F377974

General Info

Members Datasets Scaffolds Average Seq Length
271 142 542 140

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0909202|Ga0501080_0909202_158_664
Length 168
Sequence MTDPAPNKSAWWMPKSKKARRRLGVVAVAGVVLAGALGLTLYGLGTSVNMYMSPSEAKAENVKAGRTIKLGGCVEPGSLVHRQDGSISFVVVDGIDSAHVDFKGIVPDLFREGQTTVATGAFRNDGTFVATNVLAKHDENYRPRELEKTLAKSGAALPAGCSFGKPTA

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
140 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
141 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 8.49
Rhizosphere 90.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0909202 3300049742 Bacteria 767
2 JGI24736J21556_1047028 3300001904 Bacteria 663
3 JGI24737J22298_10012721 3300001990 Bacteria 2743
4 JGI24737J22298_10199693 3300001990 Bacteria 590
5 rootH1_10038712 3300003323 Bacteria 1054
6 Ga0070658_10030997 3300005327 Bacteria 4294
7 Ga0070658_10302387 3300005327 Bacteria 1364
8 Ga0070658_10567163 3300005327 Bacteria 983
9 Ga0070658_10729688 3300005327 Bacteria 860
10 Ga0070666_10068168 3300005335 Bacteria 2417
11 Ga0070680_101428746 3300005336 Bacteria 599
12 Ga0070682_100613955 3300005337 Bacteria 861
13 Ga0068868_100031389 3300005338 Bacteria 4080
14 Ga0068868_100067136 3300005338 Bacteria 2854
15 Ga0068868_100115649 3300005338 Bacteria 2184
16 Ga0070660_100017890 3300005339 Bacteria 5170
17 Ga0070660_100021493 3300005339 Bacteria 4760
18 Ga0070660_100032786 3300005339 Bacteria 3911
19 Ga0070691_10519826 3300005341 Bacteria 691
20 Ga0070661_100060673 3300005344 Bacteria 2775
21 Ga0070661_100451755 3300005344 Bacteria 1022
22 Ga0070661_100477522 3300005344 Bacteria 995
23 Ga0070661_100682614 3300005344 Bacteria 836
24 Ga0070668_100000910 3300005347 Bacteria 20612
25 Ga0070668_100864675 3300005347 Bacteria 806
26 Ga0070669_100065039 3300005353 Bacteria 2686
27 Ga0070669_100374894 3300005353 Bacteria 1159
28 Ga0070669_101308801 3300005353 Bacteria 628
29 Ga0070675_100045847 3300005354 Bacteria 3578
30 Ga0070671_100044442 3300005355 Bacteria 3692
31 Ga0070671_100050351 3300005355 Bacteria 3464
32 Ga0070671_100062973 3300005355 Bacteria 3088
33 Ga0070671_100100295 3300005355 Bacteria 2429
34 Ga0070671_100784576 3300005355 Bacteria 829
35 Ga0070674_100009591 3300005356 Bacteria 5801
36 Ga0070674_100039714 3300005356 Bacteria 3179
37 Ga0070673_100025139 3300005364 Bacteria 4378
38 Ga0070673_100050239 3300005364 Bacteria 3260
39 Ga0070673_101348203 3300005364 Bacteria 671
40 Ga0070659_100030348 3300005366 Bacteria 4184
41 Ga0070659_100073249 3300005366 Bacteria 2726
42 Ga0070659_100542931 3300005366 Bacteria 994
43 Ga0070659_100571260 3300005366 Bacteria 969
44 Ga0070659_101192435 3300005366 Bacteria 673
45 Ga0070667_100023785 3300005367 Bacteria 5086
46 Ga0070667_100042705 3300005367 Bacteria 3804
47 Ga0070667_100160905 3300005367 Bacteria 1977
48 Ga0070711_100409836 3300005439 Bacteria 1102
49 Ga0070663_100000130 3300005455 Bacteria 35749
50 Ga0070663_100177296 3300005455 Bacteria 1651
51 Ga0070663_100893646 3300005455 Bacteria 767
52 Ga0070663_101286402 3300005455 Bacteria 645
53 Ga0070678_100290215 3300005456 Bacteria 1386
54 Ga0070678_101966759 3300005456 Bacteria 553
55 Ga0070662_100011476 3300005457 Bacteria 5848
56 Ga0070662_100080868 3300005457 Bacteria 2420
57 Ga0070662_100408980 3300005457 Bacteria 1121
58 Ga0070679_100476177 3300005530 Bacteria 1193
59 Ga0070679_100721574 3300005530 Bacteria 940
60 Ga0070672_100139639 3300005543 Bacteria 1997
61 Ga0070672_100341221 3300005543 Bacteria 1276
62 Ga0070672_100375422 3300005543 Bacteria 1215
63 Ga0070693_100389123 3300005547 Bacteria 964
64 Ga0070665_100009576 3300005548 Bacteria 9796
65 Ga0070665_100016007 3300005548 Bacteria 7529
66 Ga0070665_100018136 3300005548 Bacteria 7061
67 Ga0070665_100614578 3300005548 Bacteria 1100
68 Ga0070664_100043258 3300005564 Bacteria 3800
69 Ga0070664_100736865 3300005564 Bacteria 919
70 Ga0070664_100923497 3300005564 Bacteria 819
71 Ga0068857_100262142 3300005577 Bacteria 1586
72 Ga0068854_100211886 3300005578 Bacteria 1529
73 Ga0068854_100781476 3300005578 Bacteria 831
74 Ga0068856_100181409 3300005614 Bacteria 2118
75 Ga0068852_100073476 3300005616 Bacteria 3008
76 Ga0068852_101787895 3300005616 Bacteria 637
77 Ga0068859_100017902 3300005617 Bacteria 7122
78 Ga0068859_100993035 3300005617 Bacteria 922
79 Ga0068864_101145052 3300005618 Bacteria 775
80 Ga0068870_10224402 3300005840 Bacteria 1152
81 Ga0068863_100815558 3300005841 Bacteria 931
82 Ga0068858_100211311 3300005842 Bacteria 1836
83 Ga0068858_100230768 3300005842 Bacteria 1755
84 Ga0068860_100054654 3300005843 Bacteria 3795
85 Ga0068860_100496545 3300005843 Bacteria 1218
86 Ga0068862_100147141 3300005844 Bacteria 2094
87 Ga0068862_100859522 3300005844 Bacteria 889
88 Ga0070712_100029852 3300006175 Bacteria 3658
89 Ga0097621_100023662 3300006237 Bacteria 4785
90 Ga0097621_100046600 3300006237 Bacteria 3509
91 Ga0097621_100262911 3300006237 Bacteria 1514
92 Ga0068871_100012040 3300006358 Bacteria 6366
93 Ga0068871_100613758 3300006358 Bacteria 990
94 Ga0075428_101053257 3300006844 Bacteria 860
95 Ga0068865_100333567 3300006881 Bacteria 1224
96 Ga0068865_100741703 3300006881 Bacteria 843
97 Ga0068865_100951506 3300006881 Bacteria 750
98 Ga0097620_100017902 3300006931 Bacteria 7122
99 Ga0097620_100993075 3300006931 Bacteria 922
100 Ga0105248_10009447 3300009177 Bacteria 10736
101 Ga0105249_10328187 3300009553 Bacteria 1543
102 Ga0157374_10004825 3300013296 Bacteria 11314
103 Ga0157374_10130161 3300013296 Bacteria 2435
104 Ga0157374_10784075 3300013296 Bacteria 969
105 Ga0157378_10608869 3300013297 Bacteria 1104
106 Ga0157378_12189637 3300013297 Bacteria 604
107 Ga0163162_10118886 3300013306 Bacteria 2745
108 Ga0163162_10213181 3300013306 Bacteria 2061
109 Ga0157375_10023649 3300013308 Bacteria 5673
110 Ga0157375_10157618 3300013308 Bacteria 2410
111 Ga0157375_10546308 3300013308 Bacteria 1320
112 Ga0157375_11821411 3300013308 Bacteria 722
113 Ga0157377_10732498 3300014745 Bacteria 721
114 Ga0157376_12198976 3300014969 Bacteria 590
115 Ga0207697_10018091 3300025315 Bacteria 2892
116 Ga0207688_10076118 3300025901 Bacteria 1911
117 Ga0207680_10647524 3300025903 Bacteria 756
118 Ga0207645_10000464 3300025907 Bacteria 33570
119 Ga0207645_10359242 3300025907 Bacteria 975
120 Ga0207643_10034139 3300025908 Bacteria 2849
121 Ga0207705_10020370 3300025909 Bacteria 4741
122 Ga0207705_10254267 3300025909 Bacteria 1340
123 Ga0207693_10077901 3300025915 Bacteria 2595
124 Ga0207657_10023419 3300025919 Bacteria 5750
125 Ga0207657_10053989 3300025919 Bacteria 3478
126 Ga0207657_10196173 3300025919 Bacteria 1626
127 Ga0207657_10319067 3300025919 Bacteria 1229
128 Ga0207649_10254179 3300025920 Bacteria 1267
129 Ga0207649_10567375 3300025920 Bacteria 870
130 Ga0207652_10369545 3300025921 Bacteria 1295
131 Ga0207681_10013179 3300025923 Bacteria 5111
132 Ga0207650_10941173 3300025925 Bacteria 734
133 Ga0207659_10261362 3300025926 Bacteria 1408
134 Ga0207644_10030698 3300025931 Bacteria 3739
135 Ga0207644_10699904 3300025931 Bacteria 845
136 Ga0207690_10010474 3300025932 Bacteria 5513
137 Ga0207690_10019787 3300025932 Bacteria 4149
138 Ga0207690_10054590 3300025932 Bacteria 2687
139 Ga0207690_10135357 3300025932 Bacteria 1808
140 Ga0207690_11027618 3300025932 Bacteria 686
141 Ga0207706_10281908 3300025933 Bacteria 1449
142 Ga0207706_10317058 3300025933 Bacteria 1357
143 Ga0207669_10014765 3300025937 Bacteria 3922
144 Ga0207669_10453180 3300025937 Bacteria 1017
145 Ga0207704_10044886 3300025938 Bacteria 2622
146 Ga0207691_10058831 3300025940 Bacteria 3495
147 Ga0207691_10294706 3300025940 Bacteria 1395
148 Ga0207711_10523411 3300025941 Bacteria 1106
149 Ga0207689_10124693 3300025942 Bacteria 2119
150 Ga0207689_10224181 3300025942 Bacteria 1554
151 Ga0207679_10014009 3300025945 Bacteria 5260
152 Ga0207679_10259101 3300025945 Bacteria 1482
153 Ga0207651_10005971 3300025960 Bacteria 6308
154 Ga0207651_10037582 3300025960 Bacteria 3173
155 Ga0207651_10534749 3300025960 Bacteria 1017
156 Ga0207668_10000074 3300025972 Bacteria 75726
157 Ga0207640_11027756 3300025981 Bacteria 726
158 Ga0207658_10023695 3300025986 Bacteria 4287
159 Ga0207658_10059778 3300025986 Bacteria 2841
160 Ga0207658_10262091 3300025986 Bacteria 1473
161 Ga0207658_10649538 3300025986 Bacteria 951
162 Ga0207677_10821097 3300026023 Bacteria 833
163 Ga0207703_10010910 3300026035 Bacteria 7081
164 Ga0207703_10192137 3300026035 Bacteria 1809
165 Ga0207703_10274029 3300026035 Bacteria 1530
166 Ga0207639_10094235 3300026041 Bacteria 2403
167 Ga0207678_10018933 3300026067 Bacteria 6050
168 Ga0207678_10908766 3300026067 Bacteria 778
169 Ga0207702_10539445 3300026078 Bacteria 1140
170 Ga0207648_10029788 3300026089 Bacteria 4840
171 Ga0207676_10062307 3300026095 Bacteria 2958
172 Ga0207676_11582059 3300026095 Bacteria 653
173 Ga0207674_10255665 3300026116 Bacteria 1699
174 Ga0207683_10015723 3300026121 Bacteria 6440
175 Ga0207698_10041185 3300026142 Bacteria 3439
176 Ga0207698_10443500 3300026142 Bacteria 1251
177 Ga0268266_10008818 3300028379 Bacteria 8931
178 Ga0268266_10036354 3300028379 Bacteria 4191
179 Ga0268266_10466640 3300028379 Bacteria 1202
180 Ga0268266_10476323 3300028379 Bacteria 1189
181 Ga0268265_10005676 3300028380 Bacteria 8522
182 Ga0268265_10112627 3300028380 Bacteria 2224
183 Ga0268264_10012327 3300028381 Bacteria 7036
184 Ga0307408_100433678 3300031548 Bacteria 1136
185 Ga0307405_10096060 3300031731 Bacteria 1975
186 Ga0307405_11640790 3300031731 Bacteria 568
187 Ga0307412_10448566 3300031911 Bacteria 1062
188 Ga0307409_100534216 3300031995 Bacteria 1148
189 Ga0307416_100034916 3300032002 Bacteria 3833
190 Ga0307411_10378756 3300032005 Bacteria 1163
191 Ga0307415_100018729 3300032126 Bacteria 4189
192 Ga0307415_100196909 3300032126 Bacteria 1595
193 Ga0307415_100264517 3300032126 Bacteria 1405
194 Ga0373943_0684123 3300035170 Bacteria 607
195 Ga0373937_0041086 3300036401 Bacteria 4219
196 Ga0395899_0001728 3300037312 Bacteria 18162
197 Ga0395899_0056601 3300037312 Bacteria 2898
198 Ga0395899_0085750 3300037312 Bacteria 2288
199 Ga0395899_0089261 3300037312 Bacteria 2236
200 Ga0395900_0003022 3300037418 Bacteria 18307
201 Ga0395900_0011354 3300037418 Bacteria 9112
202 Ga0395900_0085359 3300037418 Bacteria 3244
203 Ga0395900_0130152 3300037418 Bacteria 2579
204 Ga0395900_0162232 3300037418 Bacteria 2279
205 Ga0395900_0231951 3300037418 Bacteria 1856
206 Ga0395900_0398019 3300037418 Bacteria 1342
207 Ga0395898_0405804 3300037466 Bacteria 1299
208 Ga0395905_0000313 3300037471 Bacteria 70446
209 Ga0395905_0016186 3300037471 Bacteria 7087
210 Ga0395905_0066456 3300037471 Bacteria 3377
211 Ga0395905_0202687 3300037471 Bacteria 1860
212 Ga0395905_0359502 3300037471 Bacteria 1348
213 Ga0395905_0473289 3300037471 Bacteria 1152
214 Ga0395905_0853239 3300037471 Bacteria 814
215 Ga0395905_1291244 3300037471 Bacteria 634
216 Ga0395901_0157579 3300038443 Bacteria 2384
217 Ga0395901_0363951 3300038443 Bacteria 1491
218 Ga0395901_0820515 3300038443 Bacteria 917
219 Ga0439448_0216946 3300042005 Bacteria 672
220 Ga0466966_0310810 3300044684 Bacteria 947
221 Ga0466961_0136762 3300044693 Bacteria 1535
222 Ga0466971_0100530 3300044719 Bacteria 1329
223 Ga0466971_0104820 3300044719 Bacteria 1302
224 Ga0466957_0082146 3300044842 Bacteria 2008
225 Ga0466957_0155153 3300044842 Bacteria 1483
226 Ga0466957_0956798 3300044842 Bacteria 614
227 Ga0466967_0234577 3300045976 Bacteria 1748
228 Ga0466967_0311896 3300045976 Bacteria 1515
229 Ga0466967_1240301 3300045976 Bacteria 743
230 Ga0495663_0014629 3300046525 Bacteria 2201
231 Ga0495642_0079936 3300046528 Bacteria 1375
232 Ga0495598_0000266 3300046537 Bacteria 9412
233 Ga0495621_0000031 3300046539 Bacteria 27353
234 Ga0495633_0048170 3300046558 Bacteria 2013
235 Ga0495668_0016929 3300046616 Bacteria 4234
236 Ga0495625_0161676 3300046660 Bacteria 1500
237 Ga0495669_0003272 3300046684 Bacteria 6666
238 Ga0495669_0004514 3300046684 Bacteria 5754
239 Ga0495669_0017535 3300046684 Bacteria 3074
240 Ga0495669_0155313 3300046684 Bacteria 1084
241 Ga0495670_0000562 3300046691 Bacteria 17692
242 Ga0495677_0068853 3300047445 Bacteria 1318
243 Ga0495677_0132455 3300047445 Bacteria 954
244 Ga0496100_0068425 3300048903 Bacteria 2361
245 Ga0496100_0114222 3300048903 Bacteria 1881
246 Ga0496100_0890087 3300048903 Bacteria 699
247 Ga0496101_0001946 3300048904 Bacteria 12509
248 Ga0496101_0760531 3300048904 Bacteria 764
249 Ga0496101_1184298 3300048904 Bacteria 599
250 Ga0496102_0073783 3300048905 Bacteria 3136
251 Ga0496102_0207809 3300048905 Bacteria 1846
252 Ga0496104_0235628 3300048907 Bacteria 1742
253 Ga0496105_0483598 3300048908 Bacteria 974
254 Ga0496105_0651037 3300048908 Bacteria 813
255 Ga0496106_0081528 3300048909 Bacteria 2486
256 Ga0496107_0060288 3300048910 Bacteria 2746
257 Ga0496107_0099692 3300048910 Bacteria 2129
258 Ga0496107_0715711 3300048910 Bacteria 736
259 Ga0496108_0003382 3300048911 Bacteria 12807
260 Ga0496108_0135357 3300048911 Bacteria 2119
261 Ga0496109_0389141 3300048912 Bacteria 1317
262 Ga0496110_0028556 3300048913 Bacteria 4793
263 Ga0496111_0040572 3300048914 Bacteria 3339
264 Ga0496112_1256255 3300048915 Bacteria 657
265 Ga0496113_0028102 3300048916 Bacteria 4041
266 Ga0496114_0046886 3300048917 Bacteria 3592
267 Ga0496124_0711943 3300048927 Bacteria 635
268 Ga0501225_0081089 3300049705 Bacteria 932
269 Ga0495655_0025545 3300053083 Bacteria 1383
270 Ga0500594_0027137 3300053118 Bacteria 1480
271 Ga0466962_0099252 3300061719 Bacteria 1398
272 Ga0501080_0909202
273 JGI24736J21556_1047028
274 JGI24737J22298_10012721
275 JGI24737J22298_10199693
276 rootH1_10038712
277 Ga0070658_10030997
278 Ga0070658_10302387
279 Ga0070658_10567163
280 Ga0070658_10729688
281 Ga0070666_10068168
282 Ga0070680_101428746
283 Ga0070682_100613955
284 Ga0068868_100031389
285 Ga0068868_100067136
286 Ga0068868_100115649
287 Ga0070660_100017890
288 Ga0070660_100021493
289 Ga0070660_100032786
290 Ga0070691_10519826
291 Ga0070661_100060673
292 Ga0070661_100451755
293 Ga0070661_100477522
294 Ga0070661_100682614
295 Ga0070668_100000910
296 Ga0070668_100864675
297 Ga0070669_100065039
298 Ga0070669_100374894
299 Ga0070669_101308801
300 Ga0070675_100045847
301 Ga0070671_100044442
302 Ga0070671_100050351
303 Ga0070671_100062973
304 Ga0070671_100100295
305 Ga0070671_100784576
306 Ga0070674_100009591
307 Ga0070674_100039714
308 Ga0070673_100025139
309 Ga0070673_100050239
310 Ga0070673_101348203
311 Ga0070659_100030348
312 Ga0070659_100073249
313 Ga0070659_100542931
314 Ga0070659_100571260
315 Ga0070659_101192435
316 Ga0070667_100023785
317 Ga0070667_100042705
318 Ga0070667_100160905
319 Ga0070711_100409836
320 Ga0070663_100000130
321 Ga0070663_100177296
322 Ga0070663_100893646
323 Ga0070663_101286402
324 Ga0070678_100290215
325 Ga0070678_101966759
326 Ga0070662_100011476
327 Ga0070662_100080868
328 Ga0070662_100408980
329 Ga0070679_100476177
330 Ga0070679_100721574
331 Ga0070672_100139639
332 Ga0070672_100341221
333 Ga0070672_100375422
334 Ga0070693_100389123
335 Ga0070665_100009576
336 Ga0070665_100016007
337 Ga0070665_100018136
338 Ga0070665_100614578
339 Ga0070664_100043258
340 Ga0070664_100736865
341 Ga0070664_100923497
342 Ga0068857_100262142
343 Ga0068854_100211886
344 Ga0068854_100781476
345 Ga0068856_100181409
346 Ga0068852_100073476
347 Ga0068852_101787895
348 Ga0068859_100017902
349 Ga0068859_100993035
350 Ga0068864_101145052
351 Ga0068870_10224402
352 Ga0068863_100815558
353 Ga0068858_100211311
354 Ga0068858_100230768
355 Ga0068860_100054654
356 Ga0068860_100496545
357 Ga0068862_100147141
358 Ga0068862_100859522
359 Ga0070712_100029852
360 Ga0097621_100023662
361 Ga0097621_100046600
362 Ga0097621_100262911
363 Ga0068871_100012040
364 Ga0068871_100613758
365 Ga0075428_101053257
366 Ga0068865_100333567
367 Ga0068865_100741703
368 Ga0068865_100951506
369 Ga0097620_100017902
370 Ga0097620_100993075
371 Ga0105248_10009447
372 Ga0105249_10328187
373 Ga0157374_10004825
374 Ga0157374_10130161
375 Ga0157374_10784075
376 Ga0157378_10608869
377 Ga0157378_12189637
378 Ga0163162_10118886
379 Ga0163162_10213181
380 Ga0157375_10023649
381 Ga0157375_10157618
382 Ga0157375_10546308
383 Ga0157375_11821411
384 Ga0157377_10732498
385 Ga0157376_12198976
386 Ga0207697_10018091
387 Ga0207688_10076118
388 Ga0207680_10647524
389 Ga0207645_10000464
390 Ga0207645_10359242
391 Ga0207643_10034139
392 Ga0207705_10020370
393 Ga0207705_10254267
394 Ga0207693_10077901
395 Ga0207657_10023419
396 Ga0207657_10053989
397 Ga0207657_10196173
398 Ga0207657_10319067
399 Ga0207649_10254179
400 Ga0207649_10567375
401 Ga0207652_10369545
402 Ga0207681_10013179
403 Ga0207650_10941173
404 Ga0207659_10261362
405 Ga0207644_10030698
406 Ga0207644_10699904
407 Ga0207690_10010474
408 Ga0207690_10019787
409 Ga0207690_10054590
410 Ga0207690_10135357
411 Ga0207690_11027618
412 Ga0207706_10281908
413 Ga0207706_10317058
414 Ga0207669_10014765
415 Ga0207669_10453180
416 Ga0207704_10044886
417 Ga0207691_10058831
418 Ga0207691_10294706
419 Ga0207711_10523411
420 Ga0207689_10124693
421 Ga0207689_10224181
422 Ga0207679_10014009
423 Ga0207679_10259101
424 Ga0207651_10005971
425 Ga0207651_10037582
426 Ga0207651_10534749
427 Ga0207668_10000074
428 Ga0207640_11027756
429 Ga0207658_10023695
430 Ga0207658_10059778
431 Ga0207658_10262091
432 Ga0207658_10649538
433 Ga0207677_10821097
434 Ga0207703_10010910
435 Ga0207703_10192137
436 Ga0207703_10274029
437 Ga0207639_10094235
438 Ga0207678_10018933
439 Ga0207678_10908766
440 Ga0207702_10539445
441 Ga0207648_10029788
442 Ga0207676_10062307
443 Ga0207676_11582059
444 Ga0207674_10255665
445 Ga0207683_10015723
446 Ga0207698_10041185
447 Ga0207698_10443500
448 Ga0268266_10008818
449 Ga0268266_10036354
450 Ga0268266_10466640
451 Ga0268266_10476323
452 Ga0268265_10005676
453 Ga0268265_10112627
454 Ga0268264_10012327
455 Ga0307408_100433678
456 Ga0307405_10096060
457 Ga0307405_11640790
458 Ga0307412_10448566
459 Ga0307409_100534216
460 Ga0307416_100034916
461 Ga0307411_10378756
462 Ga0307415_100018729
463 Ga0307415_100196909
464 Ga0307415_100264517
465 Ga0373943_0684123
466 Ga0373937_0041086
467 Ga0395899_0001728
468 Ga0395899_0056601
469 Ga0395899_0085750
470 Ga0395899_0089261
471 Ga0395900_0003022
472 Ga0395900_0011354
473 Ga0395900_0085359
474 Ga0395900_0130152
475 Ga0395900_0162232
476 Ga0395900_0231951
477 Ga0395900_0398019
478 Ga0395898_0405804
479 Ga0395905_0000313
480 Ga0395905_0016186
481 Ga0395905_0066456
482 Ga0395905_0202687
483 Ga0395905_0359502
484 Ga0395905_0473289
485 Ga0395905_0853239
486 Ga0395905_1291244
487 Ga0395901_0157579
488 Ga0395901_0363951
489 Ga0395901_0820515
490 Ga0439448_0216946
491 Ga0466966_0310810
492 Ga0466961_0136762
493 Ga0466971_0100530
494 Ga0466971_0104820
495 Ga0466957_0082146
496 Ga0466957_0155153
497 Ga0466957_0956798
498 Ga0466967_0234577
499 Ga0466967_0311896
500 Ga0466967_1240301
501 Ga0495663_0014629
502 Ga0495642_0079936
503 Ga0495598_0000266
504 Ga0495621_0000031
505 Ga0495633_0048170
506 Ga0495668_0016929
507 Ga0495625_0161676
508 Ga0495669_0003272
509 Ga0495669_0004514
510 Ga0495669_0017535
511 Ga0495669_0155313
512 Ga0495670_0000562
513 Ga0495677_0068853
514 Ga0495677_0132455
515 Ga0496100_0068425
516 Ga0496100_0114222
517 Ga0496100_0890087
518 Ga0496101_0001946
519 Ga0496101_0760531
520 Ga0496101_1184298
521 Ga0496102_0073783
522 Ga0496102_0207809
523 Ga0496104_0235628
524 Ga0496105_0483598
525 Ga0496105_0651037
526 Ga0496106_0081528
527 Ga0496107_0060288
528 Ga0496107_0099692
529 Ga0496107_0715711
530 Ga0496108_0003382
531 Ga0496108_0135357
532 Ga0496109_0389141
533 Ga0496110_0028556
534 Ga0496111_0040572
535 Ga0496112_1256255
536 Ga0496113_0028102
537 Ga0496114_0046886
538 Ga0496124_0711943
539 Ga0501225_0081089
540 Ga0495655_0025545
541 Ga0500594_0027137
542 Ga0466962_0099252

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

18

144

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.9011 34 122
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.8331 48 121
1sr3-assembly1.cif.gz_A solution structure of the heme chaperone ccme of escherichia coli 0.8053 33 133
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8014 34 122
6kct-assembly2.cif.gz_C crystal structure of plasmodium lysyl-trna synthetase in complex with a cladosporin derivative 5 0.8001 47 120
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9011 34 122 2.40.50.140
af_Q2FY46_5_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8424 52 119 2.40.50.140
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8331 48 121 2.40.50.140
af_A0A0R4IAS3_25_130_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8222 32 120 2.40.50.140
3f8tA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8086 49 122 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A5W4VQ91-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9611 33 120 GO:0005886
GO:0017004
GO:0020037
AF-A0A836VMP7-F1-model_v4 Cytochrome c maturation protein CcmE 0.9338 1 124 GO:0005886
GO:0017004
GO:0020037
AF-A0A1G0BHU8-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9298 1 107 GO:0005886
GO:0017004
GO:0020037
AF-A0A367MDS7-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.9282 21 138 GO:0005886
GO:0017004
GO:0020037
GO:0022857
GO:0046872
AF-A0A520HNB2-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9272 1 115 GO:0005886
GO:0017004
GO:0020037

Map