F377625

General Info

Members Datasets Scaffolds Average Seq Length
271 169 542 172

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10006999|Ga0114129_1000699911
Length 184
Sequence MAVLNREEGVLCSAMDTYLAIVSKREVRSYADQPIDPDARRRILEAGRISGSSGNKQQWRFIVVESDEKRARIAESVYVPGNVLGAKLIIVVVMQGAARVYFDVGRTSQNMMLAAWNEGIGSCPNGMTDGEAVASMLGLHSGEEPAIVLTFGYPARPVDPSSRSPQEWIQRANRRPFDDVVETV

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 1.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.8
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10006999 3300009147 Bacteria 16056
2 JGI25407J50210_10007561 3300003373 Bacteria 2724
3 JGI25407J50210_10009784 3300003373 Bacteria 2432
4 Ga0070658_10026568 3300005327 Bacteria 4644
5 Ga0070658_10398725 3300005327 Bacteria 1182
6 Ga0070683_100432066 3300005329 Bacteria 1256
7 Ga0070683_100502714 3300005329 Bacteria 1158
8 Ga0070683_100715553 3300005329 Bacteria 959
9 Ga0070682_100033257 3300005337 Bacteria 3132
10 Ga0070682_100044856 3300005337 Bacteria 2738
11 Ga0070682_100073928 3300005337 Bacteria 2187
12 Ga0070682_100417371 3300005337 Bacteria 1019
13 Ga0070682_101314901 3300005337 Bacteria 615
14 Ga0068868_100042210 3300005338 Bacteria 3558
15 Ga0070660_100068108 3300005339 Bacteria 2774
16 Ga0070687_100056312 3300005343 Bacteria 2057
17 Ga0070661_100337411 3300005344 Bacteria 1180
18 Ga0070692_10059768 3300005345 Bacteria 2004
19 Ga0070692_10150016 3300005345 Bacteria 1327
20 Ga0070668_100652786 3300005347 Bacteria 924
21 Ga0070669_100609263 3300005353 Bacteria 915
22 Ga0070669_100889286 3300005353 Bacteria 760
23 Ga0070674_100064387 3300005356 Bacteria 2569
24 Ga0070674_100282112 3300005356 Bacteria 1317
25 Ga0070673_100094137 3300005364 Bacteria 2455
26 Ga0070688_100335060 3300005365 Bacteria 1103
27 Ga0070659_100127495 3300005366 Bacteria 2065
28 Ga0070659_100219191 3300005366 Bacteria 1570
29 Ga0070659_100422070 3300005366 Bacteria 1128
30 Ga0070714_100092676 3300005435 Bacteria 2648
31 Ga0070710_10641918 3300005437 Bacteria 743
32 Ga0070711_100075059 3300005439 Bacteria 2393
33 Ga0070711_100440272 3300005439 Bacteria 1065
34 Ga0070700_100158856 3300005441 Bacteria 1554
35 Ga0070700_100874461 3300005441 Bacteria 730
36 Ga0070663_100521059 3300005455 Bacteria 990
37 Ga0068867_100378159 3300005459 Bacteria 1189
38 Ga0068867_100385779 3300005459 Bacteria 1178
39 Ga0070685_10318430 3300005466 Bacteria 1053
40 Ga0070684_100556681 3300005535 Bacteria 1064
41 Ga0070684_101074686 3300005535 Bacteria 756
42 Ga0068853_100238013 3300005539 Bacteria 1668
43 Ga0070672_100131177 3300005543 Bacteria 2060
44 Ga0070672_100398801 3300005543 Bacteria 1179
45 Ga0070686_100031317 3300005544 Bacteria 3251
46 Ga0070693_100242983 3300005547 Bacteria 1190
47 Ga0070665_100190381 3300005548 Bacteria 2053
48 Ga0070665_101424927 3300005548 Bacteria 702
49 Ga0070704_100174624 3300005549 Bacteria 1712
50 Ga0070664_100059853 3300005564 Bacteria 3241
51 Ga0070664_100921397 3300005564 Bacteria 820
52 Ga0068857_100041496 3300005577 Bacteria 4080
53 Ga0068854_100186786 3300005578 Bacteria 1622
54 Ga0068854_100902670 3300005578 Bacteria 777
55 Ga0068856_100135009 3300005614 Bacteria 2473
56 Ga0070702_100087056 3300005615 Bacteria 1886
57 Ga0068852_100154779 3300005616 Bacteria 2134
58 Ga0068852_100539335 3300005616 Bacteria 1166
59 Ga0068859_100285063 3300005617 Bacteria 1745
60 Ga0068864_100037963 3300005618 Bacteria 4111
61 Ga0068864_100252707 3300005618 Bacteria 1637
62 Ga0068864_100478458 3300005618 Bacteria 1195
63 Ga0068864_100682785 3300005618 Bacteria 1002
64 Ga0068851_10099341 3300005834 Bacteria 1542
65 Ga0068851_10113722 3300005834 Bacteria 1448
66 Ga0068851_10527360 3300005834 Bacteria 711
67 Ga0068870_10120816 3300005840 Bacteria 1509
68 Ga0068863_100337025 3300005841 Bacteria 1467
69 Ga0068862_100719153 3300005844 Bacteria 969
70 Ga0081538_10001176 3300005981 Bacteria 27640
71 Ga0081538_10001209 3300005981 Bacteria 27097
72 Ga0081538_10003933 3300005981 Bacteria 13851
73 Ga0081538_10009857 3300005981 Bacteria 7900
74 Ga0081538_10015227 3300005981 Bacteria 5967
75 Ga0081538_10062986 3300005981 Bacteria 2109
76 Ga0081538_10176162 3300005981 Bacteria 923
77 Ga0081540_1001158 3300005983 Bacteria 23234
78 Ga0081539_10051772 3300005985 Bacteria 2311
79 Ga0075432_10064717 3300006058 Bacteria 1306
80 Ga0070712_100038990 3300006175 Bacteria 3249
81 Ga0075431_101628083 3300006847 Bacteria 603
82 Ga0075434_100058390 3300006871 Bacteria 3834
83 Ga0068865_100153786 3300006881 Bacteria 1748
84 Ga0097620_100285060 3300006931 Bacteria 1745
85 Ga0075435_100341118 3300007076 Bacteria 1284
86 Ga0075435_100532291 3300007076 Bacteria 1017
87 Ga0111539_10445707 3300009094 Bacteria 1507
88 Ga0105245_10076896 3300009098 Bacteria 3042
89 Ga0105245_10122297 3300009098 Bacteria 2432
90 Ga0105245_10181703 3300009098 Bacteria 2010
91 Ga0105245_11343107 3300009098 Unclassified 764
92 Ga0105247_10305227 3300009101 Unclassified 1106
93 Ga0114129_10856481 3300009147 Bacteria 1155
94 Ga0114129_10905403 3300009147 Bacteria 1117
95 Ga0105243_10081850 3300009148 Bacteria 2637
96 Ga0105243_10374334 3300009148 Bacteria 1315
97 Ga0105243_10672705 3300009148 Bacteria 1006
98 Ga0105243_11039090 3300009148 Unclassified 824
99 Ga0105242_10384829 3300009176 Unclassified 1305
100 Ga0105242_10401797 3300009176 Bacteria 1279
101 Ga0105248_10638491 3300009177 Bacteria 1201
102 Ga0105237_10213538 3300009545 Bacteria 1929
103 Ga0105238_10164237 3300009551 Bacteria 2196
104 Ga0105238_10968859 3300009551 Bacteria 871
105 Ga0105249_10078653 3300009553 Bacteria 3060
106 Ga0105249_10607957 3300009553 Bacteria 1148
107 Ga0105249_10629255 3300009553 Unclassified 1129
108 Ga0105249_10719350 3300009553 Bacteria 1059
109 Ga0105239_10498696 3300010375 Bacteria 1384
110 Ga0105239_11095853 3300010375 Bacteria 917
111 Ga0105239_11264622 3300010375 Bacteria 851
112 Ga0157369_10434713 3300013105 Bacteria 1360
113 Ga0163162_11898933 3300013306 Bacteria 682
114 Ga0157372_10042608 3300013307 Bacteria 5022
115 Ga0157375_10352090 3300013308 Bacteria 1638
116 Ga0157375_10488160 3300013308 Bacteria 1396
117 Ga0157375_12004212 3300013308 Bacteria 688
118 Ga0163163_10080360 3300014325 Bacteria 3260
119 Ga0163163_10789677 3300014325 Bacteria 1013
120 Ga0163163_12178728 3300014325 Bacteria 613
121 Ga0157380_10112013 3300014326 Bacteria 2295
122 Ga0157380_10222204 3300014326 Bacteria 1690
123 Ga0157380_10994054 3300014326 Bacteria 872
124 Ga0182008_10030944 3300014497 Bacteria 2696
125 Ga0182008_10111923 3300014497 Bacteria 1353
126 Ga0157377_10027810 3300014745 Bacteria 3039
127 Ga0157377_10113412 3300014745 Bacteria 1632
128 Ga0157377_10141234 3300014745 Bacteria 1480
129 Ga0157379_10197557 3300014968 Bacteria 1818
130 Ga0197907_10902692 3300020069 Bacteria 1845
131 Ga0206356_11270227 3300020070 Bacteria 1842
132 Ga0206353_11055320 3300020082 Bacteria 3054
133 Ga0207656_10045378 3300025321 Bacteria 1881
134 Ga0207692_10727869 3300025898 Bacteria 645
135 Ga0207642_10077539 3300025899 Bacteria 1603
136 Ga0207645_10327553 3300025907 Bacteria 1023
137 Ga0207643_10029678 3300025908 Bacteria 3042
138 Ga0207643_10205549 3300025908 Bacteria 1200
139 Ga0207695_10881168 3300025913 Bacteria 775
140 Ga0207671_10478296 3300025914 Unclassified 993
141 Ga0207663_10081958 3300025916 Bacteria 2115
142 Ga0207663_10343136 3300025916 Bacteria 1129
143 Ga0207657_10000892 3300025919 Bacteria 31592
144 Ga0207657_10049867 3300025919 Bacteria 3645
145 Ga0207657_10115409 3300025919 Bacteria 2213
146 Ga0207657_10143763 3300025919 Bacteria 1947
147 Ga0207649_10205274 3300025920 Bacteria 1395
148 Ga0207652_10007356 3300025921 Bacteria 8878
149 Ga0207652_10022562 3300025921 Bacteria 5208
150 Ga0207652_10702685 3300025921 Bacteria 902
151 Ga0207681_10767858 3300025923 Bacteria 804
152 Ga0207694_10215534 3300025924 Bacteria 1565
153 Ga0207687_10017330 3300025927 Bacteria 4741
154 Ga0207687_10098059 3300025927 Bacteria 2151
155 Ga0207687_10235172 3300025927 Bacteria 1449
156 Ga0207664_10042568 3300025929 Bacteria 3545
157 Ga0207664_10515391 3300025929 Unclassified 1071
158 Ga0207690_10056945 3300025932 Bacteria 2639
159 Ga0207690_10280248 3300025932 Bacteria 1298
160 Ga0207690_11094765 3300025932 Bacteria 664
161 Ga0207706_10062842 3300025933 Bacteria 3270
162 Ga0207706_11032054 3300025933 Bacteria 690
163 Ga0207709_10331470 3300025935 Bacteria 1142
164 Ga0207670_10624958 3300025936 Bacteria 886
165 Ga0207669_10043974 3300025937 Bacteria 2620
166 Ga0207669_10284691 3300025937 Bacteria 1248
167 Ga0207669_10501432 3300025937 Bacteria 971
168 Ga0207704_10054844 3300025938 Bacteria 2432
169 Ga0207704_10693126 3300025938 Bacteria 843
170 Ga0207691_10285408 3300025940 Bacteria 1420
171 Ga0207691_10415001 3300025940 Bacteria 1147
172 Ga0207711_10428773 3300025941 Bacteria 1230
173 Ga0207689_10009197 3300025942 Bacteria 8546
174 Ga0207661_10087857 3300025944 Bacteria 2583
175 Ga0207661_10322545 3300025944 Bacteria 1389
176 Ga0207679_10780784 3300025945 Unclassified 870
177 Ga0207679_10999322 3300025945 Bacteria 767
178 Ga0207712_10101699 3300025961 Bacteria 2138
179 Ga0207712_10157801 3300025961 Bacteria 1759
180 Ga0207668_10200377 3300025972 Bacteria 1589
181 Ga0207677_10164697 3300026023 Bacteria 1727
182 Ga0207677_10471045 3300026023 Bacteria 1080
183 Ga0207703_11127381 3300026035 Bacteria 754
184 Ga0207639_10207843 3300026041 Bacteria 1683
185 Ga0207678_10390691 3300026067 Bacteria 1203
186 Ga0207708_10057789 3300026075 Bacteria 2960
187 Ga0207708_10826553 3300026075 Bacteria 799
188 Ga0207708_11005524 3300026075 Bacteria 725
189 Ga0207702_10168425 3300026078 Bacteria 2006
190 Ga0207648_10437816 3300026089 Bacteria 1189
191 Ga0207648_10763226 3300026089 Bacteria 899
192 Ga0207648_11681203 3300026089 Bacteria 596
193 Ga0207676_10224210 3300026095 Bacteria 1676
194 Ga0207676_10326045 3300026095 Bacteria 1411
195 Ga0207676_10418396 3300026095 Bacteria 1256
196 Ga0207674_10048717 3300026116 Bacteria 4336
197 Ga0207675_100203678 3300026118 Bacteria 1901
198 Ga0207675_100300738 3300026118 Bacteria 1563
199 Ga0207675_100329253 3300026118 Bacteria 1493
200 Ga0207675_100344953 3300026118 Bacteria 1458
201 Ga0207683_10156247 3300026121 Bacteria 2060
202 Ga0207698_10053190 3300026142 Bacteria 3107
203 Ga0207698_10087858 3300026142 Bacteria 2533
204 Ga0207698_10441277 3300026142 Bacteria 1254
205 Ga0207698_10962119 3300026142 Bacteria 863
206 Ga0268266_10108563 3300028379 Bacteria 2456
207 Ga0268264_10370251 3300028381 Bacteria 1369
208 Ga0265318_10199866 3300028577 Bacteria 731
209 Ga0307410_11219581 3300031852 Bacteria 656
210 Ga0307416_101156671 3300032002 Bacteria 879
211 Ga0307415_100276651 3300032126 Bacteria 1378
212 Ga0395900_0218614 3300037418 Unclassified 1922
213 Ga0395900_1078431 3300037418 Unclassified 721
214 Ga0395898_0460361 3300037466 Unclassified 1211
215 Ga0436364_0239369 3300037853 Bacteria 6757
216 Ga0395901_0097041 3300038443 Bacteria 3089
217 Ga0436362_0643147 3300039453 Bacteria 854
218 Ga0466966_0089531 3300044684 Bacteria 1912
219 Ga0466963_0083731 3300044694 Bacteria 2163
220 Ga0466964_0027301 3300044706 Bacteria 2241
221 Ga0466971_0592907 3300044719 Unclassified 552
222 Ga0466968_0038605 3300044735 Bacteria 2007
223 Ga0466957_0131698 3300044842 Bacteria 1603
224 Ga0466960_0056787 3300044901 Bacteria 1907
225 Ga0466959_0093390 3300045049 Bacteria 2159
226 Ga0466958_0016323 3300045836 Bacteria 4274
227 Ga0466967_0001039 3300045976 Bacteria 15239
228 Ga0466967_0098129 3300045976 Bacteria 2675
229 Ga0466967_0171687 3300045976 Bacteria 2040
230 Ga0466967_0200485 3300045976 Bacteria 1890
231 Ga0466967_0546900 3300045976 Bacteria 1139
232 Ga0495629_0674962 3300046459 Bacteria 687
233 Ga0496100_0147110 3300048903 Bacteria 1676
234 Ga0496102_0260419 3300048905 Bacteria 1635
235 Ga0496104_0067745 3300048907 Bacteria 3391
236 Ga0496105_0314165 3300048908 Bacteria 1257
237 Ga0496106_0406270 3300048909 Bacteria 1094
238 Ga0496107_0449273 3300048910 Bacteria 957
239 Ga0496108_0284440 3300048911 Bacteria 1439
240 Ga0496109_0073597 3300048912 Bacteria 3139
241 Ga0496110_0150720 3300048913 Unclassified 2106
242 Ga0496110_0883569 3300048913 Bacteria 799
243 Ga0496110_0924938 3300048913 Bacteria 778
244 Ga0496112_0165661 3300048915 Bacteria 2176
245 Ga0496112_0512161 3300048915 Bacteria 1135
246 Ga0501039_0041379 3300049575 Bacteria 3559
247 Ga0501040_0140562 3300049576 Bacteria 1701
248 Ga0501041_0019245 3300049577 Bacteria 4075
249 Ga0501042_0045304 3300049578 Bacteria 3135
250 Ga0501046_0355047 3300049580 Unclassified 1064
251 Ga0501048_0122743 3300049582 Bacteria 1836
252 Ga0501067_0254800 3300049583 Bacteria 977
253 Ga0501070_0344212 3300049586 Bacteria 1211
254 Ga0501071_0336500 3300049587 Unclassified 1147
255 Ga0501072_0300716 3300049588 Unclassified 1275
256 Ga0501074_0441284 3300049590 Bacteria 923
257 Ga0501076_0131983 3300049592 Bacteria 2026
258 Ga0501077_0259410 3300049593 Bacteria 1105
259 Ga0501081_0360242 3300049743 Unclassified 1073
260 Ga0501081_0650679 3300049743 Bacteria 790
261 nmdc:mga05p37_7917_c1 3300050507 Bacteria 12542
262 nmdc:mga06r32_493276_c1 3300050510 Bacteria 1202
263 nmdc:mga08y16_825129_c1 3300050511 Bacteria 918
264 nmdc:mga0n895_234215_c1 3300050512 Bacteria 1864
265 nmdc:mga0n895_673504_c1 3300050512 Bacteria 1032
266 nmdc:mga0n895_799314_c1 3300050512 Bacteria 934
267 nmdc:mga0rr50_330568_c1 3300050513 Bacteria 1279
268 nmdc:mga0a205_2876_c1 3300050515 Bacteria 15221
269 Ga0501084_0041965 3300054114 Bacteria 3826
270 Ga0466962_0159312 3300061719 Unclassified 1097
271 Ga0530510_0221884 3300061734 Bacteria 1405
272 Ga0114129_10006999
273 JGI25407J50210_10007561
274 JGI25407J50210_10009784
275 Ga0070658_10026568
276 Ga0070658_10398725
277 Ga0070683_100432066
278 Ga0070683_100502714
279 Ga0070683_100715553
280 Ga0070682_100033257
281 Ga0070682_100044856
282 Ga0070682_100073928
283 Ga0070682_100417371
284 Ga0070682_101314901
285 Ga0068868_100042210
286 Ga0070660_100068108
287 Ga0070687_100056312
288 Ga0070661_100337411
289 Ga0070692_10059768
290 Ga0070692_10150016
291 Ga0070668_100652786
292 Ga0070669_100609263
293 Ga0070669_100889286
294 Ga0070674_100064387
295 Ga0070674_100282112
296 Ga0070673_100094137
297 Ga0070688_100335060
298 Ga0070659_100127495
299 Ga0070659_100219191
300 Ga0070659_100422070
301 Ga0070714_100092676
302 Ga0070710_10641918
303 Ga0070711_100075059
304 Ga0070711_100440272
305 Ga0070700_100158856
306 Ga0070700_100874461
307 Ga0070663_100521059
308 Ga0068867_100378159
309 Ga0068867_100385779
310 Ga0070685_10318430
311 Ga0070684_100556681
312 Ga0070684_101074686
313 Ga0068853_100238013
314 Ga0070672_100131177
315 Ga0070672_100398801
316 Ga0070686_100031317
317 Ga0070693_100242983
318 Ga0070665_100190381
319 Ga0070665_101424927
320 Ga0070704_100174624
321 Ga0070664_100059853
322 Ga0070664_100921397
323 Ga0068857_100041496
324 Ga0068854_100186786
325 Ga0068854_100902670
326 Ga0068856_100135009
327 Ga0070702_100087056
328 Ga0068852_100154779
329 Ga0068852_100539335
330 Ga0068859_100285063
331 Ga0068864_100037963
332 Ga0068864_100252707
333 Ga0068864_100478458
334 Ga0068864_100682785
335 Ga0068851_10099341
336 Ga0068851_10113722
337 Ga0068851_10527360
338 Ga0068870_10120816
339 Ga0068863_100337025
340 Ga0068862_100719153
341 Ga0081538_10001176
342 Ga0081538_10001209
343 Ga0081538_10003933
344 Ga0081538_10009857
345 Ga0081538_10015227
346 Ga0081538_10062986
347 Ga0081538_10176162
348 Ga0081540_1001158
349 Ga0081539_10051772
350 Ga0075432_10064717
351 Ga0070712_100038990
352 Ga0075431_101628083
353 Ga0075434_100058390
354 Ga0068865_100153786
355 Ga0097620_100285060
356 Ga0075435_100341118
357 Ga0075435_100532291
358 Ga0111539_10445707
359 Ga0105245_10076896
360 Ga0105245_10122297
361 Ga0105245_10181703
362 Ga0105245_11343107
363 Ga0105247_10305227
364 Ga0114129_10856481
365 Ga0114129_10905403
366 Ga0105243_10081850
367 Ga0105243_10374334
368 Ga0105243_10672705
369 Ga0105243_11039090
370 Ga0105242_10384829
371 Ga0105242_10401797
372 Ga0105248_10638491
373 Ga0105237_10213538
374 Ga0105238_10164237
375 Ga0105238_10968859
376 Ga0105249_10078653
377 Ga0105249_10607957
378 Ga0105249_10629255
379 Ga0105249_10719350
380 Ga0105239_10498696
381 Ga0105239_11095853
382 Ga0105239_11264622
383 Ga0157369_10434713
384 Ga0163162_11898933
385 Ga0157372_10042608
386 Ga0157375_10352090
387 Ga0157375_10488160
388 Ga0157375_12004212
389 Ga0163163_10080360
390 Ga0163163_10789677
391 Ga0163163_12178728
392 Ga0157380_10112013
393 Ga0157380_10222204
394 Ga0157380_10994054
395 Ga0182008_10030944
396 Ga0182008_10111923
397 Ga0157377_10027810
398 Ga0157377_10113412
399 Ga0157377_10141234
400 Ga0157379_10197557
401 Ga0197907_10902692
402 Ga0206356_11270227
403 Ga0206353_11055320
404 Ga0207656_10045378
405 Ga0207692_10727869
406 Ga0207642_10077539
407 Ga0207645_10327553
408 Ga0207643_10029678
409 Ga0207643_10205549
410 Ga0207695_10881168
411 Ga0207671_10478296
412 Ga0207663_10081958
413 Ga0207663_10343136
414 Ga0207657_10000892
415 Ga0207657_10049867
416 Ga0207657_10115409
417 Ga0207657_10143763
418 Ga0207649_10205274
419 Ga0207652_10007356
420 Ga0207652_10022562
421 Ga0207652_10702685
422 Ga0207681_10767858
423 Ga0207694_10215534
424 Ga0207687_10017330
425 Ga0207687_10098059
426 Ga0207687_10235172
427 Ga0207664_10042568
428 Ga0207664_10515391
429 Ga0207690_10056945
430 Ga0207690_10280248
431 Ga0207690_11094765
432 Ga0207706_10062842
433 Ga0207706_11032054
434 Ga0207709_10331470
435 Ga0207670_10624958
436 Ga0207669_10043974
437 Ga0207669_10284691
438 Ga0207669_10501432
439 Ga0207704_10054844
440 Ga0207704_10693126
441 Ga0207691_10285408
442 Ga0207691_10415001
443 Ga0207711_10428773
444 Ga0207689_10009197
445 Ga0207661_10087857
446 Ga0207661_10322545
447 Ga0207679_10780784
448 Ga0207679_10999322
449 Ga0207712_10101699
450 Ga0207712_10157801
451 Ga0207668_10200377
452 Ga0207677_10164697
453 Ga0207677_10471045
454 Ga0207703_11127381
455 Ga0207639_10207843
456 Ga0207678_10390691
457 Ga0207708_10057789
458 Ga0207708_10826553
459 Ga0207708_11005524
460 Ga0207702_10168425
461 Ga0207648_10437816
462 Ga0207648_10763226
463 Ga0207648_11681203
464 Ga0207676_10224210
465 Ga0207676_10326045
466 Ga0207676_10418396
467 Ga0207674_10048717
468 Ga0207675_100203678
469 Ga0207675_100300738
470 Ga0207675_100329253
471 Ga0207675_100344953
472 Ga0207683_10156247
473 Ga0207698_10053190
474 Ga0207698_10087858
475 Ga0207698_10441277
476 Ga0207698_10962119
477 Ga0268266_10108563
478 Ga0268264_10370251
479 Ga0265318_10199866
480 Ga0307410_11219581
481 Ga0307416_101156671
482 Ga0307415_100276651
483 Ga0395900_0218614
484 Ga0395900_1078431
485 Ga0395898_0460361
486 Ga0436364_0239369
487 Ga0395901_0097041
488 Ga0436362_0643147
489 Ga0466966_0089531
490 Ga0466963_0083731
491 Ga0466964_0027301
492 Ga0466971_0592907
493 Ga0466968_0038605
494 Ga0466957_0131698
495 Ga0466960_0056787
496 Ga0466959_0093390
497 Ga0466958_0016323
498 Ga0466967_0001039
499 Ga0466967_0098129
500 Ga0466967_0171687
501 Ga0466967_0200485
502 Ga0466967_0546900
503 Ga0495629_0674962
504 Ga0496100_0147110
505 Ga0496102_0260419
506 Ga0496104_0067745
507 Ga0496105_0314165
508 Ga0496106_0406270
509 Ga0496107_0449273
510 Ga0496108_0284440
511 Ga0496109_0073597
512 Ga0496110_0150720
513 Ga0496110_0883569
514 Ga0496110_0924938
515 Ga0496112_0165661
516 Ga0496112_0512161
517 Ga0501039_0041379
518 Ga0501040_0140562
519 Ga0501041_0019245
520 Ga0501042_0045304
521 Ga0501046_0355047
522 Ga0501048_0122743
523 Ga0501067_0254800
524 Ga0501070_0344212
525 Ga0501071_0336500
526 Ga0501072_0300716
527 Ga0501074_0441284
528 Ga0501076_0131983
529 Ga0501077_0259410
530 Ga0501081_0360242
531 Ga0501081_0650679
532 nmdc:mga05p37_7917_c1
533 nmdc:mga06r32_493276_c1
534 nmdc:mga08y16_825129_c1
535 nmdc:mga0n895_234215_c1
536 nmdc:mga0n895_673504_c1
537 nmdc:mga0n895_799314_c1
538 nmdc:mga0rr50_330568_c1
539 nmdc:mga0a205_2876_c1
540 Ga0501084_0041965
541 Ga0466962_0159312
542 Ga0530510_0221884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

82

153

0.93

PF00881

Nitroreductase

Nitroreductase family

21

95

0.91

PF14512

TM1586_NiRdase

Putative TM nitroreductase

16

184

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g14-assembly1.cif.gz_A crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8749 12 144
6q1l-assembly1.cif.gz_B crystal structure of oxidized iodotyrosine deiodinase (iyd) bound to fmn and 3-iodo-l-tyrosine 0.8369 11 148
5j6c-assembly1.cif.gz_B fmn-dependent nitroreductase (cdr20291_0767) from clostridium difficile r20291 0.8324 9 151
3g14-assembly1.cif.gz_B crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8218 12 152
3e10-assembly1.cif.gz_A crystal structure of putative nadh oxidase (np_348178.1) from clostridium acetobutylicum at 1.40 a resolution 0.8148 10 150
ID Description Score Start End Superfamily
3g14A00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8526 12 143 3.40.109.10
5j6cB00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8324 9 151 3.40.109.10
af_Q58779_3_195_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8251 11 136 3.40.109.10
3gfdA01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8231 9 139 3.40.109.10
3k6hB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8054 15 139 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A662MUE6-F1-model_v4 Nitroreductase family protein 0.9139 10 141 GO:0016491
AF-A0A1V1P965-F1-model_v4 NADPH-flavin oxidoreductase 0.9027 10 143 GO:0016491
AF-A0A7X5VZD3-F1-model_v4 deleted 0.9025 9 138
AF-A0A2M6K8U8-F1-model_v4 Nitroreductase domain-containing protein 0.8981 9 138 GO:0016491
AF-A0A7J4EUV6-F1-model_v4 Nitroreductase family protein 0.8979 11 138 GO:0016491

Map