Y cereblon in complex with ddb1, cc-90009, and gspt1 0.6655 7 28
8b3d-assembly1.cif.gz_d structure of the pol ii-tcr-elof1 complex. 0.6195 7 28
8dvh-assembly1.cif.gz_B crystal structure of atp-dependent lon protease from bacillus subtillis (bslonba) 0.4585 6 42
6dhx-assembly3.cif.gz_C structure of tipc2 from streptococcus intermedius b196 0.3834 9 49
ID Description Score Start End Superfamily
af_Q2FW79_1_86_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.786 3 22 2.30.29.30
1vs8G01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.6933 3 26 3.90.930.12
4g5wH01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.6872 1 24 3.90.930.12
af_Q2FYK3_109_189_1.20.5.2050 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.6725 1 86 1.20.5.2050
af_Q2FYK3_109_189_1.20.5.2050 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.6655 1 86 1.20.5.2050
ID Description Score Start End GO Terms
AF-A0A536PLS5-F1-model_v4 Virulence factor domain-containing protein 0.8215 11 86
AF-A0A381PQ51-F1-model_v4 Virulence factor domain-containing protein 0.7989 11 82
AF-A0A243VCJ3-F1-model_v4 deleted 0.7675 5 85
AF-A0A2N7SEE5-F1-model_v4 deleted 0.7607 7 83
AF-A0A536NV43-F1-model_v4 Virulence factor domain-containing protein 0.7584 9 86

Map