F377516

General Info

Members Datasets Scaffolds Average Seq Length
271 164 542 159

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100012262|Ga0068853_1000122622
Length 171
Sequence MSLDQWSSFAQIIGSIGVVLSLIFVGLQIRQNTNVLQRNEHNSTMTQWTVVRMAIAQNRDIAELMTSGLQGGALDAADQLRLEQMLQEQAWAAFHIWDRTQRGVFPKGTFEQTGGALLSQILTTPRGETWWRDAKHIGFVPGFVADVDAVLSKARASSANSASAPGTGIAP

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 5.54
Rhizosphere 93.73
Stem 0
Stem Tuber 0
Unclassified 19.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100012262 3300005539 Bacteria 6969
2 Ga0065712_10319201 3300005290 Unclassified 825
3 Ga0065712_10375616 3300005290 Bacteria 758
4 Ga0070676_10957495 3300005328 Unclassified 640
5 Ga0070690_100013445 3300005330 Bacteria 4837
6 Ga0070690_100014159 3300005330 Bacteria 4728
7 Ga0070690_100123675 3300005330 Unclassified 1739
8 Ga0070670_100745904 3300005331 Bacteria 882
9 Ga0068869_100032910 3300005334 Bacteria 3657
10 Ga0068869_100269464 3300005334 Bacteria 1366
11 Ga0068869_101184054 3300005334 Bacteria 671
12 Ga0070666_10315641 3300005335 Bacteria 1114
13 Ga0070666_10486639 3300005335 Bacteria 894
14 Ga0070682_101127842 3300005337 Unclassified 658
15 Ga0068868_100027806 3300005338 Bacteria 4317
16 Ga0068868_100101299 3300005338 Bacteria 2331
17 Ga0068868_100142630 3300005338 Bacteria 1968
18 Ga0068868_100430138 3300005338 Bacteria 1144
19 Ga0070689_100118945 3300005340 Bacteria 2109
20 Ga0070689_100263305 3300005340 Bacteria 1426
21 Ga0070661_101171897 3300005344 Bacteria 642
22 Ga0070668_100161100 3300005347 Bacteria 1821
23 Ga0070668_100345422 3300005347 Bacteria 1258
24 Ga0070669_100059766 3300005353 Bacteria 2799
25 Ga0070669_100978480 3300005353 Unclassified 725
26 Ga0070671_100458794 3300005355 Bacteria 1094
27 Ga0070674_100298302 3300005356 Bacteria 1284
28 Ga0070674_100354124 3300005356 Bacteria 1187
29 Ga0070673_100864386 3300005364 Unclassified 837
30 Ga0070688_100124200 3300005365 Unclassified 1733
31 Ga0070667_100135495 3300005367 Bacteria 2153
32 Ga0070667_100213459 3300005367 Bacteria 1716
33 Ga0070667_100440838 3300005367 Bacteria 1189
34 Ga0070667_100644024 3300005367 Bacteria 978
35 Ga0070667_100687308 3300005367 Unclassified 946
36 Ga0070714_100101853 3300005435 Bacteria 2531
37 Ga0070714_100122479 3300005435 Bacteria 2315
38 Ga0070713_100017027 3300005436 Bacteria 5482
39 Ga0070710_10012249 3300005437 Bacteria 4253
40 Ga0070711_100083414 3300005439 Bacteria 2283
41 Ga0070711_100977266 3300005439 Bacteria 725
42 Ga0070705_100104749 3300005440 Unclassified 1794
43 Ga0070708_100110385 3300005445 Bacteria 2527
44 Ga0070678_100052872 3300005456 Bacteria 2951
45 Ga0070678_100388265 3300005456 Bacteria 1209
46 Ga0070678_100528450 3300005456 Bacteria 1045
47 Ga0070662_100188159 3300005457 Bacteria 1631
48 Ga0068867_100012305 3300005459 Bacteria 6052
49 Ga0068867_100072560 3300005459 Unclassified 2577
50 Ga0068867_100100285 3300005459 Bacteria 2211
51 Ga0068867_100133051 3300005459 Bacteria 1935
52 Ga0070706_100911553 3300005467 Unclassified 812
53 Ga0070679_100421104 3300005530 Unclassified 1281
54 Ga0070697_101365156 3300005536 Bacteria 633
55 Ga0068853_100423209 3300005539 Bacteria 1249
56 Ga0070672_100011483 3300005543 Bacteria 6177
57 Ga0070672_100255997 3300005543 Bacteria 1475
58 Ga0070672_101774021 3300005543 Unclassified 555
59 Ga0070686_100061429 3300005544 Bacteria 2428
60 Ga0070695_100464978 3300005545 Bacteria 972
61 Ga0070665_100084294 3300005548 Bacteria 3183
62 Ga0070665_100161557 3300005548 Bacteria 2242
63 Ga0070665_100246905 3300005548 Bacteria 1785
64 Ga0070704_100153916 3300005549 Bacteria 1811
65 Ga0068855_100151837 3300005563 Bacteria 2633
66 Ga0068855_100389089 3300005563 Bacteria 1530
67 Ga0068854_100286520 3300005578 Unclassified 1328
68 Ga0068854_101498172 3300005578 Unclassified 612
69 Ga0068856_101050180 3300005614 Unclassified 833
70 Ga0068852_101020054 3300005616 Bacteria 846
71 Ga0068859_100278274 3300005617 Bacteria 1766
72 Ga0068859_100321334 3300005617 Bacteria 1642
73 Ga0068859_101162417 3300005617 Unclassified 849
74 Ga0068864_100141491 3300005618 Bacteria 2170
75 Ga0068861_100807126 3300005719 Bacteria 881
76 Ga0068870_10084364 3300005840 Bacteria 1763
77 Ga0068863_100016404 3300005841 Bacteria 7106
78 Ga0068863_100120305 3300005841 Bacteria 2503
79 Ga0068863_100676509 3300005841 Bacteria 1025
80 Ga0068858_100070569 3300005842 Bacteria 3238
81 Ga0068858_100402424 3300005842 Bacteria 1315
82 Ga0068860_100516071 3300005843 Bacteria 1195
83 Ga0068860_100979098 3300005843 Bacteria 863
84 Ga0070717_10012975 3300006028 Bacteria 6365
85 Ga0070712_100192899 3300006175 Bacteria 1595
86 Ga0070712_100498524 3300006175 Bacteria 1020
87 Ga0097621_100049278 3300006237 Unclassified 3421
88 Ga0068871_100145125 3300006358 Bacteria 2020
89 Ga0068871_100776778 3300006358 Unclassified 882
90 Ga0068865_100012536 3300006881 Bacteria 5339
91 Ga0068865_100025225 3300006881 Bacteria 3907
92 Ga0068865_100027785 3300006881 Bacteria 3740
93 Ga0075436_100563870 3300006914 Bacteria 837
94 Ga0097620_100278304 3300006931 Bacteria 1766
95 Ga0097620_100321352 3300006931 Bacteria 1642
96 Ga0097620_101162397 3300006931 Unclassified 849
97 Ga0099795_10000022 3300007788 Bacteria 52585
98 Ga0105240_10126877 3300009093 Bacteria 3065
99 Ga0105240_10354568 3300009093 Unclassified 1663
100 Ga0111539_10240661 3300009094 Unclassified 2107
101 Ga0105245_10016112 3300009098 Bacteria 6513
102 Ga0105245_10509379 3300009098 Bacteria 1221
103 Ga0105241_10092612 3300009174 Bacteria 2387
104 Ga0105242_10016336 3300009176 Bacteria 5772
105 Ga0105242_10074015 3300009176 Bacteria 2833
106 Ga0105248_10176114 3300009177 Bacteria 2410
107 Ga0105248_10225895 3300009177 Bacteria 2107
108 Ga0105248_10367976 3300009177 Bacteria 1618
109 Ga0105237_10072916 3300009545 Bacteria 3426
110 Ga0105237_10187448 3300009545 Bacteria 2069
111 Ga0105237_10331864 3300009545 Bacteria 1525
112 Ga0105238_10045802 3300009551 Bacteria 4418
113 Ga0105238_10213378 3300009551 Bacteria 1907
114 Ga0105238_11310396 3300009551 Unclassified 750
115 Ga0099796_10000025 3300010159 Bacteria 37858
116 Ga0105239_10157346 3300010375 Bacteria 2538
117 Ga0105239_10277960 3300010375 Unclassified 1884
118 Ga0157373_10328314 3300013100 Bacteria 1089
119 Ga0157373_10960916 3300013100 Bacteria 636
120 Ga0157370_10075734 3300013104 Bacteria 3171
121 Ga0157369_10095597 3300013105 Bacteria 3170
122 Ga0157374_10017879 3300013296 Bacteria 6249
123 Ga0157374_11314551 3300013296 Unclassified 745
124 Ga0157378_10254494 3300013297 Bacteria 1682
125 Ga0157378_10267615 3300013297 Bacteria 1642
126 Ga0157378_11147876 3300013297 Bacteria 815
127 Ga0157378_11183803 3300013297 Unclassified 803
128 Ga0163162_10679422 3300013306 Bacteria 1152
129 Ga0157372_10155051 3300013307 Bacteria 2645
130 Ga0157372_10488824 3300013307 Bacteria 1435
131 Ga0157375_10335540 3300013308 Bacteria 1677
132 Ga0157375_10358838 3300013308 Unclassified 1623
133 Ga0157375_10490339 3300013308 Bacteria 1393
134 Ga0163163_10406782 3300014325 Bacteria 1419
135 Ga0157379_10156519 3300014968 Bacteria 2056
136 Ga0157379_10200924 3300014968 Bacteria 1803
137 Ga0157376_10707534 3300014969 Bacteria 1013
138 Ga0163161_10198584 3300017792 Bacteria 1545
139 Ga0163161_10235522 3300017792 Bacteria 1422
140 Ga0207692_10160691 3300025898 Bacteria 1294
141 Ga0207710_10040118 3300025900 Bacteria 2074
142 Ga0207680_10129123 3300025903 Bacteria 1664
143 Ga0207685_10226033 3300025905 Bacteria 893
144 Ga0207699_10251731 3300025906 Bacteria 1217
145 Ga0207699_10282420 3300025906 Bacteria 1154
146 Ga0207699_10341532 3300025906 Bacteria 1055
147 Ga0207645_10361978 3300025907 Unclassified 972
148 Ga0207643_10108704 3300025908 Bacteria 1632
149 Ga0207654_10026599 3300025911 Bacteria 3135
150 Ga0207695_10052132 3300025913 Bacteria 4288
151 Ga0207695_10082033 3300025913 Bacteria 3262
152 Ga0207671_10110751 3300025914 Bacteria 2089
153 Ga0207671_10428247 3300025914 Bacteria 1053
154 Ga0207693_10271773 3300025915 Bacteria 1328
155 Ga0207693_10400003 3300025915 Bacteria 1074
156 Ga0207663_10782124 3300025916 Bacteria 759
157 Ga0207662_10606280 3300025918 Bacteria 762
158 Ga0207652_10335490 3300025921 Unclassified 1365
159 Ga0207646_10266396 3300025922 Bacteria 1549
160 Ga0207681_10099053 3300025923 Bacteria 2098
161 Ga0207694_10113913 3300025924 Bacteria 2153
162 Ga0207694_10411114 3300025924 Unclassified 1126
163 Ga0207694_10668670 3300025924 Unclassified 875
164 Ga0207659_10073008 3300025926 Bacteria 2511
165 Ga0207687_10278883 3300025927 Unclassified 1339
166 Ga0207700_10476731 3300025928 Bacteria 1102
167 Ga0207664_10088948 3300025929 Bacteria 2528
168 Ga0207644_10262741 3300025931 Unclassified 1381
169 Ga0207686_10107520 3300025934 Unclassified 1875
170 Ga0207686_10441492 3300025934 Bacteria 999
171 Ga0207686_10948316 3300025934 Bacteria 696
172 Ga0207670_10360819 3300025936 Bacteria 1153
173 Ga0207669_10115113 3300025937 Bacteria 1812
174 Ga0207669_10407059 3300025937 Unclassified 1067
175 Ga0207704_10041897 3300025938 Bacteria 2690
176 Ga0207704_10057769 3300025938 Bacteria 2385
177 Ga0207704_10336458 3300025938 Bacteria 1170
178 Ga0207691_10049068 3300025940 Bacteria 3868
179 Ga0207691_10503362 3300025940 Bacteria 1029
180 Ga0207711_10008208 3300025941 Bacteria 8739
181 Ga0207711_10028021 3300025941 Bacteria 4737
182 Ga0207711_10060542 3300025941 Bacteria 3263
183 Ga0207689_10133222 3300025942 Bacteria 2046
184 Ga0207689_10227304 3300025942 Bacteria 1542
185 Ga0207689_11018631 3300025942 Bacteria 698
186 Ga0207667_10108717 3300025949 Bacteria 2860
187 Ga0207667_10858758 3300025949 Bacteria 901
188 Ga0207651_10444528 3300025960 Bacteria 1111
189 Ga0207712_10107879 3300025961 Bacteria 2083
190 Ga0207668_10681317 3300025972 Bacteria 902
191 Ga0207668_11049421 3300025972 Unclassified 730
192 Ga0207640_10256128 3300025981 Unclassified 1361
193 Ga0207640_10790307 3300025981 Unclassified 821
194 Ga0207658_10056466 3300025986 Bacteria 2914
195 Ga0207658_10096749 3300025986 Bacteria 2303
196 Ga0207658_10392381 3300025986 Bacteria 1218
197 Ga0207677_10091075 3300026023 Bacteria 2217
198 Ga0207677_10266421 3300026023 Bacteria 1399
199 Ga0207703_10588773 3300026035 Unclassified 1051
200 Ga0207639_10386201 3300026041 Bacteria 1258
201 Ga0207639_10802032 3300026041 Unclassified 877
202 Ga0207702_10360217 3300026078 Bacteria 1394
203 Ga0207648_10060986 3300026089 Bacteria 3289
204 Ga0207648_10124895 3300026089 Bacteria 2263
205 Ga0207648_10201187 3300026089 Bacteria 1766
206 Ga0207648_10221614 3300026089 Bacteria 1681
207 Ga0207676_10098006 3300026095 Bacteria 2423
208 Ga0207676_10500194 3300026095 Bacteria 1154
209 Ga0207674_10814109 3300026116 Bacteria 901
210 Ga0207675_101279773 3300026118 Bacteria 754
211 Ga0207683_10029936 3300026121 Bacteria 4715
212 Ga0207683_10039022 3300026121 Bacteria 4142
213 Ga0207683_10435215 3300026121 Bacteria 1209
214 Ga0207683_11929311 3300026121 Bacteria 539
215 Ga0209179_1000048 3300027512 Bacteria 23370
216 Ga0268266_10160487 3300028379 Bacteria 2033
217 Ga0268266_10581154 3300028379 Bacteria 1075
218 Ga0268266_10749097 3300028379 Bacteria 943
219 Ga0268266_11335520 3300028379 Unclassified 692
220 Ga0268265_10388043 3300028380 Bacteria 1287
221 Ga0265338_10080701 3300028800 Bacteria 2732
222 Ga0307406_10412196 3300031901 Bacteria 1074
223 Ga0307409_100103407 3300031995 Bacteria 2369
224 Ga0307416_100375721 3300032002 Bacteria 1449
225 Ga0307411_10022001 3300032005 Bacteria 3745
226 Ga0307415_100998289 3300032126 Bacteria 778
227 Ga0307415_101148808 3300032126 Bacteria 729
228 Ga0373939_0253078 3300035114 Bacteria 686
229 Ga0373943_0260979 3300035170 Bacteria 975
230 Ga0373962_0109939 3300035242 Bacteria 869
231 Ga0373931_0134637 3300035691 Bacteria 1426
232 Ga0373935_0036093 3300035692 Bacteria 3089
233 Ga0373927_0004729 3300035695 Bacteria 9491
234 Ga0373927_0043239 3300035695 Unclassified 2918
235 Ga0373927_0207120 3300035695 Bacteria 1288
236 Ga0373925_0310913 3300037068 Bacteria 1274
237 Ga0373925_0337410 3300037068 Unclassified 1222
238 Ga0395905_0555685 3300037471 Unclassified 1049
239 Ga0436365_0286016 3300039437 Bacteria 9300
240 Ga0436362_0037983 3300039453 Bacteria 971
241 Ga0451798_0564520 3300041458 Unclassified 615
242 Ga0451807_1798639 3300041486 Unclassified 646
243 Ga0451577_0108794 3300042876 Bacteria 2478
244 Ga0453684_0208021 3300044712 Bacteria 2276
245 Ga0495580_0001246 3300046472 Bacteria 22461
246 Ga0495580_0042074 3300046472 Bacteria 3256
247 Ga0495662_0271871 3300046476 Bacteria 834
248 Ga0495618_0355068 3300046514 Bacteria 903
249 Ga0495628_0916877 3300046516 Bacteria 607
250 Ga0495634_0191606 3300046642 Bacteria 1275
251 Ga0495647_0311493 3300046681 Unclassified 711
252 Ga0495671_0561156 3300046692 Bacteria 543
253 Ga0496101_0436541 3300048904 Unclassified 1033
254 Ga0496101_1067638 3300048904 Unclassified 634
255 Ga0496104_0383308 3300048907 Bacteria 1318
256 Ga0496104_0543403 3300048907 Unclassified 1073
257 Ga0496104_0967909 3300048907 Bacteria 755
258 Ga0496105_0264905 3300048908 Bacteria 1389
259 Ga0496109_0129720 3300048912 Bacteria 2352
260 Ga0496111_0489713 3300048914 Bacteria 905
261 Ga0496112_0198438 3300048915 Unclassified 1967
262 Ga0496114_0139858 3300048917 Bacteria 2095
263 Ga0496114_0262435 3300048917 Unclassified 1521
264 Ga0496115_0026679 3300048918 Unclassified 4511
265 Ga0496115_1126363 3300048918 Bacteria 593
266 Ga0501076_0150394 3300049592 Bacteria 1894
267 Ga0495601_0508181 3300053077 Bacteria 777
268 Ga0495612_0355246 3300053078 Bacteria 662
269 Ga0500566_0386986 3300053094 Bacteria 630
270 Ga0501082_1125929 3300060353 Bacteria 686
271 Ga0530510_0935435 3300061734 Bacteria 663
272 Ga0068853_100012262
273 Ga0065712_10319201
274 Ga0065712_10375616
275 Ga0070676_10957495
276 Ga0070690_100013445
277 Ga0070690_100014159
278 Ga0070690_100123675
279 Ga0070670_100745904
280 Ga0068869_100032910
281 Ga0068869_100269464
282 Ga0068869_101184054
283 Ga0070666_10315641
284 Ga0070666_10486639
285 Ga0070682_101127842
286 Ga0068868_100027806
287 Ga0068868_100101299
288 Ga0068868_100142630
289 Ga0068868_100430138
290 Ga0070689_100118945
291 Ga0070689_100263305
292 Ga0070661_101171897
293 Ga0070668_100161100
294 Ga0070668_100345422
295 Ga0070669_100059766
296 Ga0070669_100978480
297 Ga0070671_100458794
298 Ga0070674_100298302
299 Ga0070674_100354124
300 Ga0070673_100864386
301 Ga0070688_100124200
302 Ga0070667_100135495
303 Ga0070667_100213459
304 Ga0070667_100440838
305 Ga0070667_100644024
306 Ga0070667_100687308
307 Ga0070714_100101853
308 Ga0070714_100122479
309 Ga0070713_100017027
310 Ga0070710_10012249
311 Ga0070711_100083414
312 Ga0070711_100977266
313 Ga0070705_100104749
314 Ga0070708_100110385
315 Ga0070678_100052872
316 Ga0070678_100388265
317 Ga0070678_100528450
318 Ga0070662_100188159
319 Ga0068867_100012305
320 Ga0068867_100072560
321 Ga0068867_100100285
322 Ga0068867_100133051
323 Ga0070706_100911553
324 Ga0070679_100421104
325 Ga0070697_101365156
326 Ga0068853_100423209
327 Ga0070672_100011483
328 Ga0070672_100255997
329 Ga0070672_101774021
330 Ga0070686_100061429
331 Ga0070695_100464978
332 Ga0070665_100084294
333 Ga0070665_100161557
334 Ga0070665_100246905
335 Ga0070704_100153916
336 Ga0068855_100151837
337 Ga0068855_100389089
338 Ga0068854_100286520
339 Ga0068854_101498172
340 Ga0068856_101050180
341 Ga0068852_101020054
342 Ga0068859_100278274
343 Ga0068859_100321334
344 Ga0068859_101162417
345 Ga0068864_100141491
346 Ga0068861_100807126
347 Ga0068870_10084364
348 Ga0068863_100016404
349 Ga0068863_100120305
350 Ga0068863_100676509
351 Ga0068858_100070569
352 Ga0068858_100402424
353 Ga0068860_100516071
354 Ga0068860_100979098
355 Ga0070717_10012975
356 Ga0070712_100192899
357 Ga0070712_100498524
358 Ga0097621_100049278
359 Ga0068871_100145125
360 Ga0068871_100776778
361 Ga0068865_100012536
362 Ga0068865_100025225
363 Ga0068865_100027785
364 Ga0075436_100563870
365 Ga0097620_100278304
366 Ga0097620_100321352
367 Ga0097620_101162397
368 Ga0099795_10000022
369 Ga0105240_10126877
370 Ga0105240_10354568
371 Ga0111539_10240661
372 Ga0105245_10016112
373 Ga0105245_10509379
374 Ga0105241_10092612
375 Ga0105242_10016336
376 Ga0105242_10074015
377 Ga0105248_10176114
378 Ga0105248_10225895
379 Ga0105248_10367976
380 Ga0105237_10072916
381 Ga0105237_10187448
382 Ga0105237_10331864
383 Ga0105238_10045802
384 Ga0105238_10213378
385 Ga0105238_11310396
386 Ga0099796_10000025
387 Ga0105239_10157346
388 Ga0105239_10277960
389 Ga0157373_10328314
390 Ga0157373_10960916
391 Ga0157370_10075734
392 Ga0157369_10095597
393 Ga0157374_10017879
394 Ga0157374_11314551
395 Ga0157378_10254494
396 Ga0157378_10267615
397 Ga0157378_11147876
398 Ga0157378_11183803
399 Ga0163162_10679422
400 Ga0157372_10155051
401 Ga0157372_10488824
402 Ga0157375_10335540
403 Ga0157375_10358838
404 Ga0157375_10490339
405 Ga0163163_10406782
406 Ga0157379_10156519
407 Ga0157379_10200924
408 Ga0157376_10707534
409 Ga0163161_10198584
410 Ga0163161_10235522
411 Ga0207692_10160691
412 Ga0207710_10040118
413 Ga0207680_10129123
414 Ga0207685_10226033
415 Ga0207699_10251731
416 Ga0207699_10282420
417 Ga0207699_10341532
418 Ga0207645_10361978
419 Ga0207643_10108704
420 Ga0207654_10026599
421 Ga0207695_10052132
422 Ga0207695_10082033
423 Ga0207671_10110751
424 Ga0207671_10428247
425 Ga0207693_10271773
426 Ga0207693_10400003
427 Ga0207663_10782124
428 Ga0207662_10606280
429 Ga0207652_10335490
430 Ga0207646_10266396
431 Ga0207681_10099053
432 Ga0207694_10113913
433 Ga0207694_10411114
434 Ga0207694_10668670
435 Ga0207659_10073008
436 Ga0207687_10278883
437 Ga0207700_10476731
438 Ga0207664_10088948
439 Ga0207644_10262741
440 Ga0207686_10107520
441 Ga0207686_10441492
442 Ga0207686_10948316
443 Ga0207670_10360819
444 Ga0207669_10115113
445 Ga0207669_10407059
446 Ga0207704_10041897
447 Ga0207704_10057769
448 Ga0207704_10336458
449 Ga0207691_10049068
450 Ga0207691_10503362
451 Ga0207711_10008208
452 Ga0207711_10028021
453 Ga0207711_10060542
454 Ga0207689_10133222
455 Ga0207689_10227304
456 Ga0207689_11018631
457 Ga0207667_10108717
458 Ga0207667_10858758
459 Ga0207651_10444528
460 Ga0207712_10107879
461 Ga0207668_10681317
462 Ga0207668_11049421
463 Ga0207640_10256128
464 Ga0207640_10790307
465 Ga0207658_10056466
466 Ga0207658_10096749
467 Ga0207658_10392381
468 Ga0207677_10091075
469 Ga0207677_10266421
470 Ga0207703_10588773
471 Ga0207639_10386201
472 Ga0207639_10802032
473 Ga0207702_10360217
474 Ga0207648_10060986
475 Ga0207648_10124895
476 Ga0207648_10201187
477 Ga0207648_10221614
478 Ga0207676_10098006
479 Ga0207676_10500194
480 Ga0207674_10814109
481 Ga0207675_101279773
482 Ga0207683_10029936
483 Ga0207683_10039022
484 Ga0207683_10435215
485 Ga0207683_11929311
486 Ga0209179_1000048
487 Ga0268266_10160487
488 Ga0268266_10581154
489 Ga0268266_10749097
490 Ga0268266_11335520
491 Ga0268265_10388043
492 Ga0265338_10080701
493 Ga0307406_10412196
494 Ga0307409_100103407
495 Ga0307416_100375721
496 Ga0307411_10022001
497 Ga0307415_100998289
498 Ga0307415_101148808
499 Ga0373939_0253078
500 Ga0373943_0260979
501 Ga0373962_0109939
502 Ga0373931_0134637
503 Ga0373935_0036093
504 Ga0373927_0004729
505 Ga0373927_0043239
506 Ga0373927_0207120
507 Ga0373925_0310913
508 Ga0373925_0337410
509 Ga0395905_0555685
510 Ga0436365_0286016
511 Ga0436362_0037983
512 Ga0451798_0564520
513 Ga0451807_1798639
514 Ga0451577_0108794
515 Ga0453684_0208021
516 Ga0495580_0001246
517 Ga0495580_0042074
518 Ga0495662_0271871
519 Ga0495618_0355068
520 Ga0495628_0916877
521 Ga0495634_0191606
522 Ga0495647_0311493
523 Ga0495671_0561156
524 Ga0496101_0436541
525 Ga0496101_1067638
526 Ga0496104_0383308
527 Ga0496104_0543403
528 Ga0496104_0967909
529 Ga0496105_0264905
530 Ga0496109_0129720
531 Ga0496111_0489713
532 Ga0496112_0198438
533 Ga0496114_0139858
534 Ga0496114_0262435
535 Ga0496115_0026679
536 Ga0496115_1126363
537 Ga0501076_0150394
538 Ga0495601_0508181
539 Ga0495612_0355246
540 Ga0500566_0386986
541 Ga0501082_1125929
542 Ga0530510_0935435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mq5-assembly2.cif.gz_B structure of human clasp1 tog1 0.6077 83 155
4ulv-assembly1.cif.gz_B cytochrome c prime from shewanella frigidimarina 0.5188 73 155
5oqm-assembly1.cif.gz_1 structure of yeast transcription pre-initiation complex with tfiih and core mediator 0.503 73 153
6a5q-assembly2.cif.gz_C-2 structure of 14-3-3 beta in complex with tfeb 14-3-3 binding motif 0.4853 49 158
5wfx-assembly1.cif.gz_B structural basis for the interaction of 14-3-3beta with tricarboxylic acid cycle intermediate malate 0.4793 49 158
ID Description Score Start End Superfamily
af_A0A0R0GN37_483_627_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6259 64 154 1.25.40.10
af_O62204_67_160_1.20.960.10 Mainly Alpha;Up-down Bundle;Mitochondrial Import Receptor Subunit Tom20; Chain A;Mitochondrial outer membrane translocase complex, subunit Tom20 domain 0.5088 57 155 1.20.960.10
2btpA01 Mainly Alpha;Up-down Bundle;Delta-Endotoxin; domain 1;14-3-3 domain 0.4624 53 158 1.20.190.20
af_Q9VBZ6_175_374_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4601 64 153 1.25.40.10
2rldD00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.4576 65 155 1.20.1440.60
ID Description Score Start End GO Terms
AF-A0A2V6LAU1-F1-model_v4 Uncharacterized protein 0.9825 66 157
AF-A0A7C7WDY1-F1-model_v4 deleted 0.9121 52 154
AF-A0A2V6LWB6-F1-model_v4 Uncharacterized protein 0.8724 35 157
AF-A0A7C7WDY1-F1-model_v4 deleted 0.8646 52 154
AF-A0A2V6LAU1-F1-model_v4 Uncharacterized protein 0.8464 66 157

Map