F377517

General Info

Members Datasets Scaffolds Average Seq Length
271 220 233 151

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_101455651|Ga0068853_1014556512
Length 155
Sequence MTEAAAAADTRDIIVDEVFPHAPETIWKALTTPELMGRWVMAPNGFVPVVGNRFTYQTTPGGAWDGVIHCEVLEVIPNERFVYAWRGGHPDNVTGYGAPLDTIVTFTLTRVAEGTRVRMVHSGFVLPRNDSAYTNMGKGWTKVVHALGTIAAGEA

Samples

Sample ID Description Type Environment
1 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
2 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
3 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
4 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
5 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
6 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
7 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
8 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
9 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
10 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
11 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
12 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
13 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
14 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
15 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
16 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
17 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
18 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
19 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
20 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
21 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
22 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
23 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
24 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
25 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
26 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
27 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
28 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
29 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
30 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
31 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
32 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
33 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
34 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
35 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
36 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
37 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
38 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
41 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
147 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
148 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
149 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
150 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
151 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
152 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
153 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
154 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
155 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
156 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
157 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
208 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
209 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
217 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
218 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
219 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
220 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.61
Metatranscriptomes 0
Isolates 14.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.24
Nodule 9.96
Rhizoplane 7.75
Rhizosphere 52.77
Stem 0
Stem Tuber 0
Unclassified 13.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10037041 3300002067 Bacteria 1430
2 JGI25152J39213_1001863 3300002773 Bacteria 8496
3 JGI25151J46595_10012205 3300003187 Bacteria 3914
4 JGI25153J46596_10029812 3300003215 Bacteria 1866
5 rootH1_10025939 3300003316 Bacteria 4484
6 rootH1_10025939 3300003323 Bacteria 6872
7 rootH2_10037340 3300003320 Bacteria 4917
8 rootH2_10070945 3300003320 Bacteria 7139
9 rootL2_10004067 3300003322 Bacteria 3214
10 rootL2_10243166 3300003322 Bacteria 2063
11 rootH1_10023157 3300003323 Bacteria 11483
12 rootH1_10082836 3300003323 Bacteria 1335
13 Ga0055528_1005639 3300003790 Bacteria 5784
14 Ga0055540_1051218 3300003792 Bacteria 851
15 Ga0070658_10000193 3300005327 Bacteria 53795
16 Ga0070658_10552141 3300005327 Bacteria 997
17 Ga0070670_100293735 3300005331 Bacteria 1421
18 Ga0070670_100604855 3300005331 Bacteria 981
19 Ga0070677_10521076 3300005333 Bacteria 647
20 Ga0068869_100368754 3300005334 Bacteria 1174
21 Ga0070660_100005845 3300005339 Bacteria 8516
22 Ga0070660_100095072 3300005339 Bacteria 2355
23 Ga0070661_100257840 3300005344 Bacteria 1347
24 Ga0070671_101242610 3300005355 Bacteria 656
25 Ga0070674_100441788 3300005356 Bacteria 1072
26 Ga0070674_100994590 3300005356 Bacteria 736
27 Ga0070673_100141314 3300005364 Bacteria 2031
28 Ga0070673_101776364 3300005364 Bacteria 584
29 Ga0070659_100415694 3300005366 Bacteria 1137
30 Ga0070659_101782188 3300005366 Bacteria 551
31 Ga0070678_100153253 3300005456 Bacteria 1859
32 Ga0070662_101021762 3300005457 Bacteria 708
33 Ga0070681_10748268 3300005458 Bacteria 894
34 Ga0068853_101294818 3300005539 Bacteria 704
35 Ga0068853_101455651 3300005539 Bacteria 663
36 Ga0070665_100069099 3300005548 Bacteria 3540
37 Ga0070665_100197603 3300005548 Bacteria 2012
38 Ga0068855_100008020 3300005563 Bacteria 12754
39 Ga0068855_100242428 3300005563 Bacteria 2014
40 Ga0068857_101410468 3300005577 Bacteria 678
41 Ga0068856_100033148 3300005614 Bacteria 5058
42 Ga0068856_100093406 3300005614 Bacteria 2994
43 Ga0068852_100001546 3300005616 Bacteria 15615
44 Ga0068858_100000119 3300005842 Bacteria 82628
45 Ga0075365_10459663 3300006038 Bacteria 899
46 Ga0075363_100133075 3300006048 Bacteria 1396
47 Ga0075367_10303498 3300006178 Bacteria 1005
48 Ga0075369_10038153 3300006186 Bacteria 2049
49 Ga0097621_101755717 3300006237 Bacteria 591
50 Ga0075370_10015313 3300006353 Bacteria 4103
51 Ga0075370_10080586 3300006353 Bacteria 1870
52 Ga0068871_101657349 3300006358 Bacteria 606
53 Ga0068865_100979858 3300006881 Bacteria 739
54 Ga0097620_100180081 3300006931 Bacteria 2196
55 Ga0099824_1016622 3300006942 Bacteria 6617
56 Ga0099794_10321127 3300007265 Bacteria 803
57 Ga0105251_10055351 3300009011 Bacteria 1881
58 Ga0105244_10210155 3300009036 Unclassified 915
59 Ga0105240_10000347 3300009093 Bacteria 86681
60 Ga0105240_10017650 3300009093 Bacteria 9609
61 Ga0105245_10000480 3300009098 Bacteria 36564
62 Ga0114129_11399876 3300009147 Bacteria 863
63 Ga0105237_10627370 3300009545 Bacteria 1082
64 Ga0105238_10011631 3300009551 Bacteria 8866
65 Ga0105238_10144816 3300009551 Bacteria 2352
66 Ga0105238_10519452 3300009551 Bacteria 1193
67 Ga0105249_12400672 3300009553 Bacteria 600
68 Ga0105239_10050707 3300010375 Bacteria 4551
69 Ga0105239_10095975 3300010375 Bacteria 3275
70 Ga0105246_11097315 3300011119 Bacteria 726
71 Ga0105246_11448426 3300011119 Bacteria 643
72 Ga0157378_10571422 3300013297 Bacteria 1139
73 Ga0163162_10902867 3300013306 Bacteria 996
74 Ga0163162_11272086 3300013306 Bacteria 836
75 Ga0182008_10072974 3300014497 Bacteria 1689
76 Ga0157377_10189375 3300014745 Bacteria 1299
77 Ga0213876_10030279 3300021384 Bacteria 2855
78 Ga0209436_114429 3300025208 Bacteria 1258
79 Ga0207425_1030026 3300025245 Bacteria 1092
80 Ga0209129_1000068 3300025258 Bacteria 217385
81 Ga0209673_1001024 3300025273 Bacteria 33282
82 Ga0209675_1005799 3300025291 Bacteria 5085
83 Ga0209025_1000045 3300025294 Bacteria 349118
84 Ga0209564_1027096 3300025295 Bacteria 1871
85 Ga0209758_1004830 3300025297 Bacteria 10876
86 Ga0209050_1006341 3300025298 Bacteria 7038
87 Ga0207426_1081670 3300025302 Bacteria 876
88 Ga0209051_1013650 3300025303 Bacteria 3849
89 Ga0207656_10145571 3300025321 Bacteria 1119
90 Ga0207713_1042036 3300025735 Bacteria 1901
91 Ga0207645_10408028 3300025907 Bacteria 914
92 Ga0207705_10001107 3300025909 Bacteria 21899
93 Ga0207707_10635161 3300025912 Bacteria 901
94 Ga0207695_10000670 3300025913 Bacteria 67451
95 Ga0207695_10075880 3300025913 Bacteria 3419
96 Ga0207671_10344810 3300025914 Bacteria 1180
97 Ga0207671_10501521 3300025914 Bacteria 968
98 Ga0207657_10002059 3300025919 Bacteria 21766
99 Ga0207649_10216811 3300025920 Bacteria 1361
100 Ga0207652_11052051 3300025921 Bacteria 713
101 Ga0207694_10050591 3300025924 Bacteria 3219
102 Ga0207687_10000882 3300025927 Bacteria 20322
103 Ga0207690_10568089 3300025932 Bacteria 923
104 Ga0207706_10870624 3300025933 Bacteria 762
105 Ga0207669_10277039 3300025937 Bacteria 1263
106 Ga0207704_11207287 3300025938 Bacteria 645
107 Ga0207689_10270344 3300025942 Bacteria 1407
108 Ga0207667_10000429 3300025949 Bacteria 56506
109 Ga0207651_10115153 3300025960 Bacteria 2027
110 Ga0207651_11327670 3300025960 Bacteria 647
111 Ga0207658_10370661 3300025986 Bacteria 1252
112 Ga0207703_10000161 3300026035 Bacteria 77310
113 Ga0207639_10096035 3300026041 Bacteria 2384
114 Ga0207639_10670251 3300026041 Bacteria 961
115 Ga0207702_10028529 3300026078 Bacteria 4640
116 Ga0207683_10144594 3300026121 Bacteria 2144
117 Ga0207698_10001115 3300026142 Bacteria 15641
118 Ga0207698_10662838 3300026142 Bacteria 1035
119 Ga0207698_11689263 3300026142 Bacteria 649
120 Ga0207428_10021739 3300027907 Bacteria 5427
121 Ga0268266_10259757 3300028379 Bacteria 1609
122 Ga0268265_11005149 3300028380 Bacteria 824
123 Ga0265334_10095297 3300028573 Bacteria 1082
124 Ga0265340_10147136 3300031247 Bacteria 1075
125 Ga0307513_10003074 3300031456 Bacteria 22759
126 Ga0307513_10315688 3300031456 Bacteria 1323
127 Ga0307509_10000008 3300031507 Bacteria 354271
128 Ga0307509_10155814 3300031507 Bacteria 2191
129 Ga0307508_10000165 3300031616 Bacteria 79729
130 Ga0307410_10899360 3300031852 Bacteria 758
131 Ga0307409_101165762 3300031995 Bacteria 793
132 Ga0307416_101185656 3300032002 Bacteria 869
133 Ga0307416_101521140 3300032002 Bacteria 775
134 Ga0373931_0200372 3300035691 Bacteria 1192
135 Ga0395899_0162757 3300037312 Bacteria 1575
136 Ga0395900_0462368 3300037418 Bacteria 1223
137 Ga0395898_0822771 3300037466 Bacteria 868
138 Ga0395905_0000171 3300037471 Bacteria 105750
139 Ga0395905_0081984 3300037471 Bacteria 3023
140 Ga0395905_1564076 3300037471 Bacteria 564
141 Ga0395901_0413208 3300038443 Bacteria 1385
142 Ga0436365_1753497 3300039437 Bacteria 1973
143 Ga0451787_226835 3300041441 Bacteria 1822
144 Ga0451791_0840209 3300041451 Bacteria 1585
145 Ga0451793_0797312 3300041452 Bacteria 711
146 Ga0451833_0256410 3300041491 Bacteria 5820
147 Ga0451837_0205682 3300041494 Bacteria 658
148 Ga0451839_1150549 3300041496 Bacteria 1141
149 Ga0451841_0112297 3300041498 Bacteria 1813
150 Ga0451845_0411381 3300041501 Bacteria 1064
151 Ga0451847_0214195 3300041503 Bacteria 1509
152 Ga0451849_0831447 3300041505 Bacteria 1198
153 Ga0451851_1058339 3300041507 Bacteria 3611
154 Ga0451843_0199322 3300041509 Bacteria 948
155 Ga0451853_1290613 3300041512 Bacteria 1556
156 Ga0466959_0117008 3300045049 Bacteria 1898
157 Ga0495629_0794121 3300046459 Bacteria 625
158 Ga0495638_0258891 3300046460 Bacteria 955
159 Ga0495651_0522966 3300046462 Bacteria 757
160 Ga0495650_0053816 3300046471 Bacteria 1646
161 Ga0495585_0062781 3300046492 Bacteria 2040
162 Ga0495596_0088067 3300046500 Bacteria 1205
163 Ga0495606_0022625 3300046507 Bacteria 4573
164 Ga0495620_0029571 3300046515 Bacteria 2533
165 Ga0495631_0392279 3300046518 Bacteria 591
166 Ga0495632_0095215 3300046519 Bacteria 1407
167 Ga0495643_0021433 3300046522 Bacteria 3707
168 Ga0495643_0053050 3300046522 Bacteria 2175
169 Ga0495666_0145146 3300046526 Bacteria 1105
170 Ga0495652_0249737 3300046529 Bacteria 1315
171 Ga0495654_0014720 3300046530 Bacteria 4159
172 Ga0495597_0193004 3300046542 Bacteria 818
173 Ga0495633_0059309 3300046558 Bacteria 1795
174 Ga0495656_0485537 3300046615 Bacteria 654
175 Ga0495668_0609672 3300046616 Bacteria 603
176 Ga0495625_0282919 3300046660 Bacteria 1066
177 Ga0495588_0284152 3300046674 Bacteria 872
178 Ga0495636_0085553 3300047318 Bacteria 1363
179 Ga0495636_0259819 3300047318 Bacteria 805
180 Ga0495683_0284295 3300047323 Bacteria 715
181 Ga0495686_0003605 3300047472 Bacteria 13275
182 Ga0495626_0049928 3300048091 Bacteria 1935
183 Ga0496102_0004715 3300048905 Bacteria 11542
184 Ga0496102_0028138 3300048905 Bacteria 5022
185 Ga0496102_0137843 3300048905 Bacteria 2286
186 Ga0496102_0263970 3300048905 Bacteria 1623
187 Ga0496102_0332669 3300048905 Bacteria 1430
188 Ga0496103_0031456 3300048906 Bacteria 3233
189 Ga0496103_0048726 3300048906 Bacteria 2618
190 Ga0496103_0599912 3300048906 Bacteria 701
191 Ga0496106_0005800 3300048909 Bacteria 9129
192 Ga0496106_0464993 3300048909 Bacteria 1016
193 Ga0496107_0132224 3300048910 Bacteria 1842
194 Ga0496107_0437022 3300048910 Bacteria 973
195 Ga0496108_0056312 3300048911 Bacteria 3303
196 Ga0496108_1127087 3300048911 Bacteria 666
197 Ga0496109_0446605 3300048912 Bacteria 1221
198 Ga0496110_0016105 3300048913 Bacteria 6234
199 Ga0496111_0002466 3300048914 Bacteria 11164
200 Ga0496111_0021774 3300048914 Bacteria 4479
201 Ga0496116_0005215 3300048919 Bacteria 12168
202 Ga0496120_0126705 3300048923 Bacteria 1313
203 Ga0496121_0199207 3300048924 Bacteria 1429
204 Ga0496122_0000488 3300048925 Bacteria 82252
205 Ga0496123_0002461 3300048926 Bacteria 22940
206 Ga0496125_0523787 3300048928 Unclassified 662
207 Ga0496126_0000542 3300048929 Bacteria 73066
208 Ga0496126_0032668 3300048929 Bacteria 4901
209 Ga0496126_0758497 3300048929 Bacteria 748
210 Ga0501038_0087861 3300049574 Bacteria 2610
211 Ga0501043_0069201 3300049579 Bacteria 2772
212 nmdc:mga03683_120013_c1 3300050489 Bacteria 1168
213 nmdc:mga03683_318353_c1 3300050489 Bacteria 732
214 nmdc:mga03683_471799_c1 3300050489 Bacteria 605
215 nmdc:mga0yw44_106066_c1 3300050492 Bacteria 1795
216 nmdc:mga0yw44_252424_c1 3300050492 Bacteria 1174
217 nmdc:mga06z11_345399_c1 3300050494 Bacteria 890
218 nmdc:mga06z11_73991_c1 3300050494 Bacteria 1810
219 nmdc:mga07m45_324546_c1 3300050496 Bacteria 895
220 nmdc:mga0sz30_224776_c1 3300050516 Bacteria 835
221 Ga0500578_0218540 3300053086 Bacteria 1159
222 Ga0500644_0162646 3300053088 Bacteria 903
223 Ga0500594_0046051 3300053118 Bacteria 1212
224 Ga0500594_0149078 3300053118 Bacteria 751
225 Ga0500642_0229651 3300053130 Bacteria 858
226 Ga0500658_0000367 3300053134 Bacteria 19903
227 Ga0500559_0172890 3300053136 Bacteria 1016
228 Ga0500577_0102261 3300053142 Bacteria 1173
229 Ga0500588_0077517 3300053146 Bacteria 1104
230 Ga0500616_0000501 3300053153 Bacteria 50041
231 Ga0500616_0165864 3300053153 Bacteria 1008
232 Ga0500627_0092263 3300053158 Bacteria 1356
233 Ga0500645_012980 3300053730 Bacteria 2683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_11399876 Ga0114129_113998762 120
2 3300025907 Ga0207645_10408028 Ga0207645_104080282 120
3 iso_pu_bacteria 2808606370 2808892856 127
4 iso_pu_bacteria 2919391150 2919394425 127
5 iso_pu_bacteria 2945920336 2945922324 127
6 iso_pu_bacteria 2945956166 2945960834 127
7 iso_pu_bacteria 2946037020 2946037404 127
8 3300002773 JGI25152J39213_1001863 JGI25152J39213_10018634 131
9 3300003187 JGI25151J46595_10012205 JGI25151J46595_100122052 131
10 3300003320 rootH2_10070945 rootH2_100709453 131
11 3300003322 rootL2_10243166 rootL2_102431661 131
12 3300005331 Ga0070670_100293735 Ga0070670_1002937352 131
13 3300009036 Ga0105244_10210155 Ga0105244_102101551 131
14 3300011119 Ga0105246_11097315 Ga0105246_110973151 131
15 3300025245 Ga0207425_1030026 Ga0207425_10300262 131
16 3300025258 Ga0209129_1000068 Ga0209129_100006819 131
17 3300025294 Ga0209025_1000045 Ga0209025_1000045305 131
18 3300027907 Ga0207428_10021739 Ga0207428_100217393 131
19 3300031852 Ga0307410_10899360 Ga0307410_108993602 131
20 3300032002 Ga0307416_101185656 Ga0307416_1011856561 131
21 3300037312 Ga0395899_0162757 Ga0395899_0162757_974_1387 131
22 3300037418 Ga0395900_0462368 Ga0395900_0462368_42_455 131
23 3300037466 Ga0395898_0822771 Ga0395898_0822771_294_707 131
24 3300037471 Ga0395905_1564076 Ga0395905_1564076_113_526 131
25 3300038443 Ga0395901_0413208 Ga0395901_0413208_171_584 131
26 3300047318 Ga0495636_0085553 Ga0495636_0085553_502_915 131
27 3300048905 Ga0496102_0004715 Ga0496102_0004715_4931_5338 131
28 3300048905 Ga0496102_0028138 Ga0496102_0028138_4200_4607 131
29 3300048905 Ga0496102_0137843 Ga0496102_0137843_974_1381 131
30 3300048905 Ga0496102_0263970 Ga0496102_0263970_1135_1548 131
31 3300048905 Ga0496102_0332669 Ga0496102_0332669_118_525 131
32 3300048906 Ga0496103_0031456 Ga0496103_0031456_1264_1671 131
33 3300048906 Ga0496103_0048726 Ga0496103_0048726_825_1232 131
34 3300048906 Ga0496103_0599912 Ga0496103_0599912_211_624 131
35 3300048909 Ga0496106_0005800 Ga0496106_0005800_640_1047 131
36 3300048909 Ga0496106_0464993 Ga0496106_0464993_69_482 131
37 3300048910 Ga0496107_0132224 Ga0496107_0132224_530_937 131
38 3300048910 Ga0496107_0437022 Ga0496107_0437022_508_921 131
39 3300048911 Ga0496108_0056312 Ga0496108_0056312_2757_3164 131
40 3300048911 Ga0496108_1127087 Ga0496108_1127087_44_457 131
41 3300048912 Ga0496109_0446605 Ga0496109_0446605_680_1087 131
42 3300048913 Ga0496110_0016105 Ga0496110_0016105_5457_5864 131
43 3300048914 Ga0496111_0002466 Ga0496111_0002466_6003_6410 131
44 3300048914 Ga0496111_0021774 Ga0496111_0021774_1046_1453 131
45 3300048928 Ga0496125_0523787 Ga0496125_0523787_52_459 131
46 3300049574 Ga0501038_0087861 Ga0501038_0087861_57_464 131
47 3300049579 Ga0501043_0069201 Ga0501043_0069201_222_629 131
48 3300031995 Ga0307409_101165762 Ga0307409_1011657622 135
49 3300003316 rootH1_10025939 rootH1_100259394 148
50 3300003320 rootH2_10037340 rootH2_100373405 148
51 3300003323 rootH1_10023157 rootH1_100231576 148
52 iso_pu_bacteria 2510461076 2510898247 148
53 iso_pu_bacteria 2510917022 2511133938 148
54 iso_pu_bacteria 2513237085 2513580574 148
55 iso_pu_bacteria 2513237162 2514022962 148
56 iso_pu_bacteria 2515154113 2515638580 148
57 iso_pu_bacteria 2515154114 2515647191 148
58 iso_pu_bacteria 2515154116 2515661062 148
59 iso_pu_bacteria 2515154134 2515743160 148
60 iso_pu_bacteria 2516653085 2517075091 148
61 iso_pu_bacteria 2517287029 2517405496 148
62 iso_pu_bacteria 2582581307 2585275239 148
63 iso_pu_bacteria 2585427526 2585525253 148
64 iso_pu_bacteria 2585427531 2585560318 148
65 iso_pu_bacteria 2585427608 2585901413 148
66 iso_pu_bacteria 2585427609 2585905497 148
67 iso_pu_bacteria 2585428125 2587979388 148
68 iso_pu_bacteria 2838686498 2838688994 148
69 iso_pu_bacteria 2838729681 2838731289 148
70 iso_pu_bacteria 2838742623 2838743817 148
71 iso_pu_bacteria 2842156927 2842159670 148
72 iso_pu_bacteria 2842163707 2842169459 148
73 iso_pu_bacteria 2842180545 2842183714 148
74 iso_pu_bacteria 2842229732 2842233806 148
75 iso_pu_bacteria 2842243621 2842245281 148
76 iso_pu_bacteria 2842257432 2842260069 148
77 iso_pu_bacteria 2842271015 2842278588 148
78 iso_pu_bacteria 2842304105 2842307148 148
79 iso_pu_bacteria 2844454524 2844455519 148
80 iso_pu_bacteria 2933570622 2933572739 148
81 iso_pu_bacteria 2935901341 2935906683 148
82 iso_pu_bacteria 8005301065 8005304195 148
83 iso_pu_bacteria 8005307578 8005310906 148
84 iso_pu_bacteria 8005688590 8005690619 148
85 iso_pu_bacteria 8023680758 8023687363 148
86 3300003322 rootL2_10004067 rootL2_100040673 149
87 3300003323 rootH1_10082836 rootH1_100828362 149
88 3300037471 Ga0395905_0000171 Ga0395905_0000171_31213_31677 149
89 3300045049 Ga0466959_0117008 Ga0466959_0117008_1037_1501 149
90 3300021384 Ga0213876_10030279 Ga0213876_100302792 150
91 3300039437 Ga0436365_1753497 Ga0436365_1753497_868_1329 150
92 3300031456 Ga0307513_10315688 Ga0307513_103156883 151
93 3300003215 JGI25153J46596_10029812 JGI25153J46596_100298122 152
94 3300003790 Ga0055528_1005639 Ga0055528_10056394 152
95 3300003792 Ga0055540_1051218 Ga0055540_10512182 152
96 3300005327 Ga0070658_10000193 Ga0070658_1000019347 152
97 3300005331 Ga0070670_100604855 Ga0070670_1006048552 152
98 3300005334 Ga0068869_100368754 Ga0068869_1003687543 152
99 3300005339 Ga0070660_100005845 Ga0070660_1000058455 152
100 3300005339 Ga0070660_100095072 Ga0070660_1000950722 152
101 3300005344 Ga0070661_100257840 Ga0070661_1002578401 152
102 3300005356 Ga0070674_100441788 Ga0070674_1004417882 152
103 3300005356 Ga0070674_100994590 Ga0070674_1009945902 152
104 3300005364 Ga0070673_100141314 Ga0070673_1001413143 152
105 3300005366 Ga0070659_100415694 Ga0070659_1004156942 152
106 3300005366 Ga0070659_101782188 Ga0070659_1017821881 152
107 3300005456 Ga0070678_100153253 Ga0070678_1001532531 152
108 3300005457 Ga0070662_101021762 Ga0070662_1010217621 152
109 3300005458 Ga0070681_10748268 Ga0070681_107482682 152
110 3300005539 Ga0068853_101455651 Ga0068853_1014556512 152
111 3300005548 Ga0070665_100069099 Ga0070665_1000690994 152
112 3300005548 Ga0070665_100197603 Ga0070665_1001976032 152
113 3300005563 Ga0068855_100008020 Ga0068855_1000080208 152
114 3300005577 Ga0068857_101410468 Ga0068857_1014104681 152
115 3300005614 Ga0068856_100033148 Ga0068856_1000331488 152
116 3300005614 Ga0068856_100093406 Ga0068856_1000934063 152
117 3300005616 Ga0068852_100001546 Ga0068852_1000015468 152
118 3300006038 Ga0075365_10459663 Ga0075365_104596632 152
119 3300006048 Ga0075363_100133075 Ga0075363_1001330752 152
120 3300006178 Ga0075367_10303498 Ga0075367_103034982 152
121 3300006186 Ga0075369_10038153 Ga0075369_100381532 152
122 3300006353 Ga0075370_10015313 Ga0075370_100153134 152
123 3300006353 Ga0075370_10080586 Ga0075370_100805863 152
124 3300006881 Ga0068865_100979858 Ga0068865_1009798582 152
125 3300006931 Ga0097620_100180081 Ga0097620_1001800812 152
126 3300006942 Ga0099824_1016622 Ga0099824_10166229 152
127 3300007265 Ga0099794_10321127 Ga0099794_103211272 152
128 3300009011 Ga0105251_10055351 Ga0105251_100553512 152
129 3300009093 Ga0105240_10000347 Ga0105240_1000034775 152
130 3300009093 Ga0105240_10017650 Ga0105240_1001765010 152
131 3300009545 Ga0105237_10627370 Ga0105237_106273702 152
132 3300009551 Ga0105238_10011631 Ga0105238_100116312 152
133 3300009551 Ga0105238_10519452 Ga0105238_105194522 152
134 3300009553 Ga0105249_12400672 Ga0105249_124006722 152
135 3300010375 Ga0105239_10050707 Ga0105239_100507078 152
136 3300010375 Ga0105239_10095975 Ga0105239_100959751 152
137 3300011119 Ga0105246_11448426 Ga0105246_114484262 152
138 3300013306 Ga0163162_11272086 Ga0163162_112720861 152
139 3300014497 Ga0182008_10072974 Ga0182008_100729742 152
140 3300025273 Ga0209673_1001024 Ga0209673_100102435 152
141 3300025291 Ga0209675_1005799 Ga0209675_10057992 152
142 3300025295 Ga0209564_1027096 Ga0209564_10270962 152
143 3300025297 Ga0209758_1004830 Ga0209758_10048302 152
144 3300025303 Ga0209051_1013650 Ga0209051_10136503 152
145 3300025321 Ga0207656_10145571 Ga0207656_101455712 152
146 3300025735 Ga0207713_1042036 Ga0207713_10420363 152
147 3300025909 Ga0207705_10001107 Ga0207705_100011076 152
148 3300025912 Ga0207707_10635161 Ga0207707_106351612 152
149 3300025913 Ga0207695_10000670 Ga0207695_1000067041 152
150 3300025913 Ga0207695_10075880 Ga0207695_100758806 152
151 3300025914 Ga0207671_10344810 Ga0207671_103448102 152
152 3300025914 Ga0207671_10501521 Ga0207671_105015212 152
153 3300025919 Ga0207657_10002059 Ga0207657_1000205910 152
154 3300025920 Ga0207649_10216811 Ga0207649_102168113 152
155 3300025921 Ga0207652_11052051 Ga0207652_110520511 152
156 3300025932 Ga0207690_10568089 Ga0207690_105680892 152
157 3300025933 Ga0207706_10870624 Ga0207706_108706242 152
158 3300025937 Ga0207669_10277039 Ga0207669_102770392 152
159 3300025938 Ga0207704_11207287 Ga0207704_112072871 152
160 3300025942 Ga0207689_10270344 Ga0207689_102703443 152
161 3300025949 Ga0207667_10000429 Ga0207667_1000042942 152
162 3300025960 Ga0207651_10115153 Ga0207651_101151533 152
163 3300026041 Ga0207639_10096035 Ga0207639_100960353 152
164 3300026078 Ga0207702_10028529 Ga0207702_100285298 152
165 3300026121 Ga0207683_10144594 Ga0207683_101445942 152
166 3300026142 Ga0207698_10001115 Ga0207698_100011158 152
167 3300028379 Ga0268266_10259757 Ga0268266_102597573 152
168 3300028380 Ga0268265_11005149 Ga0268265_110051492 152
169 3300028573 Ga0265334_10095297 Ga0265334_100952972 152
170 3300031247 Ga0265340_10147136 Ga0265340_101471362 152
171 3300031507 Ga0307509_10000008 Ga0307509_1000000819 152
172 3300031507 Ga0307509_10155814 Ga0307509_101558143 152
173 3300032002 Ga0307416_101521140 Ga0307416_1015211402 152
174 3300035691 Ga0373931_0200372 Ga0373931_0200372_561_1031 152
175 3300041441 Ga0451787_226835 Ga0451787_226835_230_694 152
176 3300041451 Ga0451791_0840209 Ga0451791_0840209_520_984 152
177 3300041452 Ga0451793_0797312 Ga0451793_0797312_222_686 152
178 3300041491 Ga0451833_0256410 Ga0451833_0256410_377_841 152
179 3300041494 Ga0451837_0205682 Ga0451837_0205682_14_478 152
180 3300041496 Ga0451839_1150549 Ga0451839_1150549_349_813 152
181 3300041498 Ga0451841_0112297 Ga0451841_0112297_1329_1793 152
182 3300041501 Ga0451845_0411381 Ga0451845_0411381_301_765 152
183 3300041503 Ga0451847_0214195 Ga0451847_0214195_184_648 152
184 3300041505 Ga0451849_0831447 Ga0451849_0831447_554_1018 152
185 3300041507 Ga0451851_1058339 Ga0451851_1058339_2286_2750 152
186 3300041509 Ga0451843_0199322 Ga0451843_0199322_349_813 152
187 3300041512 Ga0451853_1290613 Ga0451853_1290613_973_1437 152
188 3300046460 Ga0495638_0258891 Ga0495638_0258891_320_784 152
189 3300046462 Ga0495651_0522966 Ga0495651_0522966_163_636 152
190 3300046471 Ga0495650_0053816 Ga0495650_0053816_1053_1532 152
191 3300046500 Ga0495596_0088067 Ga0495596_0088067_101_565 152
192 3300046507 Ga0495606_0022625 Ga0495606_0022625_268_732 152
193 3300046515 Ga0495620_0029571 Ga0495620_0029571_1200_1664 152
194 3300046518 Ga0495631_0392279 Ga0495631_0392279_76_540 152
195 3300046519 Ga0495632_0095215 Ga0495632_0095215_211_675 152
196 3300046522 Ga0495643_0021433 Ga0495643_0021433_1204_1668 152
197 3300046522 Ga0495643_0053050 Ga0495643_0053050_1437_1901 152
198 3300046530 Ga0495654_0014720 Ga0495654_0014720_344_808 152
199 3300046542 Ga0495597_0193004 Ga0495597_0193004_268_732 152
200 3300046558 Ga0495633_0059309 Ga0495633_0059309_540_1004 152
201 3300046615 Ga0495656_0485537 Ga0495656_0485537_31_495 152
202 3300046616 Ga0495668_0609672 Ga0495668_0609672_52_516 152
203 3300046660 Ga0495625_0282919 Ga0495625_0282919_30_494 152
204 3300046674 Ga0495588_0284152 Ga0495588_0284152_348_812 152
205 3300047318 Ga0495636_0259819 Ga0495636_0259819_266_730 152
206 3300047323 Ga0495683_0284295 Ga0495683_0284295_114_578 152
207 3300047472 Ga0495686_0003605 Ga0495686_0003605_4517_4978 152
208 3300048091 Ga0495626_0049928 Ga0495626_0049928_710_1174 152
209 3300048919 Ga0496116_0005215 Ga0496116_0005215_10807_11271 152
210 3300048923 Ga0496120_0126705 Ga0496120_0126705_759_1223 152
211 3300048924 Ga0496121_0199207 Ga0496121_0199207_580_1044 152
212 3300048925 Ga0496122_0000488 Ga0496122_0000488_80550_81014 152
213 3300048926 Ga0496123_0002461 Ga0496123_0002461_1135_1599 152
214 3300050489 nmdc:mga03683_120013_c1 nmdc:mga03683_120013_c1_208_678 152
215 3300050489 nmdc:mga03683_318353_c1 nmdc:mga03683_318353_c1_55_537 152
216 3300050489 nmdc:mga03683_471799_c1 nmdc:mga03683_471799_c1_71_538 152
217 3300050492 nmdc:mga0yw44_106066_c1 nmdc:mga0yw44_106066_c1_441_911 152
218 3300050492 nmdc:mga0yw44_252424_c1 nmdc:mga0yw44_252424_c1_362_844 152
219 3300050494 nmdc:mga06z11_345399_c1 nmdc:mga06z11_345399_c1_47_529 152
220 3300050494 nmdc:mga06z11_73991_c1 nmdc:mga06z11_73991_c1_468_938 152
221 3300050496 nmdc:mga07m45_324546_c1 nmdc:mga07m45_324546_c1_125_607 152
222 3300050516 nmdc:mga0sz30_224776_c1 nmdc:mga0sz30_224776_c1_216_686 152
223 3300053086 Ga0500578_0218540 Ga0500578_0218540_368_832 152
224 3300053088 Ga0500644_0162646 Ga0500644_0162646_120_599 152
225 3300053118 Ga0500594_0046051 Ga0500594_0046051_581_1063 152
226 3300053118 Ga0500594_0149078 Ga0500594_0149078_113_577 152
227 3300053130 Ga0500642_0229651 Ga0500642_0229651_275_739 152
228 3300053134 Ga0500658_0000367 Ga0500658_0000367_10240_10704 152
229 3300053142 Ga0500577_0102261 Ga0500577_0102261_449_931 152
230 3300053146 Ga0500588_0077517 Ga0500588_0077517_501_968 152
231 3300053153 Ga0500616_0000501 Ga0500616_0000501_2186_2680 152
232 3300053153 Ga0500616_0165864 Ga0500616_0165864_384_848 152
233 3300053158 Ga0500627_0092263 Ga0500627_0092263_412_876 152
234 3300053730 Ga0500645_012980 Ga0500645_012980_2095_2574 152
235 3300002067 JGI24735J21928_10037041 JGI24735J21928_100370413 153
236 3300005327 Ga0070658_10552141 Ga0070658_105521412 153
237 3300005333 Ga0070677_10521076 Ga0070677_105210761 153
238 3300005355 Ga0070671_101242610 Ga0070671_1012426101 153
239 3300005364 Ga0070673_101776364 Ga0070673_1017763641 153
240 3300005539 Ga0068853_101294818 Ga0068853_1012948182 153
241 3300005563 Ga0068855_100242428 Ga0068855_1002424282 153
242 3300005842 Ga0068858_100000119 Ga0068858_10000011940 153
243 3300006237 Ga0097621_101755717 Ga0097621_1017557171 153
244 3300006358 Ga0068871_101657349 Ga0068871_1016573491 153
245 3300009098 Ga0105245_10000480 Ga0105245_1000048029 153
246 3300009551 Ga0105238_10144816 Ga0105238_101448163 153
247 3300013297 Ga0157378_10571422 Ga0157378_105714222 153
248 3300013306 Ga0163162_10902867 Ga0163162_109028672 153
249 3300014745 Ga0157377_10189375 Ga0157377_101893752 153
250 3300025208 Ga0209436_114429 Ga0209436_1144293 153
251 3300025298 Ga0209050_1006341 Ga0209050_100634110 153
252 3300025302 Ga0207426_1081670 Ga0207426_10816701 153
253 3300025924 Ga0207694_10050591 Ga0207694_100505912 153
254 3300025927 Ga0207687_10000882 Ga0207687_100008829 153
255 3300025960 Ga0207651_11327670 Ga0207651_113276701 153
256 3300025986 Ga0207658_10370661 Ga0207658_103706611 153
257 3300026035 Ga0207703_10000161 Ga0207703_1000016154 153
258 3300026041 Ga0207639_10670251 Ga0207639_106702512 153
259 3300026142 Ga0207698_10662838 Ga0207698_106628382 153
260 3300026142 Ga0207698_11689263 Ga0207698_116892631 153
261 3300031456 Ga0307513_10003074 Ga0307513_1000307420 153
262 3300031616 Ga0307508_10000165 Ga0307508_1000016559 153
263 3300037471 Ga0395905_0081984 Ga0395905_0081984_1639_2103 153
264 3300046459 Ga0495629_0794121 Ga0495629_0794121_37_519 153
265 3300046492 Ga0495585_0062781 Ga0495585_0062781_793_1275 153
266 3300046526 Ga0495666_0145146 Ga0495666_0145146_376_846 153
267 3300046529 Ga0495652_0249737 Ga0495652_0249737_221_703 153
268 3300048929 Ga0496126_0000542 Ga0496126_0000542_12107_12589 153
269 3300048929 Ga0496126_0032668 Ga0496126_0032668_2034_2501 153
270 3300048929 Ga0496126_0758497 Ga0496126_0758497_63_530 153
271 3300053136 Ga0500559_0172890 Ga0500559_0172890_33_515 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

20

152

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.9164 11 149
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8783 10 150
2luz-assembly1.cif.gz_A solution nmr structure of calu16 from micromonospora echinospora, northeast structural genomics consortium (nesg) target mir12 0.873 12 148
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8646 11 149
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8631 10 151
ID Description Score Start End Superfamily
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8895 9 151 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.873 12 148 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.846 9 151 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8345 11 147 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8143 13 151 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A5C1AW71-F1-model_v4 SRPBCC domain-containing protein 0.9986 9 152
AF-X1GE22-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9936 15 137
AF-A0A1F4J8V9-F1-model_v4 deleted 0.9924 9 151
AF-H5YJN1-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9898 9 152
AF-A0A1Y2Q7M6-F1-model_v4 ATPase 0.9865 10 152

Feature Viewer

pLDDT pTM Quality
93.48 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map