F377867
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 271 | 139 | 264 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0025376|Ga0495638_0025376_339_923 |
| Length | 194 |
| Sequence | MNNPYFLKAYKNKICIYISAYINCIMNLYQSLGHLVLGSRLRRLSEAFLAEINRAYQTAGIDFDASWFPVFYLLSKNDALSIKELSEQIEVSHPAASQLITNLKKRGLVSTDTCTDDGRRQLVTLTADGRDLLKQVLPVWDAISLSMAELVAEDKTAQQLLPAISALESVFRQTKLADNIVEKLNTNLKPAGND |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 3 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 4 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 5 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 6 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 7 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 8 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 63 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 97 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 98 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 99 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 100 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 101 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 102 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 103 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 104 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 105 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 106 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 134 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 135 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 136 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 137 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 138 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 139 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.42 |
| Metatranscriptomes | 0 |
| Isolates | 2.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.64 |
| Nodule | 0 |
| Rhizoplane | 0.37 |
| Rhizosphere | 85.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10046753 | 3300001979 | Bacteria | 1268 |
| 2 | JGI24737J22298_10000384 | 3300001990 | Bacteria | 15070 |
| 3 | JGI24737J22298_10048560 | 3300001990 | Bacteria | 1292 |
| 4 | JGI24735J21928_10000003 | 3300002067 | Bacteria | 385983 |
| 5 | JGI24744J21845_10006647 | 3300002077 | Bacteria | 2394 |
| 6 | JGI25162J39368_1000158 | 3300002737 | Bacteria | 74916 |
| 7 | JGI25162J39368_1001096 | 3300002737 | Bacteria | 16465 |
| 8 | JGI25165J46597_1000621 | 3300003214 | Bacteria | 29774 |
| 9 | rootH1_10019188 | 3300003316 | Bacteria | 26527 |
| 10 | rootH1_10145809 | 3300003316 | Bacteria | 1504 |
| 11 | rootH2_10000984 | 3300003320 | Bacteria | 89440 |
| 12 | rootH2_10002146 | 3300003320 | Bacteria | 11415 |
| 13 | rootL2_10079530 | 3300003322 | Bacteria | 2715 |
| 14 | rootL2_10084996 | 3300003322 | Bacteria | 3495 |
| 15 | rootL2_10282345 | 3300003322 | Bacteria | 1199 |
| 16 | rootH1_10020603 | 3300003323 | Bacteria | 10847 |
| 17 | rootH1_10189863 | 3300003323 | Bacteria | 1988 |
| 18 | rootH1_10219201 | 3300003323 | Bacteria | 2502 |
| 19 | rootH1_10280957 | 3300003323 | Bacteria | 1079 |
| 20 | rootH1_10307452 | 3300003323 | Bacteria | 1904 |
| 21 | Ga0065715_10405310 | 3300005293 | Bacteria | 876 |
| 22 | Ga0070658_10000635 | 3300005327 | Bacteria | 30331 |
| 23 | Ga0070676_10008922 | 3300005328 | Bacteria | 5421 |
| 24 | Ga0070676_10068585 | 3300005328 | Bacteria | 2123 |
| 25 | Ga0068868_100048894 | 3300005338 | Bacteria | 3319 |
| 26 | Ga0068868_100068302 | 3300005338 | Bacteria | 2830 |
| 27 | Ga0068868_100760792 | 3300005338 | Bacteria | 871 |
| 28 | Ga0070660_100043543 | 3300005339 | Bacteria | 3431 |
| 29 | Ga0070671_100009095 | 3300005355 | Bacteria | 7973 |
| 30 | Ga0070673_100010930 | 3300005364 | Bacteria | 6173 |
| 31 | Ga0070659_100728493 | 3300005366 | Bacteria | 859 |
| 32 | Ga0070678_100012924 | 3300005456 | Bacteria | 5213 |
| 33 | Ga0070662_100000053 | 3300005457 | Bacteria | 61062 |
| 34 | Ga0068867_100001837 | 3300005459 | Bacteria | 14782 |
| 35 | Ga0070685_10365224 | 3300005466 | Bacteria | 990 |
| 36 | Ga0070679_100161756 | 3300005530 | Bacteria | 2213 |
| 37 | Ga0068853_100020402 | 3300005539 | Bacteria | 5512 |
| 38 | Ga0068853_100376797 | 3300005539 | Bacteria | 1324 |
| 39 | Ga0068853_100443819 | 3300005539 | Bacteria | 1220 |
| 40 | Ga0070672_100133950 | 3300005543 | Bacteria | 2039 |
| 41 | Ga0070665_100000096 | 3300005548 | Bacteria | 166864 |
| 42 | Ga0070665_100563999 | 3300005548 | Bacteria | 1151 |
| 43 | Ga0068855_100000185 | 3300005563 | Bacteria | 79849 |
| 44 | Ga0068855_100000286 | 3300005563 | Bacteria | 62438 |
| 45 | Ga0068855_100019885 | 3300005563 | Bacteria | 8064 |
| 46 | Ga0068855_100242048 | 3300005563 | Bacteria | 2015 |
| 47 | Ga0068855_100279289 | 3300005563 | Bacteria | 1855 |
| 48 | Ga0070664_100419326 | 3300005564 | Bacteria | 1226 |
| 49 | Ga0068856_100000095 | 3300005614 | Bacteria | 84075 |
| 50 | Ga0068856_100029531 | 3300005614 | Bacteria | 5355 |
| 51 | Ga0068856_100086985 | 3300005614 | Bacteria | 3106 |
| 52 | Ga0068856_100581420 | 3300005614 | Bacteria | 1141 |
| 53 | Ga0068856_101163624 | 3300005614 | Bacteria | 788 |
| 54 | Ga0068852_100019196 | 3300005616 | Bacteria | 5403 |
| 55 | Ga0068852_100401577 | 3300005616 | Bacteria | 1348 |
| 56 | Ga0068866_10547199 | 3300005718 | Bacteria | 773 |
| 57 | Ga0097621_100001259 | 3300006237 | Bacteria | 17505 |
| 58 | Ga0068871_100004706 | 3300006358 | Bacteria | 9544 |
| 59 | Ga0068865_100000143 | 3300006881 | Bacteria | 37973 |
| 60 | Ga0105240_10000892 | 3300009093 | Bacteria | 53531 |
| 61 | Ga0105240_10003529 | 3300009093 | Bacteria | 24265 |
| 62 | Ga0105240_10074465 | 3300009093 | Bacteria | 4191 |
| 63 | Ga0105240_10092017 | 3300009093 | Bacteria | 3704 |
| 64 | Ga0105240_10097003 | 3300009093 | Bacteria | 3592 |
| 65 | Ga0105240_10504201 | 3300009093 | Bacteria | 1345 |
| 66 | Ga0105240_10611801 | 3300009093 | Bacteria | 1198 |
| 67 | Ga0105240_10841338 | 3300009093 | Bacteria | 991 |
| 68 | Ga0105240_11447686 | 3300009093 | Bacteria | 721 |
| 69 | Ga0105240_11901283 | 3300009093 | Unclassified | 619 |
| 70 | Ga0105245_10085867 | 3300009098 | Bacteria | 2885 |
| 71 | Ga0105243_10018871 | 3300009148 | Bacteria | 5229 |
| 72 | Ga0105241_10001505 | 3300009174 | Bacteria | 17872 |
| 73 | Ga0105241_10009402 | 3300009174 | Bacteria | 7182 |
| 74 | Ga0105241_10028655 | 3300009174 | Bacteria | 4149 |
| 75 | Ga0105241_10443215 | 3300009174 | Bacteria | 1147 |
| 76 | Ga0105241_10814712 | 3300009174 | Bacteria | 861 |
| 77 | Ga0105242_10010787 | 3300009176 | Bacteria | 7015 |
| 78 | Ga0105242_10336083 | 3300009176 | Bacteria | 1390 |
| 79 | Ga0105237_10000400 | 3300009545 | Bacteria | 61626 |
| 80 | Ga0105237_10002087 | 3300009545 | Bacteria | 25279 |
| 81 | Ga0105237_10002113 | 3300009545 | Bacteria | 25080 |
| 82 | Ga0105237_10012888 | 3300009545 | Bacteria | 8786 |
| 83 | Ga0105237_10031940 | 3300009545 | Bacteria | 5332 |
| 84 | Ga0105237_10042308 | 3300009545 | Bacteria | 4595 |
| 85 | Ga0105237_10197158 | 3300009545 | Bacteria | 2013 |
| 86 | Ga0105237_10256678 | 3300009545 | Bacteria | 1750 |
| 87 | Ga0105237_10263793 | 3300009545 | Bacteria | 1725 |
| 88 | Ga0105237_11005962 | 3300009545 | Unclassified | 840 |
| 89 | Ga0105237_11271222 | 3300009545 | Bacteria | 742 |
| 90 | Ga0105238_10008829 | 3300009551 | Bacteria | 10082 |
| 91 | Ga0105238_10091493 | 3300009551 | Bacteria | 3029 |
| 92 | Ga0105239_10000009 | 3300010375 | Bacteria | 361182 |
| 93 | Ga0105239_10000278 | 3300010375 | Bacteria | 75485 |
| 94 | Ga0105239_10004037 | 3300010375 | Bacteria | 17755 |
| 95 | Ga0105239_10007160 | 3300010375 | Bacteria | 12837 |
| 96 | Ga0105239_10021966 | 3300010375 | Bacteria | 7033 |
| 97 | Ga0105239_10024404 | 3300010375 | Bacteria | 6662 |
| 98 | Ga0105239_10078007 | 3300010375 | Bacteria | 3645 |
| 99 | Ga0105239_10157698 | 3300010375 | Bacteria | 2535 |
| 100 | Ga0105239_10191411 | 3300010375 | Bacteria | 2290 |
| 101 | Ga0105239_10472406 | 3300010375 | Bacteria | 1424 |
| 102 | Ga0105246_10375972 | 3300011119 | Bacteria | 1172 |
| 103 | Ga0105246_10455455 | 3300011119 | Bacteria | 1076 |
| 104 | Ga0157373_10065336 | 3300013100 | Bacteria | 2574 |
| 105 | Ga0157371_10041155 | 3300013102 | Bacteria | 3298 |
| 106 | Ga0157371_10195120 | 3300013102 | Bacteria | 1450 |
| 107 | Ga0157371_10405184 | 3300013102 | Bacteria | 998 |
| 108 | Ga0157370_11181859 | 3300013104 | Bacteria | 690 |
| 109 | Ga0157369_10141121 | 3300013105 | Bacteria | 2549 |
| 110 | Ga0157369_10271975 | 3300013105 | Bacteria | 1765 |
| 111 | Ga0157374_10009732 | 3300013296 | Bacteria | 8253 |
| 112 | Ga0157374_10060919 | 3300013296 | Bacteria | 3533 |
| 113 | Ga0157378_10034210 | 3300013297 | Bacteria | 4494 |
| 114 | Ga0157378_10035964 | 3300013297 | Bacteria | 4383 |
| 115 | Ga0157378_11481529 | 3300013297 | Bacteria | 723 |
| 116 | Ga0163162_10000005 | 3300013306 | Bacteria | 447195 |
| 117 | Ga0163162_10036606 | 3300013306 | Bacteria | 4893 |
| 118 | Ga0163162_10257844 | 3300013306 | Bacteria | 1875 |
| 119 | Ga0163162_10428615 | 3300013306 | Bacteria | 1455 |
| 120 | Ga0157372_10000514 | 3300013307 | Bacteria | 42626 |
| 121 | Ga0157372_10180254 | 3300013307 | Bacteria | 2445 |
| 122 | Ga0157375_10004654 | 3300013308 | Bacteria | 11930 |
| 123 | Ga0157375_10012824 | 3300013308 | Bacteria | 7444 |
| 124 | Ga0157375_10012859 | 3300013308 | Bacteria | 7435 |
| 125 | Ga0157375_10185659 | 3300013308 | Bacteria | 2232 |
| 126 | Ga0157377_10089997 | 3300014745 | Bacteria | 1810 |
| 127 | Ga0163161_10045823 | 3300017792 | Bacteria | 3155 |
| 128 | Ga0163161_10800059 | 3300017792 | Bacteria | 792 |
| 129 | Ga0213872_10070289 | 3300021361 | Bacteria | 1578 |
| 130 | Ga0207427_100376 | 3300025231 | Bacteria | 27182 |
| 131 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 132 | Ga0209437_100280 | 3300025233 | Bacteria | 74968 |
| 133 | Ga0209026_1001758 | 3300025250 | Bacteria | 8978 |
| 134 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 135 | Ga0209455_1002242 | 3300025272 | Bacteria | 7606 |
| 136 | Ga0207642_10222184 | 3300025899 | Bacteria | 1056 |
| 137 | Ga0207647_10000752 | 3300025904 | Bacteria | 25389 |
| 138 | Ga0207647_10326161 | 3300025904 | Bacteria | 871 |
| 139 | Ga0207645_10001524 | 3300025907 | Bacteria | 18934 |
| 140 | Ga0207705_10000636 | 3300025909 | Bacteria | 29355 |
| 141 | Ga0207705_10396228 | 3300025909 | Bacteria | 1067 |
| 142 | Ga0207654_10020277 | 3300025911 | Bacteria | 3522 |
| 143 | Ga0207695_10000267 | 3300025913 | Bacteria | 131133 |
| 144 | Ga0207695_10003248 | 3300025913 | Bacteria | 23126 |
| 145 | Ga0207695_10039229 | 3300025913 | Bacteria | 5091 |
| 146 | Ga0207695_10340110 | 3300025913 | Bacteria | 1388 |
| 147 | Ga0207695_10432917 | 3300025913 | Bacteria | 1199 |
| 148 | Ga0207671_10004100 | 3300025914 | Bacteria | 14098 |
| 149 | Ga0207671_10004658 | 3300025914 | Bacteria | 12986 |
| 150 | Ga0207671_10006434 | 3300025914 | Bacteria | 10460 |
| 151 | Ga0207671_10009606 | 3300025914 | Bacteria | 8064 |
| 152 | Ga0207671_10081135 | 3300025914 | Bacteria | 2432 |
| 153 | Ga0207671_10086698 | 3300025914 | Bacteria | 2354 |
| 154 | Ga0207671_10354195 | 3300025914 | Bacteria | 1164 |
| 155 | Ga0207671_10399803 | 3300025914 | Bacteria | 1092 |
| 156 | Ga0207671_10792065 | 3300025914 | Bacteria | 752 |
| 157 | Ga0207657_10064255 | 3300025919 | Bacteria | 3133 |
| 158 | Ga0207657_10202249 | 3300025919 | Bacteria | 1597 |
| 159 | Ga0207694_10136129 | 3300025924 | Bacteria | 1973 |
| 160 | Ga0207644_10031382 | 3300025931 | Bacteria | 3701 |
| 161 | Ga0207690_10693364 | 3300025932 | Bacteria | 837 |
| 162 | Ga0207706_10000444 | 3300025933 | Bacteria | 44162 |
| 163 | Ga0207686_10149274 | 3300025934 | Bacteria | 1625 |
| 164 | Ga0207704_10000143 | 3300025938 | Bacteria | 38321 |
| 165 | Ga0207691_10359582 | 3300025940 | Bacteria | 1245 |
| 166 | Ga0207679_10594423 | 3300025945 | Bacteria | 997 |
| 167 | Ga0207667_10000136 | 3300025949 | Bacteria | 111470 |
| 168 | Ga0207667_10000204 | 3300025949 | Bacteria | 84991 |
| 169 | Ga0207667_10081929 | 3300025949 | Bacteria | 3343 |
| 170 | Ga0207667_10203619 | 3300025949 | Bacteria | 2030 |
| 171 | Ga0207667_10236818 | 3300025949 | Bacteria | 1868 |
| 172 | Ga0207651_10162663 | 3300025960 | Bacteria | 1751 |
| 173 | Ga0207651_10544638 | 3300025960 | Bacteria | 1008 |
| 174 | Ga0207677_10038949 | 3300026023 | Bacteria | 3121 |
| 175 | Ga0207677_10142890 | 3300026023 | Bacteria | 1835 |
| 176 | Ga0207639_10163857 | 3300026041 | Bacteria | 1876 |
| 177 | Ga0207639_10293360 | 3300026041 | Bacteria | 1435 |
| 178 | Ga0207708_10909057 | 3300026075 | Bacteria | 762 |
| 179 | Ga0207702_10006023 | 3300026078 | Bacteria | 10523 |
| 180 | Ga0207702_10074071 | 3300026078 | Bacteria | 2938 |
| 181 | Ga0207702_10102282 | 3300026078 | Bacteria | 2532 |
| 182 | Ga0207702_10751889 | 3300026078 | Bacteria | 962 |
| 183 | Ga0207702_11140294 | 3300026078 | Bacteria | 774 |
| 184 | Ga0207648_10003162 | 3300026089 | Bacteria | 17356 |
| 185 | Ga0207683_10004403 | 3300026121 | Bacteria | 12176 |
| 186 | Ga0207698_10005312 | 3300026142 | Bacteria | 7937 |
| 187 | Ga0207698_10840006 | 3300026142 | Bacteria | 923 |
| 188 | Ga0268266_10000032 | 3300028379 | Bacteria | 395079 |
| 189 | Ga0268266_10478916 | 3300028379 | Bacteria | 1186 |
| 190 | Ga0307515_10002118 | 3300028794 | Bacteria | 43514 |
| 191 | Ga0307515_10317153 | 3300028794 | Bacteria | 1228 |
| 192 | Ga0265338_10120110 | 3300028800 | Bacteria | 2097 |
| 193 | Ga0265338_10395898 | 3300028800 | Bacteria | 985 |
| 194 | Ga0307509_10032255 | 3300031507 | Bacteria | 5773 |
| 195 | Ga0307507_10004880 | 3300033179 | Bacteria | 22985 |
| 196 | Ga0307510_10000714 | 3300033180 | Bacteria | 34043 |
| 197 | Ga0395899_0000050 | 3300037312 | Bacteria | 224591 |
| 198 | Ga0395900_0000139 | 3300037418 | Bacteria | 122708 |
| 199 | Ga0395900_0003170 | 3300037418 | Bacteria | 17833 |
| 200 | Ga0395900_0035528 | 3300037418 | Bacteria | 5133 |
| 201 | Ga0395898_0102943 | 3300037466 | Bacteria | 2740 |
| 202 | Ga0395898_0188541 | 3300037466 | Bacteria | 1971 |
| 203 | Ga0395905_0000169 | 3300037471 | Bacteria | 106579 |
| 204 | Ga0395905_0003831 | 3300037471 | Bacteria | 15891 |
| 205 | Ga0395901_0002154 | 3300038443 | Bacteria | 20114 |
| 206 | Ga0395901_0004810 | 3300038443 | Bacteria | 13624 |
| 207 | Ga0436361_1158472 | 3300039447 | Bacteria | 8341 |
| 208 | Ga0466966_0056071 | 3300044684 | Bacteria | 2494 |
| 209 | Ga0495638_0025376 | 3300046460 | Bacteria | 3854 |
| 210 | Ga0495651_0344115 | 3300046462 | Bacteria | 987 |
| 211 | Ga0495650_0000107 | 3300046471 | Bacteria | 200864 |
| 212 | Ga0495650_0128487 | 3300046471 | Bacteria | 926 |
| 213 | Ga0495605_0109939 | 3300046474 | Bacteria | 1259 |
| 214 | Ga0495585_0000014 | 3300046492 | Bacteria | 187513 |
| 215 | Ga0495585_0004514 | 3300046492 | Bacteria | 9019 |
| 216 | Ga0495596_0025311 | 3300046500 | Bacteria | 2400 |
| 217 | Ga0495583_0006417 | 3300046506 | Bacteria | 7696 |
| 218 | Ga0495583_0119588 | 3300046506 | Bacteria | 1110 |
| 219 | Ga0495606_0000303 | 3300046507 | Bacteria | 84874 |
| 220 | Ga0495606_0008687 | 3300046507 | Bacteria | 8751 |
| 221 | Ga0495606_0117433 | 3300046507 | Bacteria | 1596 |
| 222 | Ga0495610_0003081 | 3300046512 | Bacteria | 13312 |
| 223 | Ga0495616_0002195 | 3300046513 | Bacteria | 13047 |
| 224 | Ga0495631_0008313 | 3300046518 | Bacteria | 5230 |
| 225 | Ga0495631_0199773 | 3300046518 | Bacteria | 855 |
| 226 | Ga0495637_0026235 | 3300046520 | Bacteria | 2618 |
| 227 | Ga0495648_0006357 | 3300046524 | Bacteria | 9657 |
| 228 | Ga0495648_0335766 | 3300046524 | Bacteria | 695 |
| 229 | Ga0495609_0024881 | 3300046538 | Bacteria | 2745 |
| 230 | Ga0495622_0006876 | 3300046557 | Bacteria | 5281 |
| 231 | Ga0495633_0000015 | 3300046558 | Bacteria | 254484 |
| 232 | Ga0495633_0021073 | 3300046558 | Bacteria | 3265 |
| 233 | Ga0495668_0000010 | 3300046616 | Bacteria | 487308 |
| 234 | Ga0495668_0060201 | 3300046616 | Bacteria | 2095 |
| 235 | Ga0495625_0000021 | 3300046660 | Bacteria | 282133 |
| 236 | Ga0495625_0002809 | 3300046660 | Bacteria | 18347 |
| 237 | Ga0495625_0003409 | 3300046660 | Bacteria | 15897 |
| 238 | Ga0495625_0333912 | 3300046660 | Bacteria | 962 |
| 239 | Ga0495625_0736308 | 3300046660 | Bacteria | 579 |
| 240 | Ga0495661_0001335 | 3300046665 | Bacteria | 20928 |
| 241 | Ga0495661_0013773 | 3300046665 | Bacteria | 5426 |
| 242 | Ga0495658_0536317 | 3300046683 | Bacteria | 749 |
| 243 | Ga0495649_0000009 | 3300046694 | Bacteria | 451725 |
| 244 | Ga0495649_0112658 | 3300046694 | Bacteria | 1442 |
| 245 | Ga0495683_0043106 | 3300047323 | Bacteria | 2273 |
| 246 | Ga0495687_019948 | 3300047443 | Bacteria | 3276 |
| 247 | Ga0495687_030648 | 3300047443 | Bacteria | 2475 |
| 248 | Ga0495687_036641 | 3300047443 | Bacteria | 2193 |
| 249 | Ga0495677_0011031 | 3300047445 | Bacteria | 3311 |
| 250 | Ga0495673_0021368 | 3300047469 | Bacteria | 3197 |
| 251 | Ga0495686_0001677 | 3300047472 | Bacteria | 23025 |
| 252 | Ga0495686_0021695 | 3300047472 | Bacteria | 4260 |
| 253 | Ga0495686_0199105 | 3300047472 | Bacteria | 1150 |
| 254 | Ga0495682_0027455 | 3300049460 | Bacteria | 2111 |
| 255 | nmdc:mga07m45_138636_c1 | 3300050496 | Bacteria | 1408 |
| 256 | Ga0500608_003670 | 3300053122 | Bacteria | 5803 |
| 257 | Ga0500608_077727 | 3300053122 | Bacteria | 1571 |
| 258 | Ga0500618_000057 | 3300053125 | Bacteria | 98383 |
| 259 | Ga0500618_022162 | 3300053125 | Bacteria | 1545 |
| 260 | Ga0500642_0025900 | 3300053130 | Bacteria | 2388 |
| 261 | Ga0500561_0086584 | 3300053137 | Bacteria | 921 |
| 262 | Ga0500622_0001792 | 3300053156 | Bacteria | 16380 |
| 263 | Ga0500622_0057569 | 3300053156 | Bacteria | 1988 |
| 264 | Ga0500624_001370 | 3300053157 | Bacteria | 4081 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026075 | Ga0207708_10909057 | Ga0207708_109090571 | 127 |
| 2 | 3300037418 | Ga0395900_0000139 | Ga0395900_0000139_59649_60161 | 146 |
| 3 | 3300009174 | Ga0105241_10814712 | Ga0105241_108147121 | 147 |
| 4 | 3300046492 | Ga0495585_0004514 | Ga0495585_0004514_379_888 | 147 |
| 5 | 3300046524 | Ga0495648_0006357 | Ga0495648_0006357_2691_3200 | 147 |
| 6 | 3300046557 | Ga0495622_0006876 | Ga0495622_0006876_2022_2531 | 147 |
| 7 | 3300046616 | Ga0495668_0000010 | Ga0495668_0000010_376025_376534 | 147 |
| 8 | 3300046660 | Ga0495625_0003409 | Ga0495625_0003409_11013_11522 | 147 |
| 9 | 3300046683 | Ga0495658_0536317 | Ga0495658_0536317_117_626 | 147 |
| 10 | 3300049460 | Ga0495682_0027455 | Ga0495682_0027455_925_1434 | 147 |
| 11 | 3300053137 | Ga0500561_0086584 | Ga0500561_0086584_14_523 | 148 |
| 12 | 3300009545 | Ga0105237_10012888 | Ga0105237_100128886 | 150 |
| 13 | 3300010375 | Ga0105239_10021966 | Ga0105239_100219663 | 150 |
| 14 | 3300017792 | Ga0163161_10045823 | Ga0163161_100458231 | 150 |
| 15 | 3300025914 | Ga0207671_10004658 | Ga0207671_100046587 | 150 |
| 16 | 3300013308 | Ga0157375_10185659 | Ga0157375_101856592 | 151 |
| 17 | 3300005614 | Ga0068856_100000095 | Ga0068856_10000009538 | 153 |
| 18 | 3300026078 | Ga0207702_10006023 | Ga0207702_100060233 | 153 |
| 19 | 3300046558 | Ga0495633_0000015 | Ga0495633_0000015_170234_170743 | 153 |
| 20 | 3300003323 | rootH1_10280957 | rootH1_102809572 | 154 |
| 21 | 3300005614 | Ga0068856_100086985 | Ga0068856_1000869853 | 154 |
| 22 | 3300009093 | Ga0105240_10000892 | Ga0105240_1000089226 | 155 |
| 23 | 3300010375 | Ga0105239_10024404 | Ga0105239_100244046 | 155 |
| 24 | 3300025913 | Ga0207695_10000267 | Ga0207695_10000267103 | 155 |
| 25 | 3300028794 | Ga0307515_10002118 | Ga0307515_100021187 | 155 |
| 26 | 3300053125 | Ga0500618_022162 | Ga0500618_022162_56_565 | 155 |
| 27 | iso_pu_bacteria | 2852623160 | 2852627130 | 155 |
| 28 | iso_pu_bacteria | 2884933994 | 2884935934 | 155 |
| 29 | iso_pu_bacteria | 2599185184 | 2599479659 | 156 |
| 30 | iso_pu_bacteria | 2919437846 | 2919437930 | 156 |
| 31 | iso_pu_bacteria | 2928078545 | 2928083785 | 156 |
| 32 | iso_pu_bacteria | 2928147474 | 2928152226 | 156 |
| 33 | iso_pu_bacteria | 2932082852 | 2932084789 | 156 |
| 34 | 3300009093 | Ga0105240_10074465 | Ga0105240_100744652 | 157 |
| 35 | 3300003316 | rootH1_10145809 | rootH1_101458092 | 159 |
| 36 | 3300003323 | rootH1_10307452 | rootH1_103074522 | 159 |
| 37 | 3300005614 | Ga0068856_100029531 | Ga0068856_1000295312 | 159 |
| 38 | 3300026078 | Ga0207702_10074071 | Ga0207702_100740712 | 159 |
| 39 | 3300037418 | Ga0395900_0035528 | Ga0395900_0035528_2829_3335 | 159 |
| 40 | 3300037466 | Ga0395898_0102943 | Ga0395898_0102943_1624_2130 | 159 |
| 41 | 3300037471 | Ga0395905_0000169 | Ga0395905_0000169_105149_105655 | 159 |
| 42 | 3300038443 | Ga0395901_0002154 | Ga0395901_0002154_11649_12155 | 159 |
| 43 | 3300046474 | Ga0495605_0109939 | Ga0495605_0109939_567_1070 | 159 |
| 44 | 3300046665 | Ga0495661_0001335 | Ga0495661_0001335_14229_14732 | 159 |
| 45 | 3300001979 | JGI24740J21852_10046753 | JGI24740J21852_100467532 | 160 |
| 46 | 3300001990 | JGI24737J22298_10000384 | JGI24737J22298_1000038418 | 160 |
| 47 | 3300001990 | JGI24737J22298_10048560 | JGI24737J22298_100485602 | 160 |
| 48 | 3300002067 | JGI24735J21928_10000003 | JGI24735J21928_10000003107 | 160 |
| 49 | 3300002077 | JGI24744J21845_10006647 | JGI24744J21845_100066472 | 160 |
| 50 | 3300002737 | JGI25162J39368_1000158 | JGI25162J39368_100015866 | 160 |
| 51 | 3300002737 | JGI25162J39368_1001096 | JGI25162J39368_100109618 | 160 |
| 52 | 3300003214 | JGI25165J46597_1000621 | JGI25165J46597_100062118 | 160 |
| 53 | 3300003316 | rootH1_10019188 | rootH1_1001918821 | 160 |
| 54 | 3300003320 | rootH2_10000984 | rootH2_1000098416 | 160 |
| 55 | 3300003320 | rootH2_10002146 | rootH2_1000214611 | 160 |
| 56 | 3300003322 | rootL2_10079530 | rootL2_100795302 | 160 |
| 57 | 3300003322 | rootL2_10084996 | rootL2_100849962 | 160 |
| 58 | 3300003322 | rootL2_10282345 | rootL2_102823452 | 160 |
| 59 | 3300003323 | rootH1_10020603 | rootH1_100206032 | 160 |
| 60 | 3300003323 | rootH1_10189863 | rootH1_101898631 | 160 |
| 61 | 3300003323 | rootH1_10219201 | rootH1_102192013 | 160 |
| 62 | 3300005293 | Ga0065715_10405310 | Ga0065715_104053101 | 160 |
| 63 | 3300005327 | Ga0070658_10000635 | Ga0070658_1000063516 | 160 |
| 64 | 3300005328 | Ga0070676_10008922 | Ga0070676_100089222 | 160 |
| 65 | 3300005328 | Ga0070676_10068585 | Ga0070676_100685852 | 160 |
| 66 | 3300005338 | Ga0068868_100048894 | Ga0068868_1000488942 | 160 |
| 67 | 3300005338 | Ga0068868_100068302 | Ga0068868_1000683022 | 160 |
| 68 | 3300005338 | Ga0068868_100760792 | Ga0068868_1007607921 | 160 |
| 69 | 3300005339 | Ga0070660_100043543 | Ga0070660_1000435434 | 160 |
| 70 | 3300005355 | Ga0070671_100009095 | Ga0070671_1000090958 | 160 |
| 71 | 3300005364 | Ga0070673_100010930 | Ga0070673_1000109303 | 160 |
| 72 | 3300005366 | Ga0070659_100728493 | Ga0070659_1007284932 | 160 |
| 73 | 3300005456 | Ga0070678_100012924 | Ga0070678_1000129242 | 160 |
| 74 | 3300005457 | Ga0070662_100000053 | Ga0070662_10000005320 | 160 |
| 75 | 3300005459 | Ga0068867_100001837 | Ga0068867_1000018373 | 160 |
| 76 | 3300005466 | Ga0070685_10365224 | Ga0070685_103652241 | 160 |
| 77 | 3300005530 | Ga0070679_100161756 | Ga0070679_1001617563 | 160 |
| 78 | 3300005539 | Ga0068853_100020402 | Ga0068853_1000204022 | 160 |
| 79 | 3300005539 | Ga0068853_100376797 | Ga0068853_1003767972 | 160 |
| 80 | 3300005539 | Ga0068853_100443819 | Ga0068853_1004438191 | 160 |
| 81 | 3300005543 | Ga0070672_100133950 | Ga0070672_1001339501 | 160 |
| 82 | 3300005548 | Ga0070665_100000096 | Ga0070665_100000096106 | 160 |
| 83 | 3300005548 | Ga0070665_100563999 | Ga0070665_1005639993 | 160 |
| 84 | 3300005563 | Ga0068855_100000185 | Ga0068855_10000018533 | 160 |
| 85 | 3300005563 | Ga0068855_100000286 | Ga0068855_10000028612 | 160 |
| 86 | 3300005563 | Ga0068855_100019885 | Ga0068855_1000198852 | 160 |
| 87 | 3300005563 | Ga0068855_100242048 | Ga0068855_1002420482 | 160 |
| 88 | 3300005563 | Ga0068855_100279289 | Ga0068855_1002792892 | 160 |
| 89 | 3300005564 | Ga0070664_100419326 | Ga0070664_1004193262 | 160 |
| 90 | 3300005614 | Ga0068856_100581420 | Ga0068856_1005814202 | 160 |
| 91 | 3300005614 | Ga0068856_101163624 | Ga0068856_1011636242 | 160 |
| 92 | 3300005616 | Ga0068852_100019196 | Ga0068852_1000191963 | 160 |
| 93 | 3300005616 | Ga0068852_100401577 | Ga0068852_1004015772 | 160 |
| 94 | 3300005718 | Ga0068866_10547199 | Ga0068866_105471991 | 160 |
| 95 | 3300006237 | Ga0097621_100001259 | Ga0097621_10000125911 | 160 |
| 96 | 3300006358 | Ga0068871_100004706 | Ga0068871_1000047061 | 160 |
| 97 | 3300006881 | Ga0068865_100000143 | Ga0068865_10000014325 | 160 |
| 98 | 3300009093 | Ga0105240_10003529 | Ga0105240_1000352910 | 160 |
| 99 | 3300009093 | Ga0105240_10092017 | Ga0105240_100920172 | 160 |
| 100 | 3300009093 | Ga0105240_10097003 | Ga0105240_100970034 | 160 |
| 101 | 3300009093 | Ga0105240_10504201 | Ga0105240_105042012 | 160 |
| 102 | 3300009093 | Ga0105240_10611801 | Ga0105240_106118012 | 160 |
| 103 | 3300009093 | Ga0105240_10841338 | Ga0105240_108413382 | 160 |
| 104 | 3300009093 | Ga0105240_11447686 | Ga0105240_114476862 | 160 |
| 105 | 3300009093 | Ga0105240_11901283 | Ga0105240_119012832 | 160 |
| 106 | 3300009098 | Ga0105245_10085867 | Ga0105245_100858673 | 160 |
| 107 | 3300009148 | Ga0105243_10018871 | Ga0105243_100188714 | 160 |
| 108 | 3300009174 | Ga0105241_10001505 | Ga0105241_100015053 | 160 |
| 109 | 3300009174 | Ga0105241_10009402 | Ga0105241_100094026 | 160 |
| 110 | 3300009174 | Ga0105241_10028655 | Ga0105241_100286552 | 160 |
| 111 | 3300009174 | Ga0105241_10443215 | Ga0105241_104432152 | 160 |
| 112 | 3300009176 | Ga0105242_10010787 | Ga0105242_100107877 | 160 |
| 113 | 3300009176 | Ga0105242_10336083 | Ga0105242_103360832 | 160 |
| 114 | 3300009545 | Ga0105237_10000400 | Ga0105237_1000040048 | 160 |
| 115 | 3300009545 | Ga0105237_10002087 | Ga0105237_100020877 | 160 |
| 116 | 3300009545 | Ga0105237_10002113 | Ga0105237_1000211320 | 160 |
| 117 | 3300009545 | Ga0105237_10031940 | Ga0105237_100319403 | 160 |
| 118 | 3300009545 | Ga0105237_10042308 | Ga0105237_100423085 | 160 |
| 119 | 3300009545 | Ga0105237_10197158 | Ga0105237_101971582 | 160 |
| 120 | 3300009545 | Ga0105237_10256678 | Ga0105237_102566781 | 160 |
| 121 | 3300009545 | Ga0105237_10263793 | Ga0105237_102637932 | 160 |
| 122 | 3300009545 | Ga0105237_11005962 | Ga0105237_110059622 | 160 |
| 123 | 3300009545 | Ga0105237_11271222 | Ga0105237_112712221 | 160 |
| 124 | 3300009551 | Ga0105238_10008829 | Ga0105238_100088296 | 160 |
| 125 | 3300009551 | Ga0105238_10091493 | Ga0105238_100914934 | 160 |
| 126 | 3300010375 | Ga0105239_10000009 | Ga0105239_1000000985 | 160 |
| 127 | 3300010375 | Ga0105239_10000278 | Ga0105239_1000027867 | 160 |
| 128 | 3300010375 | Ga0105239_10004037 | Ga0105239_1000403716 | 160 |
| 129 | 3300010375 | Ga0105239_10007160 | Ga0105239_100071607 | 160 |
| 130 | 3300010375 | Ga0105239_10078007 | Ga0105239_100780073 | 160 |
| 131 | 3300010375 | Ga0105239_10157698 | Ga0105239_101576982 | 160 |
| 132 | 3300010375 | Ga0105239_10191411 | Ga0105239_101914112 | 160 |
| 133 | 3300010375 | Ga0105239_10472406 | Ga0105239_104724062 | 160 |
| 134 | 3300011119 | Ga0105246_10375972 | Ga0105246_103759722 | 160 |
| 135 | 3300011119 | Ga0105246_10455455 | Ga0105246_104554552 | 160 |
| 136 | 3300013100 | Ga0157373_10065336 | Ga0157373_100653363 | 160 |
| 137 | 3300013102 | Ga0157371_10041155 | Ga0157371_100411553 | 160 |
| 138 | 3300013102 | Ga0157371_10195120 | Ga0157371_101951201 | 160 |
| 139 | 3300013102 | Ga0157371_10405184 | Ga0157371_104051841 | 160 |
| 140 | 3300013104 | Ga0157370_11181859 | Ga0157370_111818591 | 160 |
| 141 | 3300013105 | Ga0157369_10141121 | Ga0157369_101411212 | 160 |
| 142 | 3300013105 | Ga0157369_10271975 | Ga0157369_102719752 | 160 |
| 143 | 3300013296 | Ga0157374_10009732 | Ga0157374_100097327 | 160 |
| 144 | 3300013296 | Ga0157374_10060919 | Ga0157374_100609192 | 160 |
| 145 | 3300013297 | Ga0157378_10034210 | Ga0157378_100342103 | 160 |
| 146 | 3300013297 | Ga0157378_10035964 | Ga0157378_100359642 | 160 |
| 147 | 3300013297 | Ga0157378_11481529 | Ga0157378_114815291 | 160 |
| 148 | 3300013306 | Ga0163162_10000005 | Ga0163162_10000005230 | 160 |
| 149 | 3300013306 | Ga0163162_10036606 | Ga0163162_100366063 | 160 |
| 150 | 3300013306 | Ga0163162_10257844 | Ga0163162_102578442 | 160 |
| 151 | 3300013306 | Ga0163162_10428615 | Ga0163162_104286152 | 160 |
| 152 | 3300013307 | Ga0157372_10000514 | Ga0157372_1000051416 | 160 |
| 153 | 3300013307 | Ga0157372_10180254 | Ga0157372_101802541 | 160 |
| 154 | 3300013308 | Ga0157375_10004654 | Ga0157375_100046545 | 160 |
| 155 | 3300013308 | Ga0157375_10012824 | Ga0157375_100128243 | 160 |
| 156 | 3300013308 | Ga0157375_10012859 | Ga0157375_100128595 | 160 |
| 157 | 3300014745 | Ga0157377_10089997 | Ga0157377_100899972 | 160 |
| 158 | 3300017792 | Ga0163161_10800059 | Ga0163161_108000592 | 160 |
| 159 | 3300021361 | Ga0213872_10070289 | Ga0213872_100702892 | 160 |
| 160 | 3300025231 | Ga0207427_100376 | Ga0207427_1003763 | 160 |
| 161 | 3300025233 | Ga0209437_100048 | Ga0209437_100048127 | 160 |
| 162 | 3300025233 | Ga0209437_100280 | Ga0209437_1002806 | 160 |
| 163 | 3300025250 | Ga0209026_1001758 | Ga0209026_10017582 | 160 |
| 164 | 3300025261 | Ga0209233_1000029 | Ga0209233_1000029250 | 160 |
| 165 | 3300025272 | Ga0209455_1002242 | Ga0209455_10022427 | 160 |
| 166 | 3300025899 | Ga0207642_10222184 | Ga0207642_102221841 | 160 |
| 167 | 3300025904 | Ga0207647_10000752 | Ga0207647_100007523 | 160 |
| 168 | 3300025904 | Ga0207647_10326161 | Ga0207647_103261611 | 160 |
| 169 | 3300025907 | Ga0207645_10001524 | Ga0207645_100015248 | 160 |
| 170 | 3300025909 | Ga0207705_10000636 | Ga0207705_1000063618 | 160 |
| 171 | 3300025909 | Ga0207705_10396228 | Ga0207705_103962281 | 160 |
| 172 | 3300025911 | Ga0207654_10020277 | Ga0207654_100202772 | 160 |
| 173 | 3300025913 | Ga0207695_10003248 | Ga0207695_100032485 | 160 |
| 174 | 3300025913 | Ga0207695_10039229 | Ga0207695_100392295 | 160 |
| 175 | 3300025913 | Ga0207695_10340110 | Ga0207695_103401102 | 160 |
| 176 | 3300025913 | Ga0207695_10432917 | Ga0207695_104329172 | 160 |
| 177 | 3300025914 | Ga0207671_10004100 | Ga0207671_100041009 | 160 |
| 178 | 3300025914 | Ga0207671_10006434 | Ga0207671_100064343 | 160 |
| 179 | 3300025914 | Ga0207671_10009606 | Ga0207671_100096067 | 160 |
| 180 | 3300025914 | Ga0207671_10081135 | Ga0207671_100811353 | 160 |
| 181 | 3300025914 | Ga0207671_10086698 | Ga0207671_100866982 | 160 |
| 182 | 3300025914 | Ga0207671_10354195 | Ga0207671_103541952 | 160 |
| 183 | 3300025914 | Ga0207671_10399803 | Ga0207671_103998032 | 160 |
| 184 | 3300025914 | Ga0207671_10792065 | Ga0207671_107920651 | 160 |
| 185 | 3300025919 | Ga0207657_10064255 | Ga0207657_100642552 | 160 |
| 186 | 3300025919 | Ga0207657_10202249 | Ga0207657_102022492 | 160 |
| 187 | 3300025924 | Ga0207694_10136129 | Ga0207694_101361292 | 160 |
| 188 | 3300025931 | Ga0207644_10031382 | Ga0207644_100313823 | 160 |
| 189 | 3300025932 | Ga0207690_10693364 | Ga0207690_106933642 | 160 |
| 190 | 3300025933 | Ga0207706_10000444 | Ga0207706_1000044420 | 160 |
| 191 | 3300025934 | Ga0207686_10149274 | Ga0207686_101492741 | 160 |
| 192 | 3300025938 | Ga0207704_10000143 | Ga0207704_1000014322 | 160 |
| 193 | 3300025940 | Ga0207691_10359582 | Ga0207691_103595821 | 160 |
| 194 | 3300025945 | Ga0207679_10594423 | Ga0207679_105944232 | 160 |
| 195 | 3300025949 | Ga0207667_10000136 | Ga0207667_1000013612 | 160 |
| 196 | 3300025949 | Ga0207667_10000204 | Ga0207667_1000020439 | 160 |
| 197 | 3300025949 | Ga0207667_10081929 | Ga0207667_100819293 | 160 |
| 198 | 3300025949 | Ga0207667_10203619 | Ga0207667_102036192 | 160 |
| 199 | 3300025949 | Ga0207667_10236818 | Ga0207667_102368182 | 160 |
| 200 | 3300025960 | Ga0207651_10162663 | Ga0207651_101626632 | 160 |
| 201 | 3300025960 | Ga0207651_10544638 | Ga0207651_105446382 | 160 |
| 202 | 3300026023 | Ga0207677_10038949 | Ga0207677_100389492 | 160 |
| 203 | 3300026023 | Ga0207677_10142890 | Ga0207677_101428903 | 160 |
| 204 | 3300026041 | Ga0207639_10163857 | Ga0207639_101638571 | 160 |
| 205 | 3300026041 | Ga0207639_10293360 | Ga0207639_102933602 | 160 |
| 206 | 3300026078 | Ga0207702_10102282 | Ga0207702_101022822 | 160 |
| 207 | 3300026078 | Ga0207702_10751889 | Ga0207702_107518892 | 160 |
| 208 | 3300026078 | Ga0207702_11140294 | Ga0207702_111402941 | 160 |
| 209 | 3300026089 | Ga0207648_10003162 | Ga0207648_100031627 | 160 |
| 210 | 3300026121 | Ga0207683_10004403 | Ga0207683_100044032 | 160 |
| 211 | 3300026142 | Ga0207698_10005312 | Ga0207698_100053127 | 160 |
| 212 | 3300026142 | Ga0207698_10840006 | Ga0207698_108400062 | 160 |
| 213 | 3300028379 | Ga0268266_10000032 | Ga0268266_1000003222 | 160 |
| 214 | 3300028379 | Ga0268266_10478916 | Ga0268266_104789163 | 160 |
| 215 | 3300028794 | Ga0307515_10317153 | Ga0307515_103171532 | 160 |
| 216 | 3300028800 | Ga0265338_10120110 | Ga0265338_101201102 | 160 |
| 217 | 3300028800 | Ga0265338_10395898 | Ga0265338_103958981 | 160 |
| 218 | 3300031507 | Ga0307509_10032255 | Ga0307509_100322553 | 160 |
| 219 | 3300033179 | Ga0307507_10004880 | Ga0307507_100048806 | 160 |
| 220 | 3300033180 | Ga0307510_10000714 | Ga0307510_1000071425 | 160 |
| 221 | 3300037312 | Ga0395899_0000050 | Ga0395899_0000050_205517_206023 | 160 |
| 222 | 3300037418 | Ga0395900_0003170 | Ga0395900_0003170_9295_9810 | 160 |
| 223 | 3300037466 | Ga0395898_0188541 | Ga0395898_0188541_266_781 | 160 |
| 224 | 3300037471 | Ga0395905_0003831 | Ga0395905_0003831_4761_5276 | 160 |
| 225 | 3300038443 | Ga0395901_0004810 | Ga0395901_0004810_1751_2266 | 160 |
| 226 | 3300039447 | Ga0436361_1158472 | Ga0436361_1158472_3261_3776 | 160 |
| 227 | 3300044684 | Ga0466966_0056071 | Ga0466966_0056071_1206_1712 | 160 |
| 228 | 3300046460 | Ga0495638_0025376 | Ga0495638_0025376_339_923 | 160 |
| 229 | 3300046462 | Ga0495651_0344115 | Ga0495651_0344115_38_541 | 160 |
| 230 | 3300046471 | Ga0495650_0000107 | Ga0495650_0000107_134302_134811 | 160 |
| 231 | 3300046471 | Ga0495650_0128487 | Ga0495650_0128487_178_690 | 160 |
| 232 | 3300046492 | Ga0495585_0000014 | Ga0495585_0000014_8033_8542 | 160 |
| 233 | 3300046500 | Ga0495596_0025311 | Ga0495596_0025311_1466_1972 | 160 |
| 234 | 3300046506 | Ga0495583_0006417 | Ga0495583_0006417_4907_5416 | 160 |
| 235 | 3300046506 | Ga0495583_0119588 | Ga0495583_0119588_330_836 | 160 |
| 236 | 3300046507 | Ga0495606_0000303 | Ga0495606_0000303_50100_50609 | 160 |
| 237 | 3300046507 | Ga0495606_0008687 | Ga0495606_0008687_1542_2039 | 160 |
| 238 | 3300046507 | Ga0495606_0117433 | Ga0495606_0117433_566_1075 | 160 |
| 239 | 3300046512 | Ga0495610_0003081 | Ga0495610_0003081_9090_9599 | 160 |
| 240 | 3300046513 | Ga0495616_0002195 | Ga0495616_0002195_2502_3011 | 160 |
| 241 | 3300046518 | Ga0495631_0008313 | Ga0495631_0008313_2580_3086 | 160 |
| 242 | 3300046518 | Ga0495631_0199773 | Ga0495631_0199773_312_830 | 160 |
| 243 | 3300046520 | Ga0495637_0026235 | Ga0495637_0026235_1866_2375 | 160 |
| 244 | 3300046524 | Ga0495648_0335766 | Ga0495648_0335766_133_642 | 160 |
| 245 | 3300046538 | Ga0495609_0024881 | Ga0495609_0024881_436_945 | 160 |
| 246 | 3300046558 | Ga0495633_0021073 | Ga0495633_0021073_807_1319 | 160 |
| 247 | 3300046616 | Ga0495668_0060201 | Ga0495668_0060201_1298_1807 | 160 |
| 248 | 3300046660 | Ga0495625_0000021 | Ga0495625_0000021_89497_90006 | 160 |
| 249 | 3300046660 | Ga0495625_0002809 | Ga0495625_0002809_2568_3077 | 160 |
| 250 | 3300046660 | Ga0495625_0333912 | Ga0495625_0333912_238_744 | 160 |
| 251 | 3300046660 | Ga0495625_0736308 | Ga0495625_0736308_60_566 | 160 |
| 252 | 3300046665 | Ga0495661_0013773 | Ga0495661_0013773_136_645 | 160 |
| 253 | 3300046694 | Ga0495649_0000009 | Ga0495649_0000009_369521_370030 | 160 |
| 254 | 3300046694 | Ga0495649_0112658 | Ga0495649_0112658_107_613 | 160 |
| 255 | 3300047323 | Ga0495683_0043106 | Ga0495683_0043106_452_958 | 160 |
| 256 | 3300047443 | Ga0495687_019948 | Ga0495687_019948_1297_1806 | 160 |
| 257 | 3300047443 | Ga0495687_030648 | Ga0495687_030648_233_748 | 160 |
| 258 | 3300047443 | Ga0495687_036641 | Ga0495687_036641_1098_1607 | 160 |
| 259 | 3300047445 | Ga0495677_0011031 | Ga0495677_0011031_2751_3269 | 160 |
| 260 | 3300047469 | Ga0495673_0021368 | Ga0495673_0021368_1430_1939 | 160 |
| 261 | 3300047472 | Ga0495686_0001677 | Ga0495686_0001677_9195_9704 | 160 |
| 262 | 3300047472 | Ga0495686_0021695 | Ga0495686_0021695_1922_2431 | 160 |
| 263 | 3300047472 | Ga0495686_0199105 | Ga0495686_0199105_586_1104 | 160 |
| 264 | 3300050496 | nmdc:mga07m45_138636_c1 | nmdc:mga07m45_138636_c1_664_1173 | 160 |
| 265 | 3300053122 | Ga0500608_003670 | Ga0500608_003670_4145_4651 | 160 |
| 266 | 3300053122 | Ga0500608_077727 | Ga0500608_077727_507_1016 | 160 |
| 267 | 3300053125 | Ga0500618_000057 | Ga0500618_000057_68656_69165 | 160 |
| 268 | 3300053130 | Ga0500642_0025900 | Ga0500642_0025900_281_796 | 160 |
| 269 | 3300053156 | Ga0500622_0001792 | Ga0500622_0001792_2070_2579 | 160 |
| 270 | 3300053156 | Ga0500622_0057569 | Ga0500622_0057569_1384_1893 | 160 |
| 271 | 3300053157 | Ga0500624_001370 | Ga0500624_001370_3391_3900 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.9329 | 42 | 100 |
| 4hob-assembly2.cif.gz_C | the crystal structure of the zalpha domain from cyprinid herpes virus 3 | 0.9322 | 42 | 82 |
| 4ija-assembly1.cif.gz_B | structure of s. aureus methicillin resistance factor mecr2 | 0.9302 | 41 | 100 |
| 6wxq-assembly1.cif.gz_B | crystal structure of crispr-associated transcription factor csa3 complexed with ca4 | 0.9243 | 46 | 109 |
| 7wqu-assembly1.cif.gz_B | feoc from klebsiella pneumoniae | 0.9221 | 42 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P15082_1_58_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9428 | 42 | 100 | 1.10.10.10 |
| 3majA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9393 | 54 | 100 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9334 | 42 | 99 | 1.10.10.10 |
| 4awxB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9329 | 42 | 100 | 1.10.10.10 |
| 4hobC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9322 | 42 | 82 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4TAV7-F1-model_v4 | MarR family transcriptional regulator | 0.9802 | 10 | 147 |
GO:0003700
GO:0005737 GO:0006950 |
| AF-A0A3D4TAV7-F1-model_v4 | MarR family transcriptional regulator | 0.9596 | 10 | 147 |
GO:0003700
GO:0005737 GO:0006950 |
| AF-A0A7W5ZSF2-F1-model_v4 | DNA-binding MarR family transcriptional regulator | 0.9078 | 1 | 155 |
GO:0003677
GO:0003700 GO:0005737 GO:0006950 |
| AF-A0A519K109-F1-model_v4 | MarR family transcriptional regulator | 0.9051 | 1 | 159 |
GO:0003700
GO:0006950 |
| AF-A0A4Q6A2T2-F1-model_v4 | deleted | 0.9049 | 12 | 155 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar