F377867

General Info

Members Datasets Scaffolds Average Seq Length
271 139 264 168

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0025376|Ga0495638_0025376_339_923
Length 194
Sequence MNNPYFLKAYKNKICIYISAYINCIMNLYQSLGHLVLGSRLRRLSEAFLAEINRAYQTAGIDFDASWFPVFYLLSKNDALSIKELSEQIEVSHPAASQLITNLKKRGLVSTDTCTDDGRRQLVTLTADGRDLLKQVLPVWDAISLSMAELVAEDKTAQQLLPAISALESVFRQTKLADNIVEKLNTNLKPAGND

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
130 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
135 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
136 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
137 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 0
Isolates 2.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.64
Nodule 0
Rhizoplane 0.37
Rhizosphere 85.61
Stem 0
Stem Tuber 0
Unclassified 7.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10046753 3300001979 Bacteria 1268
2 JGI24737J22298_10000384 3300001990 Bacteria 15070
3 JGI24737J22298_10048560 3300001990 Bacteria 1292
4 JGI24735J21928_10000003 3300002067 Bacteria 385983
5 JGI24744J21845_10006647 3300002077 Bacteria 2394
6 JGI25162J39368_1000158 3300002737 Bacteria 74916
7 JGI25162J39368_1001096 3300002737 Bacteria 16465
8 JGI25165J46597_1000621 3300003214 Bacteria 29774
9 rootH1_10019188 3300003316 Bacteria 26527
10 rootH1_10145809 3300003316 Bacteria 1504
11 rootH2_10000984 3300003320 Bacteria 89440
12 rootH2_10002146 3300003320 Bacteria 11415
13 rootL2_10079530 3300003322 Bacteria 2715
14 rootL2_10084996 3300003322 Bacteria 3495
15 rootL2_10282345 3300003322 Bacteria 1199
16 rootH1_10020603 3300003323 Bacteria 10847
17 rootH1_10189863 3300003323 Bacteria 1988
18 rootH1_10219201 3300003323 Bacteria 2502
19 rootH1_10280957 3300003323 Bacteria 1079
20 rootH1_10307452 3300003323 Bacteria 1904
21 Ga0065715_10405310 3300005293 Bacteria 876
22 Ga0070658_10000635 3300005327 Bacteria 30331
23 Ga0070676_10008922 3300005328 Bacteria 5421
24 Ga0070676_10068585 3300005328 Bacteria 2123
25 Ga0068868_100048894 3300005338 Bacteria 3319
26 Ga0068868_100068302 3300005338 Bacteria 2830
27 Ga0068868_100760792 3300005338 Bacteria 871
28 Ga0070660_100043543 3300005339 Bacteria 3431
29 Ga0070671_100009095 3300005355 Bacteria 7973
30 Ga0070673_100010930 3300005364 Bacteria 6173
31 Ga0070659_100728493 3300005366 Bacteria 859
32 Ga0070678_100012924 3300005456 Bacteria 5213
33 Ga0070662_100000053 3300005457 Bacteria 61062
34 Ga0068867_100001837 3300005459 Bacteria 14782
35 Ga0070685_10365224 3300005466 Bacteria 990
36 Ga0070679_100161756 3300005530 Bacteria 2213
37 Ga0068853_100020402 3300005539 Bacteria 5512
38 Ga0068853_100376797 3300005539 Bacteria 1324
39 Ga0068853_100443819 3300005539 Bacteria 1220
40 Ga0070672_100133950 3300005543 Bacteria 2039
41 Ga0070665_100000096 3300005548 Bacteria 166864
42 Ga0070665_100563999 3300005548 Bacteria 1151
43 Ga0068855_100000185 3300005563 Bacteria 79849
44 Ga0068855_100000286 3300005563 Bacteria 62438
45 Ga0068855_100019885 3300005563 Bacteria 8064
46 Ga0068855_100242048 3300005563 Bacteria 2015
47 Ga0068855_100279289 3300005563 Bacteria 1855
48 Ga0070664_100419326 3300005564 Bacteria 1226
49 Ga0068856_100000095 3300005614 Bacteria 84075
50 Ga0068856_100029531 3300005614 Bacteria 5355
51 Ga0068856_100086985 3300005614 Bacteria 3106
52 Ga0068856_100581420 3300005614 Bacteria 1141
53 Ga0068856_101163624 3300005614 Bacteria 788
54 Ga0068852_100019196 3300005616 Bacteria 5403
55 Ga0068852_100401577 3300005616 Bacteria 1348
56 Ga0068866_10547199 3300005718 Bacteria 773
57 Ga0097621_100001259 3300006237 Bacteria 17505
58 Ga0068871_100004706 3300006358 Bacteria 9544
59 Ga0068865_100000143 3300006881 Bacteria 37973
60 Ga0105240_10000892 3300009093 Bacteria 53531
61 Ga0105240_10003529 3300009093 Bacteria 24265
62 Ga0105240_10074465 3300009093 Bacteria 4191
63 Ga0105240_10092017 3300009093 Bacteria 3704
64 Ga0105240_10097003 3300009093 Bacteria 3592
65 Ga0105240_10504201 3300009093 Bacteria 1345
66 Ga0105240_10611801 3300009093 Bacteria 1198
67 Ga0105240_10841338 3300009093 Bacteria 991
68 Ga0105240_11447686 3300009093 Bacteria 721
69 Ga0105240_11901283 3300009093 Unclassified 619
70 Ga0105245_10085867 3300009098 Bacteria 2885
71 Ga0105243_10018871 3300009148 Bacteria 5229
72 Ga0105241_10001505 3300009174 Bacteria 17872
73 Ga0105241_10009402 3300009174 Bacteria 7182
74 Ga0105241_10028655 3300009174 Bacteria 4149
75 Ga0105241_10443215 3300009174 Bacteria 1147
76 Ga0105241_10814712 3300009174 Bacteria 861
77 Ga0105242_10010787 3300009176 Bacteria 7015
78 Ga0105242_10336083 3300009176 Bacteria 1390
79 Ga0105237_10000400 3300009545 Bacteria 61626
80 Ga0105237_10002087 3300009545 Bacteria 25279
81 Ga0105237_10002113 3300009545 Bacteria 25080
82 Ga0105237_10012888 3300009545 Bacteria 8786
83 Ga0105237_10031940 3300009545 Bacteria 5332
84 Ga0105237_10042308 3300009545 Bacteria 4595
85 Ga0105237_10197158 3300009545 Bacteria 2013
86 Ga0105237_10256678 3300009545 Bacteria 1750
87 Ga0105237_10263793 3300009545 Bacteria 1725
88 Ga0105237_11005962 3300009545 Unclassified 840
89 Ga0105237_11271222 3300009545 Bacteria 742
90 Ga0105238_10008829 3300009551 Bacteria 10082
91 Ga0105238_10091493 3300009551 Bacteria 3029
92 Ga0105239_10000009 3300010375 Bacteria 361182
93 Ga0105239_10000278 3300010375 Bacteria 75485
94 Ga0105239_10004037 3300010375 Bacteria 17755
95 Ga0105239_10007160 3300010375 Bacteria 12837
96 Ga0105239_10021966 3300010375 Bacteria 7033
97 Ga0105239_10024404 3300010375 Bacteria 6662
98 Ga0105239_10078007 3300010375 Bacteria 3645
99 Ga0105239_10157698 3300010375 Bacteria 2535
100 Ga0105239_10191411 3300010375 Bacteria 2290
101 Ga0105239_10472406 3300010375 Bacteria 1424
102 Ga0105246_10375972 3300011119 Bacteria 1172
103 Ga0105246_10455455 3300011119 Bacteria 1076
104 Ga0157373_10065336 3300013100 Bacteria 2574
105 Ga0157371_10041155 3300013102 Bacteria 3298
106 Ga0157371_10195120 3300013102 Bacteria 1450
107 Ga0157371_10405184 3300013102 Bacteria 998
108 Ga0157370_11181859 3300013104 Bacteria 690
109 Ga0157369_10141121 3300013105 Bacteria 2549
110 Ga0157369_10271975 3300013105 Bacteria 1765
111 Ga0157374_10009732 3300013296 Bacteria 8253
112 Ga0157374_10060919 3300013296 Bacteria 3533
113 Ga0157378_10034210 3300013297 Bacteria 4494
114 Ga0157378_10035964 3300013297 Bacteria 4383
115 Ga0157378_11481529 3300013297 Bacteria 723
116 Ga0163162_10000005 3300013306 Bacteria 447195
117 Ga0163162_10036606 3300013306 Bacteria 4893
118 Ga0163162_10257844 3300013306 Bacteria 1875
119 Ga0163162_10428615 3300013306 Bacteria 1455
120 Ga0157372_10000514 3300013307 Bacteria 42626
121 Ga0157372_10180254 3300013307 Bacteria 2445
122 Ga0157375_10004654 3300013308 Bacteria 11930
123 Ga0157375_10012824 3300013308 Bacteria 7444
124 Ga0157375_10012859 3300013308 Bacteria 7435
125 Ga0157375_10185659 3300013308 Bacteria 2232
126 Ga0157377_10089997 3300014745 Bacteria 1810
127 Ga0163161_10045823 3300017792 Bacteria 3155
128 Ga0163161_10800059 3300017792 Bacteria 792
129 Ga0213872_10070289 3300021361 Bacteria 1578
130 Ga0207427_100376 3300025231 Bacteria 27182
131 Ga0209437_100048 3300025233 Bacteria 405107
132 Ga0209437_100280 3300025233 Bacteria 74968
133 Ga0209026_1001758 3300025250 Bacteria 8978
134 Ga0209233_1000029 3300025261 Bacteria 641642
135 Ga0209455_1002242 3300025272 Bacteria 7606
136 Ga0207642_10222184 3300025899 Bacteria 1056
137 Ga0207647_10000752 3300025904 Bacteria 25389
138 Ga0207647_10326161 3300025904 Bacteria 871
139 Ga0207645_10001524 3300025907 Bacteria 18934
140 Ga0207705_10000636 3300025909 Bacteria 29355
141 Ga0207705_10396228 3300025909 Bacteria 1067
142 Ga0207654_10020277 3300025911 Bacteria 3522
143 Ga0207695_10000267 3300025913 Bacteria 131133
144 Ga0207695_10003248 3300025913 Bacteria 23126
145 Ga0207695_10039229 3300025913 Bacteria 5091
146 Ga0207695_10340110 3300025913 Bacteria 1388
147 Ga0207695_10432917 3300025913 Bacteria 1199
148 Ga0207671_10004100 3300025914 Bacteria 14098
149 Ga0207671_10004658 3300025914 Bacteria 12986
150 Ga0207671_10006434 3300025914 Bacteria 10460
151 Ga0207671_10009606 3300025914 Bacteria 8064
152 Ga0207671_10081135 3300025914 Bacteria 2432
153 Ga0207671_10086698 3300025914 Bacteria 2354
154 Ga0207671_10354195 3300025914 Bacteria 1164
155 Ga0207671_10399803 3300025914 Bacteria 1092
156 Ga0207671_10792065 3300025914 Bacteria 752
157 Ga0207657_10064255 3300025919 Bacteria 3133
158 Ga0207657_10202249 3300025919 Bacteria 1597
159 Ga0207694_10136129 3300025924 Bacteria 1973
160 Ga0207644_10031382 3300025931 Bacteria 3701
161 Ga0207690_10693364 3300025932 Bacteria 837
162 Ga0207706_10000444 3300025933 Bacteria 44162
163 Ga0207686_10149274 3300025934 Bacteria 1625
164 Ga0207704_10000143 3300025938 Bacteria 38321
165 Ga0207691_10359582 3300025940 Bacteria 1245
166 Ga0207679_10594423 3300025945 Bacteria 997
167 Ga0207667_10000136 3300025949 Bacteria 111470
168 Ga0207667_10000204 3300025949 Bacteria 84991
169 Ga0207667_10081929 3300025949 Bacteria 3343
170 Ga0207667_10203619 3300025949 Bacteria 2030
171 Ga0207667_10236818 3300025949 Bacteria 1868
172 Ga0207651_10162663 3300025960 Bacteria 1751
173 Ga0207651_10544638 3300025960 Bacteria 1008
174 Ga0207677_10038949 3300026023 Bacteria 3121
175 Ga0207677_10142890 3300026023 Bacteria 1835
176 Ga0207639_10163857 3300026041 Bacteria 1876
177 Ga0207639_10293360 3300026041 Bacteria 1435
178 Ga0207708_10909057 3300026075 Bacteria 762
179 Ga0207702_10006023 3300026078 Bacteria 10523
180 Ga0207702_10074071 3300026078 Bacteria 2938
181 Ga0207702_10102282 3300026078 Bacteria 2532
182 Ga0207702_10751889 3300026078 Bacteria 962
183 Ga0207702_11140294 3300026078 Bacteria 774
184 Ga0207648_10003162 3300026089 Bacteria 17356
185 Ga0207683_10004403 3300026121 Bacteria 12176
186 Ga0207698_10005312 3300026142 Bacteria 7937
187 Ga0207698_10840006 3300026142 Bacteria 923
188 Ga0268266_10000032 3300028379 Bacteria 395079
189 Ga0268266_10478916 3300028379 Bacteria 1186
190 Ga0307515_10002118 3300028794 Bacteria 43514
191 Ga0307515_10317153 3300028794 Bacteria 1228
192 Ga0265338_10120110 3300028800 Bacteria 2097
193 Ga0265338_10395898 3300028800 Bacteria 985
194 Ga0307509_10032255 3300031507 Bacteria 5773
195 Ga0307507_10004880 3300033179 Bacteria 22985
196 Ga0307510_10000714 3300033180 Bacteria 34043
197 Ga0395899_0000050 3300037312 Bacteria 224591
198 Ga0395900_0000139 3300037418 Bacteria 122708
199 Ga0395900_0003170 3300037418 Bacteria 17833
200 Ga0395900_0035528 3300037418 Bacteria 5133
201 Ga0395898_0102943 3300037466 Bacteria 2740
202 Ga0395898_0188541 3300037466 Bacteria 1971
203 Ga0395905_0000169 3300037471 Bacteria 106579
204 Ga0395905_0003831 3300037471 Bacteria 15891
205 Ga0395901_0002154 3300038443 Bacteria 20114
206 Ga0395901_0004810 3300038443 Bacteria 13624
207 Ga0436361_1158472 3300039447 Bacteria 8341
208 Ga0466966_0056071 3300044684 Bacteria 2494
209 Ga0495638_0025376 3300046460 Bacteria 3854
210 Ga0495651_0344115 3300046462 Bacteria 987
211 Ga0495650_0000107 3300046471 Bacteria 200864
212 Ga0495650_0128487 3300046471 Bacteria 926
213 Ga0495605_0109939 3300046474 Bacteria 1259
214 Ga0495585_0000014 3300046492 Bacteria 187513
215 Ga0495585_0004514 3300046492 Bacteria 9019
216 Ga0495596_0025311 3300046500 Bacteria 2400
217 Ga0495583_0006417 3300046506 Bacteria 7696
218 Ga0495583_0119588 3300046506 Bacteria 1110
219 Ga0495606_0000303 3300046507 Bacteria 84874
220 Ga0495606_0008687 3300046507 Bacteria 8751
221 Ga0495606_0117433 3300046507 Bacteria 1596
222 Ga0495610_0003081 3300046512 Bacteria 13312
223 Ga0495616_0002195 3300046513 Bacteria 13047
224 Ga0495631_0008313 3300046518 Bacteria 5230
225 Ga0495631_0199773 3300046518 Bacteria 855
226 Ga0495637_0026235 3300046520 Bacteria 2618
227 Ga0495648_0006357 3300046524 Bacteria 9657
228 Ga0495648_0335766 3300046524 Bacteria 695
229 Ga0495609_0024881 3300046538 Bacteria 2745
230 Ga0495622_0006876 3300046557 Bacteria 5281
231 Ga0495633_0000015 3300046558 Bacteria 254484
232 Ga0495633_0021073 3300046558 Bacteria 3265
233 Ga0495668_0000010 3300046616 Bacteria 487308
234 Ga0495668_0060201 3300046616 Bacteria 2095
235 Ga0495625_0000021 3300046660 Bacteria 282133
236 Ga0495625_0002809 3300046660 Bacteria 18347
237 Ga0495625_0003409 3300046660 Bacteria 15897
238 Ga0495625_0333912 3300046660 Bacteria 962
239 Ga0495625_0736308 3300046660 Bacteria 579
240 Ga0495661_0001335 3300046665 Bacteria 20928
241 Ga0495661_0013773 3300046665 Bacteria 5426
242 Ga0495658_0536317 3300046683 Bacteria 749
243 Ga0495649_0000009 3300046694 Bacteria 451725
244 Ga0495649_0112658 3300046694 Bacteria 1442
245 Ga0495683_0043106 3300047323 Bacteria 2273
246 Ga0495687_019948 3300047443 Bacteria 3276
247 Ga0495687_030648 3300047443 Bacteria 2475
248 Ga0495687_036641 3300047443 Bacteria 2193
249 Ga0495677_0011031 3300047445 Bacteria 3311
250 Ga0495673_0021368 3300047469 Bacteria 3197
251 Ga0495686_0001677 3300047472 Bacteria 23025
252 Ga0495686_0021695 3300047472 Bacteria 4260
253 Ga0495686_0199105 3300047472 Bacteria 1150
254 Ga0495682_0027455 3300049460 Bacteria 2111
255 nmdc:mga07m45_138636_c1 3300050496 Bacteria 1408
256 Ga0500608_003670 3300053122 Bacteria 5803
257 Ga0500608_077727 3300053122 Bacteria 1571
258 Ga0500618_000057 3300053125 Bacteria 98383
259 Ga0500618_022162 3300053125 Bacteria 1545
260 Ga0500642_0025900 3300053130 Bacteria 2388
261 Ga0500561_0086584 3300053137 Bacteria 921
262 Ga0500622_0001792 3300053156 Bacteria 16380
263 Ga0500622_0057569 3300053156 Bacteria 1988
264 Ga0500624_001370 3300053157 Bacteria 4081

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026075 Ga0207708_10909057 Ga0207708_109090571 127
2 3300037418 Ga0395900_0000139 Ga0395900_0000139_59649_60161 146
3 3300009174 Ga0105241_10814712 Ga0105241_108147121 147
4 3300046492 Ga0495585_0004514 Ga0495585_0004514_379_888 147
5 3300046524 Ga0495648_0006357 Ga0495648_0006357_2691_3200 147
6 3300046557 Ga0495622_0006876 Ga0495622_0006876_2022_2531 147
7 3300046616 Ga0495668_0000010 Ga0495668_0000010_376025_376534 147
8 3300046660 Ga0495625_0003409 Ga0495625_0003409_11013_11522 147
9 3300046683 Ga0495658_0536317 Ga0495658_0536317_117_626 147
10 3300049460 Ga0495682_0027455 Ga0495682_0027455_925_1434 147
11 3300053137 Ga0500561_0086584 Ga0500561_0086584_14_523 148
12 3300009545 Ga0105237_10012888 Ga0105237_100128886 150
13 3300010375 Ga0105239_10021966 Ga0105239_100219663 150
14 3300017792 Ga0163161_10045823 Ga0163161_100458231 150
15 3300025914 Ga0207671_10004658 Ga0207671_100046587 150
16 3300013308 Ga0157375_10185659 Ga0157375_101856592 151
17 3300005614 Ga0068856_100000095 Ga0068856_10000009538 153
18 3300026078 Ga0207702_10006023 Ga0207702_100060233 153
19 3300046558 Ga0495633_0000015 Ga0495633_0000015_170234_170743 153
20 3300003323 rootH1_10280957 rootH1_102809572 154
21 3300005614 Ga0068856_100086985 Ga0068856_1000869853 154
22 3300009093 Ga0105240_10000892 Ga0105240_1000089226 155
23 3300010375 Ga0105239_10024404 Ga0105239_100244046 155
24 3300025913 Ga0207695_10000267 Ga0207695_10000267103 155
25 3300028794 Ga0307515_10002118 Ga0307515_100021187 155
26 3300053125 Ga0500618_022162 Ga0500618_022162_56_565 155
27 iso_pu_bacteria 2852623160 2852627130 155
28 iso_pu_bacteria 2884933994 2884935934 155
29 iso_pu_bacteria 2599185184 2599479659 156
30 iso_pu_bacteria 2919437846 2919437930 156
31 iso_pu_bacteria 2928078545 2928083785 156
32 iso_pu_bacteria 2928147474 2928152226 156
33 iso_pu_bacteria 2932082852 2932084789 156
34 3300009093 Ga0105240_10074465 Ga0105240_100744652 157
35 3300003316 rootH1_10145809 rootH1_101458092 159
36 3300003323 rootH1_10307452 rootH1_103074522 159
37 3300005614 Ga0068856_100029531 Ga0068856_1000295312 159
38 3300026078 Ga0207702_10074071 Ga0207702_100740712 159
39 3300037418 Ga0395900_0035528 Ga0395900_0035528_2829_3335 159
40 3300037466 Ga0395898_0102943 Ga0395898_0102943_1624_2130 159
41 3300037471 Ga0395905_0000169 Ga0395905_0000169_105149_105655 159
42 3300038443 Ga0395901_0002154 Ga0395901_0002154_11649_12155 159
43 3300046474 Ga0495605_0109939 Ga0495605_0109939_567_1070 159
44 3300046665 Ga0495661_0001335 Ga0495661_0001335_14229_14732 159
45 3300001979 JGI24740J21852_10046753 JGI24740J21852_100467532 160
46 3300001990 JGI24737J22298_10000384 JGI24737J22298_1000038418 160
47 3300001990 JGI24737J22298_10048560 JGI24737J22298_100485602 160
48 3300002067 JGI24735J21928_10000003 JGI24735J21928_10000003107 160
49 3300002077 JGI24744J21845_10006647 JGI24744J21845_100066472 160
50 3300002737 JGI25162J39368_1000158 JGI25162J39368_100015866 160
51 3300002737 JGI25162J39368_1001096 JGI25162J39368_100109618 160
52 3300003214 JGI25165J46597_1000621 JGI25165J46597_100062118 160
53 3300003316 rootH1_10019188 rootH1_1001918821 160
54 3300003320 rootH2_10000984 rootH2_1000098416 160
55 3300003320 rootH2_10002146 rootH2_1000214611 160
56 3300003322 rootL2_10079530 rootL2_100795302 160
57 3300003322 rootL2_10084996 rootL2_100849962 160
58 3300003322 rootL2_10282345 rootL2_102823452 160
59 3300003323 rootH1_10020603 rootH1_100206032 160
60 3300003323 rootH1_10189863 rootH1_101898631 160
61 3300003323 rootH1_10219201 rootH1_102192013 160
62 3300005293 Ga0065715_10405310 Ga0065715_104053101 160
63 3300005327 Ga0070658_10000635 Ga0070658_1000063516 160
64 3300005328 Ga0070676_10008922 Ga0070676_100089222 160
65 3300005328 Ga0070676_10068585 Ga0070676_100685852 160
66 3300005338 Ga0068868_100048894 Ga0068868_1000488942 160
67 3300005338 Ga0068868_100068302 Ga0068868_1000683022 160
68 3300005338 Ga0068868_100760792 Ga0068868_1007607921 160
69 3300005339 Ga0070660_100043543 Ga0070660_1000435434 160
70 3300005355 Ga0070671_100009095 Ga0070671_1000090958 160
71 3300005364 Ga0070673_100010930 Ga0070673_1000109303 160
72 3300005366 Ga0070659_100728493 Ga0070659_1007284932 160
73 3300005456 Ga0070678_100012924 Ga0070678_1000129242 160
74 3300005457 Ga0070662_100000053 Ga0070662_10000005320 160
75 3300005459 Ga0068867_100001837 Ga0068867_1000018373 160
76 3300005466 Ga0070685_10365224 Ga0070685_103652241 160
77 3300005530 Ga0070679_100161756 Ga0070679_1001617563 160
78 3300005539 Ga0068853_100020402 Ga0068853_1000204022 160
79 3300005539 Ga0068853_100376797 Ga0068853_1003767972 160
80 3300005539 Ga0068853_100443819 Ga0068853_1004438191 160
81 3300005543 Ga0070672_100133950 Ga0070672_1001339501 160
82 3300005548 Ga0070665_100000096 Ga0070665_100000096106 160
83 3300005548 Ga0070665_100563999 Ga0070665_1005639993 160
84 3300005563 Ga0068855_100000185 Ga0068855_10000018533 160
85 3300005563 Ga0068855_100000286 Ga0068855_10000028612 160
86 3300005563 Ga0068855_100019885 Ga0068855_1000198852 160
87 3300005563 Ga0068855_100242048 Ga0068855_1002420482 160
88 3300005563 Ga0068855_100279289 Ga0068855_1002792892 160
89 3300005564 Ga0070664_100419326 Ga0070664_1004193262 160
90 3300005614 Ga0068856_100581420 Ga0068856_1005814202 160
91 3300005614 Ga0068856_101163624 Ga0068856_1011636242 160
92 3300005616 Ga0068852_100019196 Ga0068852_1000191963 160
93 3300005616 Ga0068852_100401577 Ga0068852_1004015772 160
94 3300005718 Ga0068866_10547199 Ga0068866_105471991 160
95 3300006237 Ga0097621_100001259 Ga0097621_10000125911 160
96 3300006358 Ga0068871_100004706 Ga0068871_1000047061 160
97 3300006881 Ga0068865_100000143 Ga0068865_10000014325 160
98 3300009093 Ga0105240_10003529 Ga0105240_1000352910 160
99 3300009093 Ga0105240_10092017 Ga0105240_100920172 160
100 3300009093 Ga0105240_10097003 Ga0105240_100970034 160
101 3300009093 Ga0105240_10504201 Ga0105240_105042012 160
102 3300009093 Ga0105240_10611801 Ga0105240_106118012 160
103 3300009093 Ga0105240_10841338 Ga0105240_108413382 160
104 3300009093 Ga0105240_11447686 Ga0105240_114476862 160
105 3300009093 Ga0105240_11901283 Ga0105240_119012832 160
106 3300009098 Ga0105245_10085867 Ga0105245_100858673 160
107 3300009148 Ga0105243_10018871 Ga0105243_100188714 160
108 3300009174 Ga0105241_10001505 Ga0105241_100015053 160
109 3300009174 Ga0105241_10009402 Ga0105241_100094026 160
110 3300009174 Ga0105241_10028655 Ga0105241_100286552 160
111 3300009174 Ga0105241_10443215 Ga0105241_104432152 160
112 3300009176 Ga0105242_10010787 Ga0105242_100107877 160
113 3300009176 Ga0105242_10336083 Ga0105242_103360832 160
114 3300009545 Ga0105237_10000400 Ga0105237_1000040048 160
115 3300009545 Ga0105237_10002087 Ga0105237_100020877 160
116 3300009545 Ga0105237_10002113 Ga0105237_1000211320 160
117 3300009545 Ga0105237_10031940 Ga0105237_100319403 160
118 3300009545 Ga0105237_10042308 Ga0105237_100423085 160
119 3300009545 Ga0105237_10197158 Ga0105237_101971582 160
120 3300009545 Ga0105237_10256678 Ga0105237_102566781 160
121 3300009545 Ga0105237_10263793 Ga0105237_102637932 160
122 3300009545 Ga0105237_11005962 Ga0105237_110059622 160
123 3300009545 Ga0105237_11271222 Ga0105237_112712221 160
124 3300009551 Ga0105238_10008829 Ga0105238_100088296 160
125 3300009551 Ga0105238_10091493 Ga0105238_100914934 160
126 3300010375 Ga0105239_10000009 Ga0105239_1000000985 160
127 3300010375 Ga0105239_10000278 Ga0105239_1000027867 160
128 3300010375 Ga0105239_10004037 Ga0105239_1000403716 160
129 3300010375 Ga0105239_10007160 Ga0105239_100071607 160
130 3300010375 Ga0105239_10078007 Ga0105239_100780073 160
131 3300010375 Ga0105239_10157698 Ga0105239_101576982 160
132 3300010375 Ga0105239_10191411 Ga0105239_101914112 160
133 3300010375 Ga0105239_10472406 Ga0105239_104724062 160
134 3300011119 Ga0105246_10375972 Ga0105246_103759722 160
135 3300011119 Ga0105246_10455455 Ga0105246_104554552 160
136 3300013100 Ga0157373_10065336 Ga0157373_100653363 160
137 3300013102 Ga0157371_10041155 Ga0157371_100411553 160
138 3300013102 Ga0157371_10195120 Ga0157371_101951201 160
139 3300013102 Ga0157371_10405184 Ga0157371_104051841 160
140 3300013104 Ga0157370_11181859 Ga0157370_111818591 160
141 3300013105 Ga0157369_10141121 Ga0157369_101411212 160
142 3300013105 Ga0157369_10271975 Ga0157369_102719752 160
143 3300013296 Ga0157374_10009732 Ga0157374_100097327 160
144 3300013296 Ga0157374_10060919 Ga0157374_100609192 160
145 3300013297 Ga0157378_10034210 Ga0157378_100342103 160
146 3300013297 Ga0157378_10035964 Ga0157378_100359642 160
147 3300013297 Ga0157378_11481529 Ga0157378_114815291 160
148 3300013306 Ga0163162_10000005 Ga0163162_10000005230 160
149 3300013306 Ga0163162_10036606 Ga0163162_100366063 160
150 3300013306 Ga0163162_10257844 Ga0163162_102578442 160
151 3300013306 Ga0163162_10428615 Ga0163162_104286152 160
152 3300013307 Ga0157372_10000514 Ga0157372_1000051416 160
153 3300013307 Ga0157372_10180254 Ga0157372_101802541 160
154 3300013308 Ga0157375_10004654 Ga0157375_100046545 160
155 3300013308 Ga0157375_10012824 Ga0157375_100128243 160
156 3300013308 Ga0157375_10012859 Ga0157375_100128595 160
157 3300014745 Ga0157377_10089997 Ga0157377_100899972 160
158 3300017792 Ga0163161_10800059 Ga0163161_108000592 160
159 3300021361 Ga0213872_10070289 Ga0213872_100702892 160
160 3300025231 Ga0207427_100376 Ga0207427_1003763 160
161 3300025233 Ga0209437_100048 Ga0209437_100048127 160
162 3300025233 Ga0209437_100280 Ga0209437_1002806 160
163 3300025250 Ga0209026_1001758 Ga0209026_10017582 160
164 3300025261 Ga0209233_1000029 Ga0209233_1000029250 160
165 3300025272 Ga0209455_1002242 Ga0209455_10022427 160
166 3300025899 Ga0207642_10222184 Ga0207642_102221841 160
167 3300025904 Ga0207647_10000752 Ga0207647_100007523 160
168 3300025904 Ga0207647_10326161 Ga0207647_103261611 160
169 3300025907 Ga0207645_10001524 Ga0207645_100015248 160
170 3300025909 Ga0207705_10000636 Ga0207705_1000063618 160
171 3300025909 Ga0207705_10396228 Ga0207705_103962281 160
172 3300025911 Ga0207654_10020277 Ga0207654_100202772 160
173 3300025913 Ga0207695_10003248 Ga0207695_100032485 160
174 3300025913 Ga0207695_10039229 Ga0207695_100392295 160
175 3300025913 Ga0207695_10340110 Ga0207695_103401102 160
176 3300025913 Ga0207695_10432917 Ga0207695_104329172 160
177 3300025914 Ga0207671_10004100 Ga0207671_100041009 160
178 3300025914 Ga0207671_10006434 Ga0207671_100064343 160
179 3300025914 Ga0207671_10009606 Ga0207671_100096067 160
180 3300025914 Ga0207671_10081135 Ga0207671_100811353 160
181 3300025914 Ga0207671_10086698 Ga0207671_100866982 160
182 3300025914 Ga0207671_10354195 Ga0207671_103541952 160
183 3300025914 Ga0207671_10399803 Ga0207671_103998032 160
184 3300025914 Ga0207671_10792065 Ga0207671_107920651 160
185 3300025919 Ga0207657_10064255 Ga0207657_100642552 160
186 3300025919 Ga0207657_10202249 Ga0207657_102022492 160
187 3300025924 Ga0207694_10136129 Ga0207694_101361292 160
188 3300025931 Ga0207644_10031382 Ga0207644_100313823 160
189 3300025932 Ga0207690_10693364 Ga0207690_106933642 160
190 3300025933 Ga0207706_10000444 Ga0207706_1000044420 160
191 3300025934 Ga0207686_10149274 Ga0207686_101492741 160
192 3300025938 Ga0207704_10000143 Ga0207704_1000014322 160
193 3300025940 Ga0207691_10359582 Ga0207691_103595821 160
194 3300025945 Ga0207679_10594423 Ga0207679_105944232 160
195 3300025949 Ga0207667_10000136 Ga0207667_1000013612 160
196 3300025949 Ga0207667_10000204 Ga0207667_1000020439 160
197 3300025949 Ga0207667_10081929 Ga0207667_100819293 160
198 3300025949 Ga0207667_10203619 Ga0207667_102036192 160
199 3300025949 Ga0207667_10236818 Ga0207667_102368182 160
200 3300025960 Ga0207651_10162663 Ga0207651_101626632 160
201 3300025960 Ga0207651_10544638 Ga0207651_105446382 160
202 3300026023 Ga0207677_10038949 Ga0207677_100389492 160
203 3300026023 Ga0207677_10142890 Ga0207677_101428903 160
204 3300026041 Ga0207639_10163857 Ga0207639_101638571 160
205 3300026041 Ga0207639_10293360 Ga0207639_102933602 160
206 3300026078 Ga0207702_10102282 Ga0207702_101022822 160
207 3300026078 Ga0207702_10751889 Ga0207702_107518892 160
208 3300026078 Ga0207702_11140294 Ga0207702_111402941 160
209 3300026089 Ga0207648_10003162 Ga0207648_100031627 160
210 3300026121 Ga0207683_10004403 Ga0207683_100044032 160
211 3300026142 Ga0207698_10005312 Ga0207698_100053127 160
212 3300026142 Ga0207698_10840006 Ga0207698_108400062 160
213 3300028379 Ga0268266_10000032 Ga0268266_1000003222 160
214 3300028379 Ga0268266_10478916 Ga0268266_104789163 160
215 3300028794 Ga0307515_10317153 Ga0307515_103171532 160
216 3300028800 Ga0265338_10120110 Ga0265338_101201102 160
217 3300028800 Ga0265338_10395898 Ga0265338_103958981 160
218 3300031507 Ga0307509_10032255 Ga0307509_100322553 160
219 3300033179 Ga0307507_10004880 Ga0307507_100048806 160
220 3300033180 Ga0307510_10000714 Ga0307510_1000071425 160
221 3300037312 Ga0395899_0000050 Ga0395899_0000050_205517_206023 160
222 3300037418 Ga0395900_0003170 Ga0395900_0003170_9295_9810 160
223 3300037466 Ga0395898_0188541 Ga0395898_0188541_266_781 160
224 3300037471 Ga0395905_0003831 Ga0395905_0003831_4761_5276 160
225 3300038443 Ga0395901_0004810 Ga0395901_0004810_1751_2266 160
226 3300039447 Ga0436361_1158472 Ga0436361_1158472_3261_3776 160
227 3300044684 Ga0466966_0056071 Ga0466966_0056071_1206_1712 160
228 3300046460 Ga0495638_0025376 Ga0495638_0025376_339_923 160
229 3300046462 Ga0495651_0344115 Ga0495651_0344115_38_541 160
230 3300046471 Ga0495650_0000107 Ga0495650_0000107_134302_134811 160
231 3300046471 Ga0495650_0128487 Ga0495650_0128487_178_690 160
232 3300046492 Ga0495585_0000014 Ga0495585_0000014_8033_8542 160
233 3300046500 Ga0495596_0025311 Ga0495596_0025311_1466_1972 160
234 3300046506 Ga0495583_0006417 Ga0495583_0006417_4907_5416 160
235 3300046506 Ga0495583_0119588 Ga0495583_0119588_330_836 160
236 3300046507 Ga0495606_0000303 Ga0495606_0000303_50100_50609 160
237 3300046507 Ga0495606_0008687 Ga0495606_0008687_1542_2039 160
238 3300046507 Ga0495606_0117433 Ga0495606_0117433_566_1075 160
239 3300046512 Ga0495610_0003081 Ga0495610_0003081_9090_9599 160
240 3300046513 Ga0495616_0002195 Ga0495616_0002195_2502_3011 160
241 3300046518 Ga0495631_0008313 Ga0495631_0008313_2580_3086 160
242 3300046518 Ga0495631_0199773 Ga0495631_0199773_312_830 160
243 3300046520 Ga0495637_0026235 Ga0495637_0026235_1866_2375 160
244 3300046524 Ga0495648_0335766 Ga0495648_0335766_133_642 160
245 3300046538 Ga0495609_0024881 Ga0495609_0024881_436_945 160
246 3300046558 Ga0495633_0021073 Ga0495633_0021073_807_1319 160
247 3300046616 Ga0495668_0060201 Ga0495668_0060201_1298_1807 160
248 3300046660 Ga0495625_0000021 Ga0495625_0000021_89497_90006 160
249 3300046660 Ga0495625_0002809 Ga0495625_0002809_2568_3077 160
250 3300046660 Ga0495625_0333912 Ga0495625_0333912_238_744 160
251 3300046660 Ga0495625_0736308 Ga0495625_0736308_60_566 160
252 3300046665 Ga0495661_0013773 Ga0495661_0013773_136_645 160
253 3300046694 Ga0495649_0000009 Ga0495649_0000009_369521_370030 160
254 3300046694 Ga0495649_0112658 Ga0495649_0112658_107_613 160
255 3300047323 Ga0495683_0043106 Ga0495683_0043106_452_958 160
256 3300047443 Ga0495687_019948 Ga0495687_019948_1297_1806 160
257 3300047443 Ga0495687_030648 Ga0495687_030648_233_748 160
258 3300047443 Ga0495687_036641 Ga0495687_036641_1098_1607 160
259 3300047445 Ga0495677_0011031 Ga0495677_0011031_2751_3269 160
260 3300047469 Ga0495673_0021368 Ga0495673_0021368_1430_1939 160
261 3300047472 Ga0495686_0001677 Ga0495686_0001677_9195_9704 160
262 3300047472 Ga0495686_0021695 Ga0495686_0021695_1922_2431 160
263 3300047472 Ga0495686_0199105 Ga0495686_0199105_586_1104 160
264 3300050496 nmdc:mga07m45_138636_c1 nmdc:mga07m45_138636_c1_664_1173 160
265 3300053122 Ga0500608_003670 Ga0500608_003670_4145_4651 160
266 3300053122 Ga0500608_077727 Ga0500608_077727_507_1016 160
267 3300053125 Ga0500618_000057 Ga0500618_000057_68656_69165 160
268 3300053130 Ga0500642_0025900 Ga0500642_0025900_281_796 160
269 3300053156 Ga0500622_0001792 Ga0500622_0001792_2070_2579 160
270 3300053156 Ga0500622_0057569 Ga0500622_0057569_1384_1893 160
271 3300053157 Ga0500624_001370 Ga0500624_001370_3391_3900 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

66

120

0.95

PF12802

MarR_2

MarR family

61

120

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9329 42 100
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9322 42 82
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9302 41 100
6wxq-assembly1.cif.gz_B crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.9243 46 109
7wqu-assembly1.cif.gz_B feoc from klebsiella pneumoniae 0.9221 42 100
ID Description Score Start End Superfamily
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9428 42 100 1.10.10.10
3majA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9393 54 100 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9334 42 99 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9329 42 100 1.10.10.10
4hobC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9322 42 82 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3D4TAV7-F1-model_v4 MarR family transcriptional regulator 0.9802 10 147 GO:0003700
GO:0005737
GO:0006950
AF-A0A3D4TAV7-F1-model_v4 MarR family transcriptional regulator 0.9596 10 147 GO:0003700
GO:0005737
GO:0006950
AF-A0A7W5ZSF2-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.9078 1 155 GO:0003677
GO:0003700
GO:0005737
GO:0006950
AF-A0A519K109-F1-model_v4 MarR family transcriptional regulator 0.9051 1 159 GO:0003700
GO:0006950
AF-A0A4Q6A2T2-F1-model_v4 deleted 0.9049 12 155

Feature Viewer

pLDDT pTM Quality
82.12 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map